F361359

General Info

Members Datasets Scaffolds Average Seq Length
250 157 500 275

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100023879|Ga0070659_1000238793
Length 309
Sequence VHDSGASRPRGSVCLSIRERLTGPPVSGKRPRRAAYALPTLFTSANIFLGFVAILQAFEGALLAKSGDLTTNVHFAIAAKALAFAVLFDGLDGRIARMTNTTSDFGRELDSLADVITFGIAPAVLVFVWGVLFVVPPGDGPVQSQLDRAGYLVSFFYLLCGAVRLARFNVQTNPLPKNPGRPDRKYFVGLPIPAGAGFVAAVVYMDASPVRSLVFSILWLIVTVIVSLLMVSTWRYPSFKQVSISKPRTPLTVLVVAGIAFLISQWSQPVLLIVACAYLLSGIVIRIGGIVRRHRKSRHHASLPEHQVG

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
106 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
107 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
156 2643221638 Duganella sp. Root336D2 Isolate Unclassified
157 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0.8
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 0
Rhizoplane 0.8
Rhizosphere 74.8
Stem 0
Stem Tuber 0
Unclassified 18.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100023879 3300005366 Bacteria 4683
2 JGI25152J39213_1000783 3300002773 Bacteria 15988
3 JGI25150J39212_1000793 3300002774 Bacteria 10765
4 JGI25150J39212_1002828 3300002774 Bacteria 4199
5 JGI25159J45721_1023822 3300002987 Bacteria 1102
6 Ga0055526_1003470 3300003771 Bacteria 10007
7 Ga0055524_1001762 3300003775 Bacteria 11945
8 Ga0055524_1009442 3300003775 Bacteria 3965
9 Ga0055524_1010331 3300003775 Bacteria 3727
10 Ga0055534_1001540 3300003784 Bacteria 8992
11 Ga0070658_10107311 3300005327 Bacteria 2311
12 Ga0070683_100126507 3300005329 Unclassified 2416
13 Ga0070683_100129832 3300005329 Bacteria 2384
14 Ga0068868_100091328 3300005338 Bacteria 2453
15 Ga0070689_100052408 3300005340 Bacteria 3156
16 Ga0070689_100228292 3300005340 Unclassified 1529
17 Ga0070668_100090709 3300005347 Unclassified 2408
18 Ga0070667_100347047 3300005367 Bacteria 1343
19 Ga0070709_10102516 3300005434 Bacteria 1909
20 Ga0070714_100180158 3300005435 Bacteria 1922
21 Ga0070713_100062859 3300005436 Unclassified 3110
22 Ga0070708_100063530 3300005445 Bacteria 3305
23 Ga0070708_100164101 3300005445 Bacteria 2071
24 Ga0070678_100219007 3300005456 Bacteria 1581
25 Ga0070681_10229279 3300005458 Bacteria 1772
26 Ga0070681_10436111 3300005458 Bacteria 1222
27 Ga0068867_100008454 3300005459 Bacteria 7261
28 Ga0070685_10062915 3300005466 Unclassified 2177
29 Ga0070706_100366983 3300005467 Bacteria 1341
30 Ga0070707_100011671 3300005468 Bacteria 8196
31 Ga0070707_100016271 3300005468 Bacteria 6981
32 Ga0070707_100107442 3300005468 Unclassified 2707
33 Ga0070699_100301691 3300005518 Bacteria 1437
34 Ga0070679_100695211 3300005530 Bacteria 960
35 Ga0070697_100000166 3300005536 Bacteria 53539
36 Ga0070697_100068853 3300005536 Bacteria 2898
37 Ga0068853_100013855 3300005539 Bacteria 6591
38 Ga0068853_100523762 3300005539 Unclassified 1121
39 Ga0070704_100209676 3300005549 Bacteria 1578
40 Ga0068855_100009010 3300005563 Bacteria 12058
41 Ga0068855_100045470 3300005563 Bacteria 5193
42 Ga0068857_100241205 3300005577 Bacteria 1655
43 Ga0068856_100004276 3300005614 Bacteria 14255
44 Ga0068856_100113067 3300005614 Bacteria 2713
45 Ga0068860_100296583 3300005843 Unclassified 1583
46 Ga0070717_10029552 3300006028 Bacteria 4398
47 Ga0097621_100038075 3300006237 Bacteria 3858
48 Ga0097621_100178269 3300006237 Bacteria 1835
49 Ga0068871_100005722 3300006358 Bacteria 8727
50 Ga0075436_100032605 3300006914 Bacteria 3591
51 Ga0075435_100177486 3300007076 Bacteria 1799
52 Ga0105240_10158077 3300009093 Bacteria 2694
53 Ga0105240_10213610 3300009093 Unclassified 2252
54 Ga0105240_10245004 3300009093 Unclassified 2076
55 Ga0111539_10216034 3300009094 Bacteria 2234
56 Ga0105245_10057345 3300009098 Bacteria 3503
57 Ga0105242_10157143 3300009176 Bacteria 1987
58 Ga0105248_10113647 3300009177 Bacteria 3054
59 Ga0105248_10596469 3300009177 Bacteria 1246
60 Ga0105248_10609720 3300009177 Bacteria 1231
61 Ga0105237_10026427 3300009545 Bacteria 5933
62 Ga0105238_10151419 3300009551 Bacteria 2295
63 Ga0105249_10501113 3300009553 Unclassified 1259
64 Ga0105239_10137014 3300010375 Bacteria 2725
65 Ga0105239_10325762 3300010375 Bacteria 1733
66 Ga0157370_10132635 3300013104 Bacteria 2323
67 Ga0157374_10077012 3300013296 Unclassified 3155
68 Ga0157374_10352523 3300013296 Unclassified 1462
69 Ga0157374_10515815 3300013296 Unclassified 1201
70 Ga0163162_10266004 3300013306 Bacteria 1846
71 Ga0163162_10569976 3300013306 Bacteria 1259
72 Ga0157372_10032813 3300013307 Bacteria 5696
73 Ga0157372_10427208 3300013307 Bacteria 1544
74 Ga0157375_10280344 3300013308 Bacteria 1830
75 Ga0157375_10521915 3300013308 Bacteria 1351
76 Ga0163163_10037392 3300014325 Bacteria 4722
77 Ga0157376_10015317 3300014969 Bacteria 5790
78 Ga0206356_11607969 3300020070 Bacteria 947
79 Ga0213872_10000098 3300021361 Bacteria 80168
80 Ga0213876_10002968 3300021384 Bacteria 9831
81 Ga0213876_10049508 3300021384 Unclassified 2220
82 Ga0213875_10000056 3300021388 Bacteria 136543
83 Ga0213875_10000108 3300021388 Bacteria 94421
84 Ga0213875_10005880 3300021388 Bacteria 6519
85 Ga0213875_10012698 3300021388 Bacteria 4148
86 Ga0213875_10016822 3300021388 Bacteria 3542
87 Ga0213875_10058162 3300021388 Bacteria 1810
88 Ga0207425_1000001 3300025245 Bacteria 2525432
89 Ga0207425_1024874 3300025245 Bacteria 1239
90 Ga0209129_1000001 3300025258 Bacteria 1452436
91 Ga0209565_1014197 3300025263 Bacteria 1837
92 Ga0209758_1000116 3300025297 Bacteria 198356
93 Ga0209256_1001951 3300025299 Bacteria 18696
94 Ga0207699_10086735 3300025906 Bacteria 1956
95 Ga0207684_10297562 3300025910 Bacteria 1391
96 Ga0207695_10395752 3300025913 Unclassified 1266
97 Ga0207695_10453753 3300025913 Unclassified 1165
98 Ga0207663_10104822 3300025916 Bacteria 1907
99 Ga0207646_10061830 3300025922 Bacteria 3342
100 Ga0207646_10218870 3300025922 Unclassified 1720
101 Ga0207700_10022603 3300025928 Bacteria 4319
102 Ga0207700_10105089 3300025928 Bacteria 2261
103 Ga0207664_10423926 3300025929 Unclassified 1185
104 Ga0207690_10318870 3300025932 Bacteria 1221
105 Ga0207670_10431745 3300025936 Unclassified 1059
106 Ga0207711_10026928 3300025941 Unclassified 4827
107 Ga0207711_10077930 3300025941 Bacteria 2890
108 Ga0207661_10604399 3300025944 Unclassified 1007
109 Ga0207667_10039887 3300025949 Bacteria 5001
110 Ga0207712_10346162 3300025961 Unclassified 1234
111 Ga0207658_10141915 3300025986 Bacteria 1945
112 Ga0207639_10274401 3300026041 Bacteria 1480
113 Ga0207678_10404600 3300026067 Bacteria 1182
114 Ga0207702_10000876 3300026078 Bacteria 31306
115 Ga0207702_10012618 3300026078 Bacteria 7034
116 Ga0207702_10105798 3300026078 Bacteria 2492
117 Ga0207641_10049138 3300026088 Unclassified 3563
118 Ga0207648_10018248 3300026089 Bacteria 6355
119 Ga0207674_10392690 3300026116 Bacteria 1341
120 Ga0207675_100516300 3300026118 Bacteria 1191
121 Ga0207698_10009014 3300026142 Bacteria 6336
122 Ga0265337_1004298 3300028556 Bacteria 5943
123 Ga0265336_10042198 3300028666 Unclassified 1393
124 Ga0265332_10021503 3300031238 Bacteria 2849
125 Ga0265328_10000050 3300031239 Bacteria 79086
126 Ga0265320_10000270 3300031240 Bacteria 42895
127 Ga0265340_10083306 3300031247 Bacteria 1503
128 Ga0265331_10012135 3300031250 Bacteria 4682
129 Ga0265327_10128699 3300031251 Bacteria 1193
130 Ga0265316_10000260 3300031344 Bacteria 60214
131 Ga0265316_10002007 3300031344 Bacteria 21451
132 Ga0265316_10054237 3300031344 Bacteria 3139
133 Ga0265316_10057320 3300031344 Bacteria 3038
134 Ga0265316_10168914 3300031344 Bacteria 1632
135 Ga0265316_10255759 3300031344 Bacteria 1285
136 Ga0265316_10379097 3300031344 Bacteria 1021
137 Ga0307509_10354981 3300031507 Bacteria 1188
138 Ga0265314_10006408 3300031711 Bacteria 10429
139 Ga0265314_10016838 3300031711 Bacteria 5760
140 Ga0316593_10032469 3300032168 Bacteria 1705
141 Ga0373926_0084029 3300035083 Bacteria 1180
142 Ga0373944_0094794 3300035089 Bacteria 1002
143 Ga0373943_0063387 3300035170 Unclassified 1853
144 Ga0373931_0248409 3300035691 Bacteria 1081
145 Ga0373927_0002794 3300035695 Bacteria 12743
146 Ga0373925_0029784 3300037068 Unclassified 4005
147 Ga0395899_0234157 3300037312 Unclassified 1267
148 Ga0436364_0115933 3300037853 Bacteria 94405
149 Ga0436364_0180871 3300037853 Bacteria 8172
150 Ga0436364_0312520 3300037853 Bacteria 18265
151 Ga0436364_0565318 3300037853 Bacteria 4189
152 Ga0436364_0623132 3300037853 Bacteria 1202
153 Ga0436364_0666874 3300037853 Unclassified 3948
154 Ga0436364_0725828 3300037853 Unclassified 2529
155 Ga0436364_0911271 3300037853 Bacteria 3520
156 Ga0436364_0921979 3300037853 Bacteria 1957
157 Ga0436364_1046197 3300037853 Bacteria 12743
158 Ga0436364_1155365 3300037853 Bacteria 6551
159 Ga0436364_1171939 3300037853 Bacteria 5999
160 Ga0436364_1183540 3300037853 Unclassified 1707
161 Ga0436364_1404943 3300037853 Bacteria 1605
162 Ga0436364_1512173 3300037853 Unclassified 1824
163 Ga0400484_13419 3300038725 Bacteria 5959
164 Ga0400490_26537 3300038726 Unclassified 1582
165 Ga0400488_14609 3300038741 Bacteria 2420
166 Ga0400483_052348 3300039062 Unclassified 1056
167 Ga0400483_107486 3300039062 Bacteria 3664
168 Ga0400483_112409 3300039062 Bacteria 1315
169 Ga0400483_161186 3300039062 Bacteria 1006
170 Ga0400483_200883 3300039062 Bacteria 3120
171 Ga0400483_212581 3300039062 Bacteria 2611
172 Ga0436365_0513920 3300039437 Bacteria 43713
173 Ga0436365_0564045 3300039437 Unclassified 1203
174 Ga0436365_1060900 3300039437 Unclassified 4972
175 Ga0436365_1149577 3300039437 Unclassified 1963
176 Ga0436365_1164343 3300039437 Bacteria 2922
177 Ga0436365_1419121 3300039437 Bacteria 5816
178 Ga0436360_0498443 3300039438 Bacteria 28098
179 Ga0436360_0966363 3300039438 Unclassified 1050
180 Ga0436361_0630510 3300039447 Bacteria 1028
181 Ga0436361_0683315 3300039447 Bacteria 65588
182 Ga0436361_0713312 3300039447 Unclassified 4134
183 Ga0436361_0923366 3300039447 Bacteria 3277
184 Ga0436363_0621646 3300039450 Bacteria 1687
185 Ga0436363_0666163 3300039450 Bacteria 1403
186 Ga0436363_1122495 3300039450 Bacteria 1691
187 Ga0436362_1020693 3300039453 Bacteria 2476
188 Ga0436362_1239235 3300039453 Bacteria 6242
189 Ga0453684_0310935 3300044712 Bacteria 1788
190 Ga0453684_0749868 3300044712 Bacteria 1057
191 Ga0466957_0276159 3300044842 Unclassified 1123
192 Ga0466959_0020213 3300045049 Bacteria 4902
193 Ga0466959_0161031 3300045049 Bacteria 1578
194 Ga0451576_0086774 3300045051 Bacteria 3255
195 Ga0451576_0479071 3300045051 Bacteria 1307
196 Ga0466958_0087567 3300045836 Bacteria 1923
197 Ga0466967_0158302 3300045976 Unclassified 2124
198 Ga0495651_0241216 3300046462 Bacteria 1239
199 Ga0495580_0000779 3300046472 Bacteria 27448
200 Ga0495580_0026006 3300046472 Bacteria 4271
201 Ga0495580_0040462 3300046472 Bacteria 3329
202 Ga0495580_0155916 3300046472 Bacteria 1581
203 Ga0495664_0024509 3300046477 Bacteria 3508
204 Ga0495607_0003633 3300046501 Bacteria 11713
205 Ga0495628_0025229 3300046516 Bacteria 4857
206 Ga0495666_0153022 3300046526 Bacteria 1072
207 Ga0495640_0167317 3300046533 Bacteria 1406
208 Ga0495645_0023995 3300046543 Bacteria 4421
209 Ga0495667_0031731 3300046559 Bacteria 3543
210 Ga0495667_0232511 3300046559 Bacteria 1175
211 Ga0495599_0043774 3300046678 Bacteria 2810
212 Ga0495623_0033587 3300046679 Bacteria 3292
213 Ga0495613_0061326 3300046689 Bacteria 2754
214 Ga0495674_0044043 3300047319 Bacteria 3969
215 Ga0495674_0045586 3300047319 Unclassified 3893
216 Ga0495674_0316676 3300047319 Bacteria 1272
217 Ga0495674_0540417 3300047319 Unclassified 929
218 Ga0495675_0334753 3300047444 Unclassified 893
219 Ga0495684_0037134 3300047471 Bacteria 3736
220 Ga0495684_0053533 3300047471 Bacteria 3079
221 Ga0495686_0011465 3300047472 Bacteria 6242
222 Ga0495686_0012642 3300047472 Bacteria 5898
223 Ga0495602_0057243 3300048088 Bacteria 3421
224 Ga0495602_0185922 3300048088 Bacteria 1598
225 Ga0496112_0064657 3300048915 Bacteria 3610
226 Ga0496114_0141677 3300048917 Unclassified 2082
227 Ga0501032_0114030 3300049569 Bacteria 1788
228 Ga0501034_0012701 3300049571 Bacteria 8689
229 Ga0501034_0231811 3300049571 Bacteria 1795
230 Ga0501037_0049030 3300049573 Bacteria 3093
231 Ga0501038_0456975 3300049574 Bacteria 981
232 Ga0501046_0108231 3300049580 Bacteria 2126
233 Ga0501047_0200716 3300049581 Bacteria 1855
234 Ga0501047_0247870 3300049581 Bacteria 1630
235 Ga0501070_0052521 3300049586 Bacteria 3383
236 Ga0501070_0129005 3300049586 Bacteria 2089
237 Ga0501074_0237522 3300049590 Bacteria 1297
238 Ga0501035_0125924 3300049822 Bacteria 2236
239 Ga0501044_0006360 3300049823 Bacteria 13056
240 Ga0501044_0013201 3300049823 Bacteria 8946
241 Ga0501044_0052922 3300049823 Bacteria 4179
242 nmdc:mga08y16_430844_c1 3300050511 Bacteria 1347
243 nmdc:mga0rr50_220934_c1 3300050513 Unclassified 1564
244 nmdc:mga08x19_302_c1 3300050514 Bacteria 36231
245 Ga0495619_0297431 3300053085 Bacteria 1118
246 Ga0500634_0060759 3300053161 Bacteria 2006
247 Ga0501084_0003557 3300054114 Bacteria 12652
248 2643787213 2643221554 Bacteria 6603920
249 2644215711 2643221638 Bacteria 6579467
250 2857580272 2857576091 Bacteria 5465855
251 Ga0070659_100023879
252 JGI25152J39213_1000783
253 JGI25150J39212_1000793
254 JGI25150J39212_1002828
255 JGI25159J45721_1023822
256 Ga0055526_1003470
257 Ga0055524_1001762
258 Ga0055524_1009442
259 Ga0055524_1010331
260 Ga0055534_1001540
261 Ga0070658_10107311
262 Ga0070683_100126507
263 Ga0070683_100129832
264 Ga0068868_100091328
265 Ga0070689_100052408
266 Ga0070689_100228292
267 Ga0070668_100090709
268 Ga0070667_100347047
269 Ga0070709_10102516
270 Ga0070714_100180158
271 Ga0070713_100062859
272 Ga0070708_100063530
273 Ga0070708_100164101
274 Ga0070678_100219007
275 Ga0070681_10229279
276 Ga0070681_10436111
277 Ga0068867_100008454
278 Ga0070685_10062915
279 Ga0070706_100366983
280 Ga0070707_100011671
281 Ga0070707_100016271
282 Ga0070707_100107442
283 Ga0070699_100301691
284 Ga0070679_100695211
285 Ga0070697_100000166
286 Ga0070697_100068853
287 Ga0068853_100013855
288 Ga0068853_100523762
289 Ga0070704_100209676
290 Ga0068855_100009010
291 Ga0068855_100045470
292 Ga0068857_100241205
293 Ga0068856_100004276
294 Ga0068856_100113067
295 Ga0068860_100296583
296 Ga0070717_10029552
297 Ga0097621_100038075
298 Ga0097621_100178269
299 Ga0068871_100005722
300 Ga0075436_100032605
301 Ga0075435_100177486
302 Ga0105240_10158077
303 Ga0105240_10213610
304 Ga0105240_10245004
305 Ga0111539_10216034
306 Ga0105245_10057345
307 Ga0105242_10157143
308 Ga0105248_10113647
309 Ga0105248_10596469
310 Ga0105248_10609720
311 Ga0105237_10026427
312 Ga0105238_10151419
313 Ga0105249_10501113
314 Ga0105239_10137014
315 Ga0105239_10325762
316 Ga0157370_10132635
317 Ga0157374_10077012
318 Ga0157374_10352523
319 Ga0157374_10515815
320 Ga0163162_10266004
321 Ga0163162_10569976
322 Ga0157372_10032813
323 Ga0157372_10427208
324 Ga0157375_10280344
325 Ga0157375_10521915
326 Ga0163163_10037392
327 Ga0157376_10015317
328 Ga0206356_11607969
329 Ga0213872_10000098
330 Ga0213876_10002968
331 Ga0213876_10049508
332 Ga0213875_10000056
333 Ga0213875_10000108
334 Ga0213875_10005880
335 Ga0213875_10012698
336 Ga0213875_10016822
337 Ga0213875_10058162
338 Ga0207425_1000001
339 Ga0207425_1024874
340 Ga0209129_1000001
341 Ga0209565_1014197
342 Ga0209758_1000116
343 Ga0209256_1001951
344 Ga0207699_10086735
345 Ga0207684_10297562
346 Ga0207695_10395752
347 Ga0207695_10453753
348 Ga0207663_10104822
349 Ga0207646_10061830
350 Ga0207646_10218870
351 Ga0207700_10022603
352 Ga0207700_10105089
353 Ga0207664_10423926
354 Ga0207690_10318870
355 Ga0207670_10431745
356 Ga0207711_10026928
357 Ga0207711_10077930
358 Ga0207661_10604399
359 Ga0207667_10039887
360 Ga0207712_10346162
361 Ga0207658_10141915
362 Ga0207639_10274401
363 Ga0207678_10404600
364 Ga0207702_10000876
365 Ga0207702_10012618
366 Ga0207702_10105798
367 Ga0207641_10049138
368 Ga0207648_10018248
369 Ga0207674_10392690
370 Ga0207675_100516300
371 Ga0207698_10009014
372 Ga0265337_1004298
373 Ga0265336_10042198
374 Ga0265332_10021503
375 Ga0265328_10000050
376 Ga0265320_10000270
377 Ga0265340_10083306
378 Ga0265331_10012135
379 Ga0265327_10128699
380 Ga0265316_10000260
381 Ga0265316_10002007
382 Ga0265316_10054237
383 Ga0265316_10057320
384 Ga0265316_10168914
385 Ga0265316_10255759
386 Ga0265316_10379097
387 Ga0307509_10354981
388 Ga0265314_10006408
389 Ga0265314_10016838
390 Ga0316593_10032469
391 Ga0373926_0084029
392 Ga0373944_0094794
393 Ga0373943_0063387
394 Ga0373931_0248409
395 Ga0373927_0002794
396 Ga0373925_0029784
397 Ga0395899_0234157
398 Ga0436364_0115933
399 Ga0436364_0180871
400 Ga0436364_0312520
401 Ga0436364_0565318
402 Ga0436364_0623132
403 Ga0436364_0666874
404 Ga0436364_0725828
405 Ga0436364_0911271
406 Ga0436364_0921979
407 Ga0436364_1046197
408 Ga0436364_1155365
409 Ga0436364_1171939
410 Ga0436364_1183540
411 Ga0436364_1404943
412 Ga0436364_1512173
413 Ga0400484_13419
414 Ga0400490_26537
415 Ga0400488_14609
416 Ga0400483_052348
417 Ga0400483_107486
418 Ga0400483_112409
419 Ga0400483_161186
420 Ga0400483_200883
421 Ga0400483_212581
422 Ga0436365_0513920
423 Ga0436365_0564045
424 Ga0436365_1060900
425 Ga0436365_1149577
426 Ga0436365_1164343
427 Ga0436365_1419121
428 Ga0436360_0498443
429 Ga0436360_0966363
430 Ga0436361_0630510
431 Ga0436361_0683315
432 Ga0436361_0713312
433 Ga0436361_0923366
434 Ga0436363_0621646
435 Ga0436363_0666163
436 Ga0436363_1122495
437 Ga0436362_1020693
438 Ga0436362_1239235
439 Ga0453684_0310935
440 Ga0453684_0749868
441 Ga0466957_0276159
442 Ga0466959_0020213
443 Ga0466959_0161031
444 Ga0451576_0086774
445 Ga0451576_0479071
446 Ga0466958_0087567
447 Ga0466967_0158302
448 Ga0495651_0241216
449 Ga0495580_0000779
450 Ga0495580_0026006
451 Ga0495580_0040462
452 Ga0495580_0155916
453 Ga0495664_0024509
454 Ga0495607_0003633
455 Ga0495628_0025229
456 Ga0495666_0153022
457 Ga0495640_0167317
458 Ga0495645_0023995
459 Ga0495667_0031731
460 Ga0495667_0232511
461 Ga0495599_0043774
462 Ga0495623_0033587
463 Ga0495613_0061326
464 Ga0495674_0044043
465 Ga0495674_0045586
466 Ga0495674_0316676
467 Ga0495674_0540417
468 Ga0495675_0334753
469 Ga0495684_0037134
470 Ga0495684_0053533
471 Ga0495686_0011465
472 Ga0495686_0012642
473 Ga0495602_0057243
474 Ga0495602_0185922
475 Ga0496112_0064657
476 Ga0496114_0141677
477 Ga0501032_0114030
478 Ga0501034_0012701
479 Ga0501034_0231811
480 Ga0501037_0049030
481 Ga0501038_0456975
482 Ga0501046_0108231
483 Ga0501047_0200716
484 Ga0501047_0247870
485 Ga0501070_0052521
486 Ga0501070_0129005
487 Ga0501074_0237522
488 Ga0501035_0125924
489 Ga0501044_0006360
490 Ga0501044_0013201
491 Ga0501044_0052922
492 nmdc:mga08y16_430844_c1
493 nmdc:mga0rr50_220934_c1
494 nmdc:mga08x19_302_c1
495 Ga0495619_0297431
496 Ga0500634_0060759
497 Ga0501084_0003557
498 2643787213
499 2644215711
500 2857580272

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

36

207

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.8338 34 260
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.8186 34 260
3k1s-assembly1.cif.gz_A crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis 0.7976 34 125
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.7593 42 203
2e2a-assembly1.cif.gz_C asp81leu enzyme iia from the lactose specific pts from lactococcus lactis 0.7462 37 123
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8955 41 205 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8939 38 209 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8756 37 215 1.20.120.1760
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8748 27 210 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8564 36 260 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A832EXD2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9902 34 125 GO:0008654
GO:0016020
GO:0016780
AF-W0V588-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9647 34 273 GO:0003882
GO:0008444
GO:0008654
GO:0012505
GO:0016020
AF-A0A832EXD2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9591 34 125 GO:0008654
GO:0016020
GO:0016780
AF-A0A349SD42-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9556 40 266 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A1C0A929-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9526 48 207 GO:0003882
GO:0008654
GO:0012505
GO:0016020

Map