F361359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 157 | 500 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100023879|Ga0070659_1000238793 |
| Length | 309 |
| Sequence | VHDSGASRPRGSVCLSIRERLTGPPVSGKRPRRAAYALPTLFTSANIFLGFVAILQAFEGALLAKSGDLTTNVHFAIAAKALAFAVLFDGLDGRIARMTNTTSDFGRELDSLADVITFGIAPAVLVFVWGVLFVVPPGDGPVQSQLDRAGYLVSFFYLLCGAVRLARFNVQTNPLPKNPGRPDRKYFVGLPIPAGAGFVAAVVYMDASPVRSLVFSILWLIVTVIVSLLMVSTWRYPSFKQVSISKPRTPLTVLVVAGIAFLISQWSQPVLLIVACAYLLSGIVIRIGGIVRRHRKSRHHASLPEHQVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 58 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 89 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 91 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 94 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 95 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 98 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 100 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 105 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 106 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 107 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 108 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 111 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 112 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 113 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 114 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 154 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 156 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 157 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98 |
| Metatranscriptomes | 0.8 |
| Isolates | 1.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.4 |
| Nodule | 0 |
| Rhizoplane | 0.8 |
| Rhizosphere | 74.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070659_100023879 | 3300005366 | Bacteria | 4683 |
| 2 | JGI25152J39213_1000783 | 3300002773 | Bacteria | 15988 |
| 3 | JGI25150J39212_1000793 | 3300002774 | Bacteria | 10765 |
| 4 | JGI25150J39212_1002828 | 3300002774 | Bacteria | 4199 |
| 5 | JGI25159J45721_1023822 | 3300002987 | Bacteria | 1102 |
| 6 | Ga0055526_1003470 | 3300003771 | Bacteria | 10007 |
| 7 | Ga0055524_1001762 | 3300003775 | Bacteria | 11945 |
| 8 | Ga0055524_1009442 | 3300003775 | Bacteria | 3965 |
| 9 | Ga0055524_1010331 | 3300003775 | Bacteria | 3727 |
| 10 | Ga0055534_1001540 | 3300003784 | Bacteria | 8992 |
| 11 | Ga0070658_10107311 | 3300005327 | Bacteria | 2311 |
| 12 | Ga0070683_100126507 | 3300005329 | Unclassified | 2416 |
| 13 | Ga0070683_100129832 | 3300005329 | Bacteria | 2384 |
| 14 | Ga0068868_100091328 | 3300005338 | Bacteria | 2453 |
| 15 | Ga0070689_100052408 | 3300005340 | Bacteria | 3156 |
| 16 | Ga0070689_100228292 | 3300005340 | Unclassified | 1529 |
| 17 | Ga0070668_100090709 | 3300005347 | Unclassified | 2408 |
| 18 | Ga0070667_100347047 | 3300005367 | Bacteria | 1343 |
| 19 | Ga0070709_10102516 | 3300005434 | Bacteria | 1909 |
| 20 | Ga0070714_100180158 | 3300005435 | Bacteria | 1922 |
| 21 | Ga0070713_100062859 | 3300005436 | Unclassified | 3110 |
| 22 | Ga0070708_100063530 | 3300005445 | Bacteria | 3305 |
| 23 | Ga0070708_100164101 | 3300005445 | Bacteria | 2071 |
| 24 | Ga0070678_100219007 | 3300005456 | Bacteria | 1581 |
| 25 | Ga0070681_10229279 | 3300005458 | Bacteria | 1772 |
| 26 | Ga0070681_10436111 | 3300005458 | Bacteria | 1222 |
| 27 | Ga0068867_100008454 | 3300005459 | Bacteria | 7261 |
| 28 | Ga0070685_10062915 | 3300005466 | Unclassified | 2177 |
| 29 | Ga0070706_100366983 | 3300005467 | Bacteria | 1341 |
| 30 | Ga0070707_100011671 | 3300005468 | Bacteria | 8196 |
| 31 | Ga0070707_100016271 | 3300005468 | Bacteria | 6981 |
| 32 | Ga0070707_100107442 | 3300005468 | Unclassified | 2707 |
| 33 | Ga0070699_100301691 | 3300005518 | Bacteria | 1437 |
| 34 | Ga0070679_100695211 | 3300005530 | Bacteria | 960 |
| 35 | Ga0070697_100000166 | 3300005536 | Bacteria | 53539 |
| 36 | Ga0070697_100068853 | 3300005536 | Bacteria | 2898 |
| 37 | Ga0068853_100013855 | 3300005539 | Bacteria | 6591 |
| 38 | Ga0068853_100523762 | 3300005539 | Unclassified | 1121 |
| 39 | Ga0070704_100209676 | 3300005549 | Bacteria | 1578 |
| 40 | Ga0068855_100009010 | 3300005563 | Bacteria | 12058 |
| 41 | Ga0068855_100045470 | 3300005563 | Bacteria | 5193 |
| 42 | Ga0068857_100241205 | 3300005577 | Bacteria | 1655 |
| 43 | Ga0068856_100004276 | 3300005614 | Bacteria | 14255 |
| 44 | Ga0068856_100113067 | 3300005614 | Bacteria | 2713 |
| 45 | Ga0068860_100296583 | 3300005843 | Unclassified | 1583 |
| 46 | Ga0070717_10029552 | 3300006028 | Bacteria | 4398 |
| 47 | Ga0097621_100038075 | 3300006237 | Bacteria | 3858 |
| 48 | Ga0097621_100178269 | 3300006237 | Bacteria | 1835 |
| 49 | Ga0068871_100005722 | 3300006358 | Bacteria | 8727 |
| 50 | Ga0075436_100032605 | 3300006914 | Bacteria | 3591 |
| 51 | Ga0075435_100177486 | 3300007076 | Bacteria | 1799 |
| 52 | Ga0105240_10158077 | 3300009093 | Bacteria | 2694 |
| 53 | Ga0105240_10213610 | 3300009093 | Unclassified | 2252 |
| 54 | Ga0105240_10245004 | 3300009093 | Unclassified | 2076 |
| 55 | Ga0111539_10216034 | 3300009094 | Bacteria | 2234 |
| 56 | Ga0105245_10057345 | 3300009098 | Bacteria | 3503 |
| 57 | Ga0105242_10157143 | 3300009176 | Bacteria | 1987 |
| 58 | Ga0105248_10113647 | 3300009177 | Bacteria | 3054 |
| 59 | Ga0105248_10596469 | 3300009177 | Bacteria | 1246 |
| 60 | Ga0105248_10609720 | 3300009177 | Bacteria | 1231 |
| 61 | Ga0105237_10026427 | 3300009545 | Bacteria | 5933 |
| 62 | Ga0105238_10151419 | 3300009551 | Bacteria | 2295 |
| 63 | Ga0105249_10501113 | 3300009553 | Unclassified | 1259 |
| 64 | Ga0105239_10137014 | 3300010375 | Bacteria | 2725 |
| 65 | Ga0105239_10325762 | 3300010375 | Bacteria | 1733 |
| 66 | Ga0157370_10132635 | 3300013104 | Bacteria | 2323 |
| 67 | Ga0157374_10077012 | 3300013296 | Unclassified | 3155 |
| 68 | Ga0157374_10352523 | 3300013296 | Unclassified | 1462 |
| 69 | Ga0157374_10515815 | 3300013296 | Unclassified | 1201 |
| 70 | Ga0163162_10266004 | 3300013306 | Bacteria | 1846 |
| 71 | Ga0163162_10569976 | 3300013306 | Bacteria | 1259 |
| 72 | Ga0157372_10032813 | 3300013307 | Bacteria | 5696 |
| 73 | Ga0157372_10427208 | 3300013307 | Bacteria | 1544 |
| 74 | Ga0157375_10280344 | 3300013308 | Bacteria | 1830 |
| 75 | Ga0157375_10521915 | 3300013308 | Bacteria | 1351 |
| 76 | Ga0163163_10037392 | 3300014325 | Bacteria | 4722 |
| 77 | Ga0157376_10015317 | 3300014969 | Bacteria | 5790 |
| 78 | Ga0206356_11607969 | 3300020070 | Bacteria | 947 |
| 79 | Ga0213872_10000098 | 3300021361 | Bacteria | 80168 |
| 80 | Ga0213876_10002968 | 3300021384 | Bacteria | 9831 |
| 81 | Ga0213876_10049508 | 3300021384 | Unclassified | 2220 |
| 82 | Ga0213875_10000056 | 3300021388 | Bacteria | 136543 |
| 83 | Ga0213875_10000108 | 3300021388 | Bacteria | 94421 |
| 84 | Ga0213875_10005880 | 3300021388 | Bacteria | 6519 |
| 85 | Ga0213875_10012698 | 3300021388 | Bacteria | 4148 |
| 86 | Ga0213875_10016822 | 3300021388 | Bacteria | 3542 |
| 87 | Ga0213875_10058162 | 3300021388 | Bacteria | 1810 |
| 88 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 89 | Ga0207425_1024874 | 3300025245 | Bacteria | 1239 |
| 90 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 91 | Ga0209565_1014197 | 3300025263 | Bacteria | 1837 |
| 92 | Ga0209758_1000116 | 3300025297 | Bacteria | 198356 |
| 93 | Ga0209256_1001951 | 3300025299 | Bacteria | 18696 |
| 94 | Ga0207699_10086735 | 3300025906 | Bacteria | 1956 |
| 95 | Ga0207684_10297562 | 3300025910 | Bacteria | 1391 |
| 96 | Ga0207695_10395752 | 3300025913 | Unclassified | 1266 |
| 97 | Ga0207695_10453753 | 3300025913 | Unclassified | 1165 |
| 98 | Ga0207663_10104822 | 3300025916 | Bacteria | 1907 |
| 99 | Ga0207646_10061830 | 3300025922 | Bacteria | 3342 |
| 100 | Ga0207646_10218870 | 3300025922 | Unclassified | 1720 |
| 101 | Ga0207700_10022603 | 3300025928 | Bacteria | 4319 |
| 102 | Ga0207700_10105089 | 3300025928 | Bacteria | 2261 |
| 103 | Ga0207664_10423926 | 3300025929 | Unclassified | 1185 |
| 104 | Ga0207690_10318870 | 3300025932 | Bacteria | 1221 |
| 105 | Ga0207670_10431745 | 3300025936 | Unclassified | 1059 |
| 106 | Ga0207711_10026928 | 3300025941 | Unclassified | 4827 |
| 107 | Ga0207711_10077930 | 3300025941 | Bacteria | 2890 |
| 108 | Ga0207661_10604399 | 3300025944 | Unclassified | 1007 |
| 109 | Ga0207667_10039887 | 3300025949 | Bacteria | 5001 |
| 110 | Ga0207712_10346162 | 3300025961 | Unclassified | 1234 |
| 111 | Ga0207658_10141915 | 3300025986 | Bacteria | 1945 |
| 112 | Ga0207639_10274401 | 3300026041 | Bacteria | 1480 |
| 113 | Ga0207678_10404600 | 3300026067 | Bacteria | 1182 |
| 114 | Ga0207702_10000876 | 3300026078 | Bacteria | 31306 |
| 115 | Ga0207702_10012618 | 3300026078 | Bacteria | 7034 |
| 116 | Ga0207702_10105798 | 3300026078 | Bacteria | 2492 |
| 117 | Ga0207641_10049138 | 3300026088 | Unclassified | 3563 |
| 118 | Ga0207648_10018248 | 3300026089 | Bacteria | 6355 |
| 119 | Ga0207674_10392690 | 3300026116 | Bacteria | 1341 |
| 120 | Ga0207675_100516300 | 3300026118 | Bacteria | 1191 |
| 121 | Ga0207698_10009014 | 3300026142 | Bacteria | 6336 |
| 122 | Ga0265337_1004298 | 3300028556 | Bacteria | 5943 |
| 123 | Ga0265336_10042198 | 3300028666 | Unclassified | 1393 |
| 124 | Ga0265332_10021503 | 3300031238 | Bacteria | 2849 |
| 125 | Ga0265328_10000050 | 3300031239 | Bacteria | 79086 |
| 126 | Ga0265320_10000270 | 3300031240 | Bacteria | 42895 |
| 127 | Ga0265340_10083306 | 3300031247 | Bacteria | 1503 |
| 128 | Ga0265331_10012135 | 3300031250 | Bacteria | 4682 |
| 129 | Ga0265327_10128699 | 3300031251 | Bacteria | 1193 |
| 130 | Ga0265316_10000260 | 3300031344 | Bacteria | 60214 |
| 131 | Ga0265316_10002007 | 3300031344 | Bacteria | 21451 |
| 132 | Ga0265316_10054237 | 3300031344 | Bacteria | 3139 |
| 133 | Ga0265316_10057320 | 3300031344 | Bacteria | 3038 |
| 134 | Ga0265316_10168914 | 3300031344 | Bacteria | 1632 |
| 135 | Ga0265316_10255759 | 3300031344 | Bacteria | 1285 |
| 136 | Ga0265316_10379097 | 3300031344 | Bacteria | 1021 |
| 137 | Ga0307509_10354981 | 3300031507 | Bacteria | 1188 |
| 138 | Ga0265314_10006408 | 3300031711 | Bacteria | 10429 |
| 139 | Ga0265314_10016838 | 3300031711 | Bacteria | 5760 |
| 140 | Ga0316593_10032469 | 3300032168 | Bacteria | 1705 |
| 141 | Ga0373926_0084029 | 3300035083 | Bacteria | 1180 |
| 142 | Ga0373944_0094794 | 3300035089 | Bacteria | 1002 |
| 143 | Ga0373943_0063387 | 3300035170 | Unclassified | 1853 |
| 144 | Ga0373931_0248409 | 3300035691 | Bacteria | 1081 |
| 145 | Ga0373927_0002794 | 3300035695 | Bacteria | 12743 |
| 146 | Ga0373925_0029784 | 3300037068 | Unclassified | 4005 |
| 147 | Ga0395899_0234157 | 3300037312 | Unclassified | 1267 |
| 148 | Ga0436364_0115933 | 3300037853 | Bacteria | 94405 |
| 149 | Ga0436364_0180871 | 3300037853 | Bacteria | 8172 |
| 150 | Ga0436364_0312520 | 3300037853 | Bacteria | 18265 |
| 151 | Ga0436364_0565318 | 3300037853 | Bacteria | 4189 |
| 152 | Ga0436364_0623132 | 3300037853 | Bacteria | 1202 |
| 153 | Ga0436364_0666874 | 3300037853 | Unclassified | 3948 |
| 154 | Ga0436364_0725828 | 3300037853 | Unclassified | 2529 |
| 155 | Ga0436364_0911271 | 3300037853 | Bacteria | 3520 |
| 156 | Ga0436364_0921979 | 3300037853 | Bacteria | 1957 |
| 157 | Ga0436364_1046197 | 3300037853 | Bacteria | 12743 |
| 158 | Ga0436364_1155365 | 3300037853 | Bacteria | 6551 |
| 159 | Ga0436364_1171939 | 3300037853 | Bacteria | 5999 |
| 160 | Ga0436364_1183540 | 3300037853 | Unclassified | 1707 |
| 161 | Ga0436364_1404943 | 3300037853 | Bacteria | 1605 |
| 162 | Ga0436364_1512173 | 3300037853 | Unclassified | 1824 |
| 163 | Ga0400484_13419 | 3300038725 | Bacteria | 5959 |
| 164 | Ga0400490_26537 | 3300038726 | Unclassified | 1582 |
| 165 | Ga0400488_14609 | 3300038741 | Bacteria | 2420 |
| 166 | Ga0400483_052348 | 3300039062 | Unclassified | 1056 |
| 167 | Ga0400483_107486 | 3300039062 | Bacteria | 3664 |
| 168 | Ga0400483_112409 | 3300039062 | Bacteria | 1315 |
| 169 | Ga0400483_161186 | 3300039062 | Bacteria | 1006 |
| 170 | Ga0400483_200883 | 3300039062 | Bacteria | 3120 |
| 171 | Ga0400483_212581 | 3300039062 | Bacteria | 2611 |
| 172 | Ga0436365_0513920 | 3300039437 | Bacteria | 43713 |
| 173 | Ga0436365_0564045 | 3300039437 | Unclassified | 1203 |
| 174 | Ga0436365_1060900 | 3300039437 | Unclassified | 4972 |
| 175 | Ga0436365_1149577 | 3300039437 | Unclassified | 1963 |
| 176 | Ga0436365_1164343 | 3300039437 | Bacteria | 2922 |
| 177 | Ga0436365_1419121 | 3300039437 | Bacteria | 5816 |
| 178 | Ga0436360_0498443 | 3300039438 | Bacteria | 28098 |
| 179 | Ga0436360_0966363 | 3300039438 | Unclassified | 1050 |
| 180 | Ga0436361_0630510 | 3300039447 | Bacteria | 1028 |
| 181 | Ga0436361_0683315 | 3300039447 | Bacteria | 65588 |
| 182 | Ga0436361_0713312 | 3300039447 | Unclassified | 4134 |
| 183 | Ga0436361_0923366 | 3300039447 | Bacteria | 3277 |
| 184 | Ga0436363_0621646 | 3300039450 | Bacteria | 1687 |
| 185 | Ga0436363_0666163 | 3300039450 | Bacteria | 1403 |
| 186 | Ga0436363_1122495 | 3300039450 | Bacteria | 1691 |
| 187 | Ga0436362_1020693 | 3300039453 | Bacteria | 2476 |
| 188 | Ga0436362_1239235 | 3300039453 | Bacteria | 6242 |
| 189 | Ga0453684_0310935 | 3300044712 | Bacteria | 1788 |
| 190 | Ga0453684_0749868 | 3300044712 | Bacteria | 1057 |
| 191 | Ga0466957_0276159 | 3300044842 | Unclassified | 1123 |
| 192 | Ga0466959_0020213 | 3300045049 | Bacteria | 4902 |
| 193 | Ga0466959_0161031 | 3300045049 | Bacteria | 1578 |
| 194 | Ga0451576_0086774 | 3300045051 | Bacteria | 3255 |
| 195 | Ga0451576_0479071 | 3300045051 | Bacteria | 1307 |
| 196 | Ga0466958_0087567 | 3300045836 | Bacteria | 1923 |
| 197 | Ga0466967_0158302 | 3300045976 | Unclassified | 2124 |
| 198 | Ga0495651_0241216 | 3300046462 | Bacteria | 1239 |
| 199 | Ga0495580_0000779 | 3300046472 | Bacteria | 27448 |
| 200 | Ga0495580_0026006 | 3300046472 | Bacteria | 4271 |
| 201 | Ga0495580_0040462 | 3300046472 | Bacteria | 3329 |
| 202 | Ga0495580_0155916 | 3300046472 | Bacteria | 1581 |
| 203 | Ga0495664_0024509 | 3300046477 | Bacteria | 3508 |
| 204 | Ga0495607_0003633 | 3300046501 | Bacteria | 11713 |
| 205 | Ga0495628_0025229 | 3300046516 | Bacteria | 4857 |
| 206 | Ga0495666_0153022 | 3300046526 | Bacteria | 1072 |
| 207 | Ga0495640_0167317 | 3300046533 | Bacteria | 1406 |
| 208 | Ga0495645_0023995 | 3300046543 | Bacteria | 4421 |
| 209 | Ga0495667_0031731 | 3300046559 | Bacteria | 3543 |
| 210 | Ga0495667_0232511 | 3300046559 | Bacteria | 1175 |
| 211 | Ga0495599_0043774 | 3300046678 | Bacteria | 2810 |
| 212 | Ga0495623_0033587 | 3300046679 | Bacteria | 3292 |
| 213 | Ga0495613_0061326 | 3300046689 | Bacteria | 2754 |
| 214 | Ga0495674_0044043 | 3300047319 | Bacteria | 3969 |
| 215 | Ga0495674_0045586 | 3300047319 | Unclassified | 3893 |
| 216 | Ga0495674_0316676 | 3300047319 | Bacteria | 1272 |
| 217 | Ga0495674_0540417 | 3300047319 | Unclassified | 929 |
| 218 | Ga0495675_0334753 | 3300047444 | Unclassified | 893 |
| 219 | Ga0495684_0037134 | 3300047471 | Bacteria | 3736 |
| 220 | Ga0495684_0053533 | 3300047471 | Bacteria | 3079 |
| 221 | Ga0495686_0011465 | 3300047472 | Bacteria | 6242 |
| 222 | Ga0495686_0012642 | 3300047472 | Bacteria | 5898 |
| 223 | Ga0495602_0057243 | 3300048088 | Bacteria | 3421 |
| 224 | Ga0495602_0185922 | 3300048088 | Bacteria | 1598 |
| 225 | Ga0496112_0064657 | 3300048915 | Bacteria | 3610 |
| 226 | Ga0496114_0141677 | 3300048917 | Unclassified | 2082 |
| 227 | Ga0501032_0114030 | 3300049569 | Bacteria | 1788 |
| 228 | Ga0501034_0012701 | 3300049571 | Bacteria | 8689 |
| 229 | Ga0501034_0231811 | 3300049571 | Bacteria | 1795 |
| 230 | Ga0501037_0049030 | 3300049573 | Bacteria | 3093 |
| 231 | Ga0501038_0456975 | 3300049574 | Bacteria | 981 |
| 232 | Ga0501046_0108231 | 3300049580 | Bacteria | 2126 |
| 233 | Ga0501047_0200716 | 3300049581 | Bacteria | 1855 |
| 234 | Ga0501047_0247870 | 3300049581 | Bacteria | 1630 |
| 235 | Ga0501070_0052521 | 3300049586 | Bacteria | 3383 |
| 236 | Ga0501070_0129005 | 3300049586 | Bacteria | 2089 |
| 237 | Ga0501074_0237522 | 3300049590 | Bacteria | 1297 |
| 238 | Ga0501035_0125924 | 3300049822 | Bacteria | 2236 |
| 239 | Ga0501044_0006360 | 3300049823 | Bacteria | 13056 |
| 240 | Ga0501044_0013201 | 3300049823 | Bacteria | 8946 |
| 241 | Ga0501044_0052922 | 3300049823 | Bacteria | 4179 |
| 242 | nmdc:mga08y16_430844_c1 | 3300050511 | Bacteria | 1347 |
| 243 | nmdc:mga0rr50_220934_c1 | 3300050513 | Unclassified | 1564 |
| 244 | nmdc:mga08x19_302_c1 | 3300050514 | Bacteria | 36231 |
| 245 | Ga0495619_0297431 | 3300053085 | Bacteria | 1118 |
| 246 | Ga0500634_0060759 | 3300053161 | Bacteria | 2006 |
| 247 | Ga0501084_0003557 | 3300054114 | Bacteria | 12652 |
| 248 | 2643787213 | 2643221554 | Bacteria | 6603920 |
| 249 | 2644215711 | 2643221638 | Bacteria | 6579467 |
| 250 | 2857580272 | 2857576091 | Bacteria | 5465855 |
| 251 | Ga0070659_100023879 | |||
| 252 | JGI25152J39213_1000783 | |||
| 253 | JGI25150J39212_1000793 | |||
| 254 | JGI25150J39212_1002828 | |||
| 255 | JGI25159J45721_1023822 | |||
| 256 | Ga0055526_1003470 | |||
| 257 | Ga0055524_1001762 | |||
| 258 | Ga0055524_1009442 | |||
| 259 | Ga0055524_1010331 | |||
| 260 | Ga0055534_1001540 | |||
| 261 | Ga0070658_10107311 | |||
| 262 | Ga0070683_100126507 | |||
| 263 | Ga0070683_100129832 | |||
| 264 | Ga0068868_100091328 | |||
| 265 | Ga0070689_100052408 | |||
| 266 | Ga0070689_100228292 | |||
| 267 | Ga0070668_100090709 | |||
| 268 | Ga0070667_100347047 | |||
| 269 | Ga0070709_10102516 | |||
| 270 | Ga0070714_100180158 | |||
| 271 | Ga0070713_100062859 | |||
| 272 | Ga0070708_100063530 | |||
| 273 | Ga0070708_100164101 | |||
| 274 | Ga0070678_100219007 | |||
| 275 | Ga0070681_10229279 | |||
| 276 | Ga0070681_10436111 | |||
| 277 | Ga0068867_100008454 | |||
| 278 | Ga0070685_10062915 | |||
| 279 | Ga0070706_100366983 | |||
| 280 | Ga0070707_100011671 | |||
| 281 | Ga0070707_100016271 | |||
| 282 | Ga0070707_100107442 | |||
| 283 | Ga0070699_100301691 | |||
| 284 | Ga0070679_100695211 | |||
| 285 | Ga0070697_100000166 | |||
| 286 | Ga0070697_100068853 | |||
| 287 | Ga0068853_100013855 | |||
| 288 | Ga0068853_100523762 | |||
| 289 | Ga0070704_100209676 | |||
| 290 | Ga0068855_100009010 | |||
| 291 | Ga0068855_100045470 | |||
| 292 | Ga0068857_100241205 | |||
| 293 | Ga0068856_100004276 | |||
| 294 | Ga0068856_100113067 | |||
| 295 | Ga0068860_100296583 | |||
| 296 | Ga0070717_10029552 | |||
| 297 | Ga0097621_100038075 | |||
| 298 | Ga0097621_100178269 | |||
| 299 | Ga0068871_100005722 | |||
| 300 | Ga0075436_100032605 | |||
| 301 | Ga0075435_100177486 | |||
| 302 | Ga0105240_10158077 | |||
| 303 | Ga0105240_10213610 | |||
| 304 | Ga0105240_10245004 | |||
| 305 | Ga0111539_10216034 | |||
| 306 | Ga0105245_10057345 | |||
| 307 | Ga0105242_10157143 | |||
| 308 | Ga0105248_10113647 | |||
| 309 | Ga0105248_10596469 | |||
| 310 | Ga0105248_10609720 | |||
| 311 | Ga0105237_10026427 | |||
| 312 | Ga0105238_10151419 | |||
| 313 | Ga0105249_10501113 | |||
| 314 | Ga0105239_10137014 | |||
| 315 | Ga0105239_10325762 | |||
| 316 | Ga0157370_10132635 | |||
| 317 | Ga0157374_10077012 | |||
| 318 | Ga0157374_10352523 | |||
| 319 | Ga0157374_10515815 | |||
| 320 | Ga0163162_10266004 | |||
| 321 | Ga0163162_10569976 | |||
| 322 | Ga0157372_10032813 | |||
| 323 | Ga0157372_10427208 | |||
| 324 | Ga0157375_10280344 | |||
| 325 | Ga0157375_10521915 | |||
| 326 | Ga0163163_10037392 | |||
| 327 | Ga0157376_10015317 | |||
| 328 | Ga0206356_11607969 | |||
| 329 | Ga0213872_10000098 | |||
| 330 | Ga0213876_10002968 | |||
| 331 | Ga0213876_10049508 | |||
| 332 | Ga0213875_10000056 | |||
| 333 | Ga0213875_10000108 | |||
| 334 | Ga0213875_10005880 | |||
| 335 | Ga0213875_10012698 | |||
| 336 | Ga0213875_10016822 | |||
| 337 | Ga0213875_10058162 | |||
| 338 | Ga0207425_1000001 | |||
| 339 | Ga0207425_1024874 | |||
| 340 | Ga0209129_1000001 | |||
| 341 | Ga0209565_1014197 | |||
| 342 | Ga0209758_1000116 | |||
| 343 | Ga0209256_1001951 | |||
| 344 | Ga0207699_10086735 | |||
| 345 | Ga0207684_10297562 | |||
| 346 | Ga0207695_10395752 | |||
| 347 | Ga0207695_10453753 | |||
| 348 | Ga0207663_10104822 | |||
| 349 | Ga0207646_10061830 | |||
| 350 | Ga0207646_10218870 | |||
| 351 | Ga0207700_10022603 | |||
| 352 | Ga0207700_10105089 | |||
| 353 | Ga0207664_10423926 | |||
| 354 | Ga0207690_10318870 | |||
| 355 | Ga0207670_10431745 | |||
| 356 | Ga0207711_10026928 | |||
| 357 | Ga0207711_10077930 | |||
| 358 | Ga0207661_10604399 | |||
| 359 | Ga0207667_10039887 | |||
| 360 | Ga0207712_10346162 | |||
| 361 | Ga0207658_10141915 | |||
| 362 | Ga0207639_10274401 | |||
| 363 | Ga0207678_10404600 | |||
| 364 | Ga0207702_10000876 | |||
| 365 | Ga0207702_10012618 | |||
| 366 | Ga0207702_10105798 | |||
| 367 | Ga0207641_10049138 | |||
| 368 | Ga0207648_10018248 | |||
| 369 | Ga0207674_10392690 | |||
| 370 | Ga0207675_100516300 | |||
| 371 | Ga0207698_10009014 | |||
| 372 | Ga0265337_1004298 | |||
| 373 | Ga0265336_10042198 | |||
| 374 | Ga0265332_10021503 | |||
| 375 | Ga0265328_10000050 | |||
| 376 | Ga0265320_10000270 | |||
| 377 | Ga0265340_10083306 | |||
| 378 | Ga0265331_10012135 | |||
| 379 | Ga0265327_10128699 | |||
| 380 | Ga0265316_10000260 | |||
| 381 | Ga0265316_10002007 | |||
| 382 | Ga0265316_10054237 | |||
| 383 | Ga0265316_10057320 | |||
| 384 | Ga0265316_10168914 | |||
| 385 | Ga0265316_10255759 | |||
| 386 | Ga0265316_10379097 | |||
| 387 | Ga0307509_10354981 | |||
| 388 | Ga0265314_10006408 | |||
| 389 | Ga0265314_10016838 | |||
| 390 | Ga0316593_10032469 | |||
| 391 | Ga0373926_0084029 | |||
| 392 | Ga0373944_0094794 | |||
| 393 | Ga0373943_0063387 | |||
| 394 | Ga0373931_0248409 | |||
| 395 | Ga0373927_0002794 | |||
| 396 | Ga0373925_0029784 | |||
| 397 | Ga0395899_0234157 | |||
| 398 | Ga0436364_0115933 | |||
| 399 | Ga0436364_0180871 | |||
| 400 | Ga0436364_0312520 | |||
| 401 | Ga0436364_0565318 | |||
| 402 | Ga0436364_0623132 | |||
| 403 | Ga0436364_0666874 | |||
| 404 | Ga0436364_0725828 | |||
| 405 | Ga0436364_0911271 | |||
| 406 | Ga0436364_0921979 | |||
| 407 | Ga0436364_1046197 | |||
| 408 | Ga0436364_1155365 | |||
| 409 | Ga0436364_1171939 | |||
| 410 | Ga0436364_1183540 | |||
| 411 | Ga0436364_1404943 | |||
| 412 | Ga0436364_1512173 | |||
| 413 | Ga0400484_13419 | |||
| 414 | Ga0400490_26537 | |||
| 415 | Ga0400488_14609 | |||
| 416 | Ga0400483_052348 | |||
| 417 | Ga0400483_107486 | |||
| 418 | Ga0400483_112409 | |||
| 419 | Ga0400483_161186 | |||
| 420 | Ga0400483_200883 | |||
| 421 | Ga0400483_212581 | |||
| 422 | Ga0436365_0513920 | |||
| 423 | Ga0436365_0564045 | |||
| 424 | Ga0436365_1060900 | |||
| 425 | Ga0436365_1149577 | |||
| 426 | Ga0436365_1164343 | |||
| 427 | Ga0436365_1419121 | |||
| 428 | Ga0436360_0498443 | |||
| 429 | Ga0436360_0966363 | |||
| 430 | Ga0436361_0630510 | |||
| 431 | Ga0436361_0683315 | |||
| 432 | Ga0436361_0713312 | |||
| 433 | Ga0436361_0923366 | |||
| 434 | Ga0436363_0621646 | |||
| 435 | Ga0436363_0666163 | |||
| 436 | Ga0436363_1122495 | |||
| 437 | Ga0436362_1020693 | |||
| 438 | Ga0436362_1239235 | |||
| 439 | Ga0453684_0310935 | |||
| 440 | Ga0453684_0749868 | |||
| 441 | Ga0466957_0276159 | |||
| 442 | Ga0466959_0020213 | |||
| 443 | Ga0466959_0161031 | |||
| 444 | Ga0451576_0086774 | |||
| 445 | Ga0451576_0479071 | |||
| 446 | Ga0466958_0087567 | |||
| 447 | Ga0466967_0158302 | |||
| 448 | Ga0495651_0241216 | |||
| 449 | Ga0495580_0000779 | |||
| 450 | Ga0495580_0026006 | |||
| 451 | Ga0495580_0040462 | |||
| 452 | Ga0495580_0155916 | |||
| 453 | Ga0495664_0024509 | |||
| 454 | Ga0495607_0003633 | |||
| 455 | Ga0495628_0025229 | |||
| 456 | Ga0495666_0153022 | |||
| 457 | Ga0495640_0167317 | |||
| 458 | Ga0495645_0023995 | |||
| 459 | Ga0495667_0031731 | |||
| 460 | Ga0495667_0232511 | |||
| 461 | Ga0495599_0043774 | |||
| 462 | Ga0495623_0033587 | |||
| 463 | Ga0495613_0061326 | |||
| 464 | Ga0495674_0044043 | |||
| 465 | Ga0495674_0045586 | |||
| 466 | Ga0495674_0316676 | |||
| 467 | Ga0495674_0540417 | |||
| 468 | Ga0495675_0334753 | |||
| 469 | Ga0495684_0037134 | |||
| 470 | Ga0495684_0053533 | |||
| 471 | Ga0495686_0011465 | |||
| 472 | Ga0495686_0012642 | |||
| 473 | Ga0495602_0057243 | |||
| 474 | Ga0495602_0185922 | |||
| 475 | Ga0496112_0064657 | |||
| 476 | Ga0496114_0141677 | |||
| 477 | Ga0501032_0114030 | |||
| 478 | Ga0501034_0012701 | |||
| 479 | Ga0501034_0231811 | |||
| 480 | Ga0501037_0049030 | |||
| 481 | Ga0501038_0456975 | |||
| 482 | Ga0501046_0108231 | |||
| 483 | Ga0501047_0200716 | |||
| 484 | Ga0501047_0247870 | |||
| 485 | Ga0501070_0052521 | |||
| 486 | Ga0501070_0129005 | |||
| 487 | Ga0501074_0237522 | |||
| 488 | Ga0501035_0125924 | |||
| 489 | Ga0501044_0006360 | |||
| 490 | Ga0501044_0013201 | |||
| 491 | Ga0501044_0052922 | |||
| 492 | nmdc:mga08y16_430844_c1 | |||
| 493 | nmdc:mga0rr50_220934_c1 | |||
| 494 | nmdc:mga08x19_302_c1 | |||
| 495 | Ga0495619_0297431 | |||
| 496 | Ga0500634_0060759 | |||
| 497 | Ga0501084_0003557 | |||
| 498 | 2643787213 | |||
| 499 | 2644215711 | |||
| 500 | 2857580272 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.8338 | 34 | 260 |
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.8186 | 34 | 260 |
| 3k1s-assembly1.cif.gz_A | crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis | 0.7976 | 34 | 125 |
| 4mnd-assembly1.cif.gz_A-2 | crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein | 0.7593 | 42 | 203 |
| 2e2a-assembly1.cif.gz_C | asp81leu enzyme iia from the lactose specific pts from lactococcus lactis | 0.7462 | 37 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8955 | 41 | 205 | 1.20.120.1760 |
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8939 | 38 | 209 | 1.20.120.1760 |
| af_D3ZGY5_32_207_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8756 | 37 | 215 | 1.20.120.1760 |
| af_P9WPG1_2_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8748 | 27 | 210 | 1.20.120.1760 |
| af_Q58609_4_200_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8564 | 36 | 260 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832EXD2-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9902 | 34 | 125 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-W0V588-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9647 | 34 | 273 |
GO:0003882
GO:0008444 GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A832EXD2-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9591 | 34 | 125 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A349SD42-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9556 | 40 | 266 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A1C0A929-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9526 | 48 | 207 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |