F361142

General Info

Members Datasets Scaffolds Average Seq Length
249 165 224 267

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_022204|Ga0500562_022204_30_956
Length 308
Sequence MPGLAHSHAEIAPEFSFHVFPFQALMPASFRSPSAAEDSPRPAPLAPEDYDVLDDILEDLRARNPNVPQWEFCEGFMAALVCCRRTIHPAEYWPVLLDAGDDLATLFTDAAQLERFSALWQQRWDGIAVALSIEVESLDDERAYCPEVIDVRGAIAALPESERAEALSHDDGQAADTSDLPAFGQVWALGFMFAVESWPDEWVVPSRDKEAKRWIDESMEAIAVLCEDDTGPAEVSAFETDAGEGPPSMSNARLQAFGEAVWAVYDLRELWRSIGPRVETVRRAAEPGRNDLCHCGSGKKYKKCHGAN

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221717 Acidovorax sp. Root267 Isolate Unclassified
11 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
12 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
13 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
14 2885198086 Variovorax sp. 679 Isolate Unclassified
15 2885211737 Variovorax sp. 553 Isolate Unclassified
16 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
17 2899924645 Variovorax sp. 369 Isolate Unclassified
18 2928037797 Variovorax sp. 1126 Isolate Unclassified
19 2928044640 Variovorax sp. 1128 Isolate Unclassified
20 2928051484 Variovorax sp. 1133 Isolate Unclassified
21 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
22 2928070936 Variovorax gossypii 1167 Isolate Unclassified
23 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
24 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
25 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
124 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
125 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
159 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
160 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
161 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 0.8
Isolates 10.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 43.78
Nodule 0.8
Rhizoplane 3.61
Rhizosphere 36.14
Stem 0
Stem Tuber 0
Unclassified 15.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10086445 3300001989 Bacteria 958
2 JGI25155J39150_1000042 3300002704 Bacteria 88585
3 JGI25156J39149_1000053 3300002705 Bacteria 88796
4 JGI25154J39366_1000082 3300002738 Bacteria 88767
5 JGI25157J39369_1000072 3300002741 Bacteria 88796
6 JGI25150J39212_1000649 3300002774 Bacteria 12976
7 JGI25150J39212_1004227 3300002774 Bacteria 3223
8 JGI25150J39212_1005391 3300002774 Bacteria 2732
9 JGI25159J45721_1001172 3300002987 Bacteria 11186
10 JGI25159J45721_1004516 3300002987 Bacteria 4600
11 JGI25159J45721_1006223 3300002987 Bacteria 3607
12 JGI25151J46595_10002989 3300003187 Bacteria 9641
13 JGI25151J46595_10006986 3300003187 Bacteria 5587
14 JGI25151J46595_10051643 3300003187 Bacteria 1390
15 JGI25160J50197_1000188 3300003354 Bacteria 52036
16 JGI25160J50197_1002467 3300003354 Bacteria 8609
17 JGI25161J50226_1000007 3300003374 Bacteria 256181
18 Ga0006562J51391_1129089 3300003578 Bacteria 3940
19 Ga0006562J51391_1129091 3300003578 Bacteria 2500
20 Ga0055535_1000460 3300003761 Bacteria 37464
21 Ga0055542_1000092 3300003762 Bacteria 121105
22 Ga0055526_1002015 3300003771 Bacteria 13974
23 Ga0055526_1003935 3300003771 Bacteria 9173
24 Ga0055537_1000243 3300003773 Bacteria 39987
25 Ga0055537_1008715 3300003773 Bacteria 2312
26 Ga0055524_1000213 3300003775 Bacteria 61225
27 Ga0055536_1000526 3300003781 Bacteria 26477
28 Ga0055536_1013080 3300003781 Bacteria 3023
29 Ga0055536_1019090 3300003781 Bacteria 2169
30 Ga0055534_1001447 3300003784 Bacteria 9452
31 Ga0055534_1002616 3300003784 Bacteria 6133
32 Ga0055528_1000316 3300003790 Bacteria 40688
33 Ga0055530_10001521 3300003791 Bacteria 16748
34 Ga0055530_10003710 3300003791 Bacteria 8501
35 Ga0055540_1000176 3300003792 Bacteria 63046
36 Ga0055531_10000570 3300003794 Bacteria 32274
37 Ga0055531_10000850 3300003794 Bacteria 25221
38 Ga0055531_10001384 3300003794 Bacteria 17989
39 Ga0055543_1000842 3300004625 Bacteria 14843
40 Ga0070658_10009519 3300005327 Bacteria 7804
41 Ga0070658_10060897 3300005327 Bacteria 3075
42 Ga0070658_10334863 3300005327 Bacteria 1294
43 Ga0070661_100217986 3300005344 Bacteria 1463
44 Ga0068851_10004697 3300005834 Bacteria 6176
45 Ga0075365_10102769 3300006038 Bacteria 1958
46 Ga0075365_10436475 3300006038 Bacteria 925
47 Ga0075364_10019151 3300006051 Bacteria 4293
48 Ga0075366_10046524 3300006195 Bacteria 2571
49 Ga0075366_10303660 3300006195 Bacteria 976
50 Ga0075370_10254678 3300006353 Bacteria 1041
51 Ga0068871_100260813 3300006358 Bacteria 1511
52 Ga0097620_100302790 3300006931 Bacteria 1692
53 Ga0105240_10394891 3300009093 Bacteria 1559
54 Ga0157373_10537355 3300013100 Bacteria 847
55 Ga0182008_10010292 3300014497 Bacteria 5009
56 Ga0157376_10361075 3300014969 Bacteria 1393
57 Ga0213872_10002909 3300021361 Bacteria 9736
58 Ga0209435_100019 3300025206 Bacteria 260989
59 Ga0209258_100020 3300025242 Bacteria 565241
60 Ga0207425_1000554 3300025245 Bacteria 22297
61 Ga0207425_1002808 3300025245 Bacteria 5880
62 Ga0207425_1002837 3300025245 Bacteria 5829
63 Ga0209646_1000038 3300025246 Bacteria 353982
64 Ga0209026_1000048 3300025250 Bacteria 257264
65 Ga0209148_1000031 3300025254 Bacteria 564601
66 Ga0209759_1000038 3300025256 Bacteria 257264
67 Ga0209129_1000136 3300025258 Bacteria 123804
68 Ga0209129_1001641 3300025258 Bacteria 12155
69 Ga0209129_1024166 3300025258 Bacteria 1073
70 Ga0209129_1026203 3300025258 Bacteria 1009
71 Ga0209565_1000026 3300025263 Bacteria 365910
72 Ga0209565_1002341 3300025263 Bacteria 6922
73 Ga0209673_1000009 3300025273 Bacteria 620735
74 Ga0209673_1000266 3300025273 Bacteria 98358
75 Ga0209673_1001437 3300025273 Bacteria 22664
76 Ga0209130_1000289 3300025284 Bacteria 61485
77 Ga0209130_1001571 3300025284 Bacteria 14386
78 Ga0209130_1003032 3300025284 Bacteria 7584
79 Ga0209130_1003326 3300025284 Bacteria 6927
80 Ga0209675_1000473 3300025291 Bacteria 30855
81 Ga0209675_1008467 3300025291 Bacteria 3772
82 Ga0209675_1016532 3300025291 Bacteria 2143
83 Ga0209676_1000013 3300025292 Bacteria 816080
84 Ga0209676_1008088 3300025292 Bacteria 4774
85 Ga0209025_1000620 3300025294 Bacteria 63314
86 Ga0209025_1000728 3300025294 Bacteria 55852
87 Ga0209025_1002159 3300025294 Bacteria 21921
88 Ga0209025_1004012 3300025294 Bacteria 13194
89 Ga0209025_1006033 3300025294 Bacteria 9587
90 Ga0209025_1012088 3300025294 Bacteria 5587
91 Ga0209564_1000101 3300025295 Bacteria 222879
92 Ga0209564_1000156 3300025295 Bacteria 165265
93 Ga0209564_1000579 3300025295 Bacteria 58010
94 Ga0209564_1000620 3300025295 Bacteria 54301
95 Ga0209564_1012266 3300025295 Bacteria 3751
96 Ga0209758_1000127 3300025297 Bacteria 189368
97 Ga0209758_1010234 3300025297 Bacteria 5652
98 Ga0209050_1000008 3300025298 Bacteria 1144179
99 Ga0209050_1002038 3300025298 Bacteria 18671
100 Ga0209256_1000003 3300025299 Bacteria 1661127
101 Ga0209256_1000104 3300025299 Bacteria 189367
102 Ga0209256_1000137 3300025299 Bacteria 158814
103 Ga0207426_1000091 3300025302 Bacteria 280561
104 Ga0207426_1000149 3300025302 Bacteria 189367
105 Ga0207426_1000478 3300025302 Bacteria 61105
106 Ga0207426_1004353 3300025302 Bacteria 6957
107 Ga0209051_1000005 3300025303 Bacteria 1142353
108 Ga0209051_1000055 3300025303 Bacteria 277194
109 Ga0209051_1014851 3300025303 Bacteria 3615
110 Ga0209257_1000048 3300025304 Bacteria 455536
111 Ga0209257_1000101 3300025304 Bacteria 251553
112 Ga0209257_1003830 3300025304 Bacteria 12333
113 Ga0209257_1055086 3300025304 Bacteria 1104
114 Ga0207656_10001611 3300025321 Bacteria 7508
115 Ga0207695_10134847 3300025913 Bacteria 2423
116 Ga0207686_10004484 3300025934 Bacteria 7480
117 Ga0207640_10276487 3300025981 Bacteria 1317
118 Ga0207639_10066857 3300026041 Bacteria 2795
119 Ga0207678_10364883 3300026067 Bacteria 1247
120 Ga0207674_10074952 3300026116 Bacteria 3394
121 Ga0207698_10067595 3300026142 Bacteria 2818
122 Ga0209971_1023726 3300027682 Bacteria 1464
123 Ga0209974_10067511 3300027876 Bacteria 1217
124 Ga0307515_10000751 3300028794 Bacteria 75067
125 Ga0265330_10000012 3300031235 Bacteria 180837
126 Ga0265332_10000012 3300031238 Bacteria 272641
127 Ga0265332_10000134 3300031238 Bacteria 61247
128 Ga0265325_10011854 3300031241 Bacteria 4999
129 Ga0265340_10009480 3300031247 Bacteria 5223
130 Ga0307513_10000246 3300031456 Bacteria 78455
131 Ga0307513_10005219 3300031456 Bacteria 17204
132 Ga0307408_100000111 3300031548 Bacteria 90575
133 Ga0307408_100002072 3300031548 Bacteria 14440
134 Ga0307408_100090219 3300031548 Bacteria 2312
135 Ga0307408_100142316 3300031548 Bacteria 1884
136 Ga0307514_10006983 3300031649 Bacteria 9763
137 Ga0265314_10000029 3300031711 Bacteria 272506
138 Ga0307516_10011776 3300031730 Bacteria 9485
139 Ga0307406_10000046 3300031901 Bacteria 69556
140 Ga0307406_10059522 3300031901 Bacteria 2459
141 Ga0307406_10207751 3300031901 Bacteria 1446
142 Ga0307412_10416302 3300031911 Bacteria 1098
143 Ga0307416_100643777 3300032002 Bacteria 1144
144 Ga0395899_0074838 3300037312 Bacteria 2473
145 Ga0395900_0144092 3300037418 Bacteria 2437
146 Ga0395900_0536822 3300037418 Bacteria 1116
147 Ga0395898_0038546 3300037466 Bacteria 4735
148 Ga0395898_0054450 3300037466 Bacteria 3904
149 Ga0395905_0000898 3300037471 Bacteria 38801
150 Ga0395905_0001977 3300037471 Bacteria 23435
151 Ga0395905_0011572 3300037471 Bacteria 8523
152 Ga0395905_0073988 3300037471 Bacteria 3193
153 Ga0395905_0105850 3300037471 Bacteria 2641
154 Ga0395905_0113073 3300037471 Bacteria 2550
155 Ga0395905_0192404 3300037471 Bacteria 1913
156 Ga0395905_0438619 3300037471 Bacteria 1203
157 Ga0395905_0672533 3300037471 Bacteria 937
158 Ga0395901_0127586 3300038443 Bacteria 2673
159 Ga0395901_0194527 3300038443 Bacteria 2127
160 Ga0395901_0691540 3300038443 Bacteria 1018
161 Ga0436361_0063474 3300039447 Bacteria 40373
162 Ga0439439_0054216 3300041406 Bacteria 1056
163 Ga0439453_0016522 3300041408 Bacteria 1288
164 Ga0451795_1546150 3300041456 Bacteria 1328
165 Ga0451798_0381216 3300041458 Bacteria 820
166 Ga0451800_0156206 3300041459 Bacteria 1425
167 Ga0451841_1433608 3300041498 Bacteria 1441
168 Ga0439445_0008880 3300042004 Bacteria 2361
169 Ga0439449_0003313 3300042007 Bacteria 6286
170 Ga0439462_0003684 3300042015 Bacteria 3695
171 Ga0439463_074104 3300042016 Bacteria 873
172 Ga0450911_000402 3300042115 Bacteria 14291
173 Ga0450897_011160 3300042128 Bacteria 872
174 Ga0450898_035831 3300042134 Bacteria 925
175 Ga0439446_0030718 3300042156 Bacteria 1553
176 Ga0450909_004989 3300042185 Bacteria 1906
177 Ga0439434_0078582 3300042435 Bacteria 1045
178 Ga0451577_0013611 3300042876 Bacteria 7606
179 Ga0451577_0017366 3300042876 Bacteria 6649
180 Ga0466972_0169226 3300044658 Bacteria 1026
181 Ga0453683_0017062 3300044673 Bacteria 4681
182 Ga0453684_0030817 3300044712 Bacteria 7564
183 Ga0453684_0164901 3300044712 Bacteria 2617
184 Ga0453684_0187414 3300044712 Bacteria 2423
185 Ga0466970_0088036 3300044765 Bacteria 1684
186 Ga0451576_0015405 3300045051 Bacteria 8468
187 Ga0451576_0121689 3300045051 Bacteria 2717
188 Ga0495651_0148829 3300046462 Bacteria 1690
189 Ga0495654_0002611 3300046530 Bacteria 11484
190 Ga0495597_0000717 3300046542 Bacteria 26586
191 Ga0495633_0013017 3300046558 Bacteria 4401
192 Ga0495656_0019316 3300046615 Bacteria 2630
193 Ga0495635_0326836 3300046663 Bacteria 1026
194 Ga0496102_0160938 3300048905 Bacteria 2112
195 Ga0496110_0092051 3300048913 Bacteria 2713
196 Ga0496114_0133480 3300048917 Bacteria 2146
197 Ga0496116_0031010 3300048919 Bacteria 3835
198 Ga0496117_0037244 3300048920 Bacteria 3626
199 Ga0496118_0007907 3300048921 Bacteria 11136
200 Ga0496118_0011223 3300048921 Bacteria 8770
201 Ga0496121_0015791 3300048924 Bacteria 7864
202 Ga0496124_0015334 3300048927 Bacteria 7354
203 Ga0496125_0003362 3300048928 Bacteria 19484
204 Ga0496125_0004947 3300048928 Bacteria 15076
205 Ga0496125_0012250 3300048928 Bacteria 8527
206 Ga0496126_0056169 3300048929 Bacteria 3560
207 nmdc:mga03n38_198301_c1 3300050490 Bacteria 1038
208 nmdc:mga0k408_4416_c1 3300050493 Bacteria 7468
209 nmdc:mga06z11_58938_c1 3300050494 Bacteria 1994
210 nmdc:mga06z11_63025_c1 3300050494 Bacteria 1938
211 Ga0500644_0011562 3300053088 Bacteria 2415
212 Ga0500651_0000026 3300053093 Bacteria 117323
213 Ga0500651_0066320 3300053093 Bacteria 2248
214 Ga0500566_0087795 3300053094 Bacteria 1722
215 Ga0500650_0030747 3300053098 Bacteria 2437
216 Ga0500660_096792 3300053100 Bacteria 1300
217 Ga0500562_022204 3300053108 Bacteria 1654
218 Ga0500593_008564 3300053117 Bacteria 4208
219 Ga0500628_022219 3300053129 Bacteria 1295
220 Ga0500658_0001421 3300053134 Bacteria 9645
221 Ga0500586_007041 3300053145 Bacteria 2973
222 Ga0500645_001378 3300053730 Bacteria 12439
223 Ga0500645_013552 3300053730 Bacteria 2614
224 Ga0500661_003659 3300055283 Bacteria 2887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042016 Ga0439463_074104 Ga0439463_074104_22_741 210
2 3300041458 Ga0451798_0381216 Ga0451798_0381216_29_706 211
3 3300041406 Ga0439439_0054216 Ga0439439_0054216_170_880 235
4 3300042007 Ga0439449_0003313 Ga0439449_0003313_240_950 235
5 3300042015 Ga0439462_0003684 Ga0439462_0003684_899_1609 235
6 3300042134 Ga0450898_035831 Ga0450898_035831_190_900 235
7 3300031730 Ga0307516_10011776 Ga0307516_100117767 241
8 3300037471 Ga0395905_0438619 Ga0395905_0438619_122_889 241
9 3300002704 JGI25155J39150_1000042 JGI25155J39150_100004255 243
10 3300002705 JGI25156J39149_1000053 JGI25156J39149_100005326 243
11 3300002738 JGI25154J39366_1000082 JGI25154J39366_100008226 243
12 3300002741 JGI25157J39369_1000072 JGI25157J39369_100007255 243
13 3300006195 Ga0075366_10046524 Ga0075366_100465241 243
14 3300025206 Ga0209435_100019 Ga0209435_100019158 243
15 3300025246 Ga0209646_1000038 Ga0209646_1000038159 243
16 3300025250 Ga0209026_1000048 Ga0209026_1000048158 243
17 3300025256 Ga0209759_1000038 Ga0209759_100003886 243
18 3300046663 Ga0495635_0326836 Ga0495635_0326836_199_1011 243
19 3300050493 nmdc:mga0k408_4416_c1 nmdc:mga0k408_4416_c1_3819_4631 243
20 3300053100 Ga0500660_096792 Ga0500660_096792_446_1276 243
21 3300005327 Ga0070658_10009519 Ga0070658_100095194 246
22 iso_pu_bacteria 2932422444 2932423086 248
23 3300053117 Ga0500593_008564 Ga0500593_008564_1261_2091 250
24 3300037466 Ga0395898_0054450 Ga0395898_0054450_585_1343 251
25 3300037471 Ga0395905_0672533 Ga0395905_0672533_136_894 251
26 3300038443 Ga0395901_0691540 Ga0395901_0691540_108_866 251
27 3300053730 Ga0500645_013552 Ga0500645_013552_614_1411 251
28 3300046558 Ga0495633_0013017 Ga0495633_0013017_2328_3137 252
29 iso_pu_bacteria 2881101125 2881104642 252
30 3300006038 Ga0075365_10102769 Ga0075365_101027692 253
31 3300028794 Ga0307515_10000751 Ga0307515_1000075163 253
32 3300031238 Ga0265332_10000134 Ga0265332_1000013424 253
33 3300031456 Ga0307513_10005219 Ga0307513_100052196 253
34 3300031649 Ga0307514_10006983 Ga0307514_100069836 253
35 3300046530 Ga0495654_0002611 Ga0495654_0002611_8135_8968 253
36 3300046615 Ga0495656_0019316 Ga0495656_0019316_694_1455 253
37 3300050490 nmdc:mga03n38_198301_c1 nmdc:mga03n38_198301_c1_137_919 253
38 3300050494 nmdc:mga06z11_58938_c1 nmdc:mga06z11_58938_c1_194_976 253
39 3300003794 Ga0055531_10000570 Ga0055531_1000057025 254
40 3300005327 Ga0070658_10060897 Ga0070658_100608974 254
41 3300006931 Ga0097620_100302790 Ga0097620_1003027902 254
42 3300025303 Ga0209051_1000055 Ga0209051_1000055224 254
43 3300025304 Ga0209257_1000101 Ga0209257_1000101198 254
44 3300031235 Ga0265330_10000012 Ga0265330_1000001221 254
45 3300031238 Ga0265332_10000012 Ga0265332_1000001221 254
46 3300031241 Ga0265325_10011854 Ga0265325_100118544 254
47 3300031247 Ga0265340_10009480 Ga0265340_100094801 254
48 3300031711 Ga0265314_10000029 Ga0265314_10000029237 254
49 3300037312 Ga0395899_0074838 Ga0395899_0074838_994_1761 254
50 3300037418 Ga0395900_0144092 Ga0395900_0144092_1090_1857 254
51 3300037466 Ga0395898_0038546 Ga0395898_0038546_2356_3123 254
52 3300037471 Ga0395905_0000898 Ga0395905_0000898_8126_8893 254
53 3300037471 Ga0395905_0011572 Ga0395905_0011572_5417_6184 254
54 3300037471 Ga0395905_0073988 Ga0395905_0073988_937_1704 254
55 3300037471 Ga0395905_0105850 Ga0395905_0105850_994_1761 254
56 3300038443 Ga0395901_0127586 Ga0395901_0127586_1154_1921 254
57 3300041408 Ga0439453_0016522 Ga0439453_0016522_95_862 254
58 3300042128 Ga0450897_011160 Ga0450897_011160_91_858 254
59 3300042156 Ga0439446_0030718 Ga0439446_0030718_436_1203 254
60 3300042185 Ga0450909_004989 Ga0450909_004989_664_1431 254
61 3300042435 Ga0439434_0078582 Ga0439434_0078582_142_909 254
62 3300044658 Ga0466972_0169226 Ga0466972_0169226_232_999 254
63 3300044712 Ga0453684_0164901 Ga0453684_0164901_1057_1845 254
64 3300044712 Ga0453684_0187414 Ga0453684_0187414_1203_2003 254
65 3300044765 Ga0466970_0088036 Ga0466970_0088036_472_1239 254
66 3300046542 Ga0495597_0000717 Ga0495597_0000717_21729_22601 254
67 3300050494 nmdc:mga06z11_63025_c1 nmdc:mga06z11_63025_c1_410_1177 254
68 3300032002 Ga0307416_100643777 Ga0307416_1006437772 255
69 3300037471 Ga0395905_0192404 Ga0395905_0192404_930_1697 255
70 3300042004 Ga0439445_0008880 Ga0439445_0008880_205_1062 255
71 3300042115 Ga0450911_000402 Ga0450911_000402_6937_7794 255
72 3300042876 Ga0451577_0017366 Ga0451577_0017366_709_1518 255
73 3300044673 Ga0453683_0017062 Ga0453683_0017062_2241_3098 255
74 3300045051 Ga0451576_0015405 Ga0451576_0015405_7326_8135 255
75 3300048928 Ga0496125_0003362 Ga0496125_0003362_13906_14763 255
76 3300048929 Ga0496126_0056169 Ga0496126_0056169_32_889 255
77 3300053093 Ga0500651_0066320 Ga0500651_0066320_735_1547 255
78 iso_pu_bacteria 2842718218 2842722412 255
79 3300002774 JGI25150J39212_1004227 JGI25150J39212_10042271 256
80 3300002987 JGI25159J45721_1004516 JGI25159J45721_10045163 256
81 3300003187 JGI25151J46595_10006986 JGI25151J46595_100069863 256
82 3300003771 Ga0055526_1002015 Ga0055526_10020153 256
83 3300003771 Ga0055526_1003935 Ga0055526_10039353 256
84 3300003773 Ga0055537_1000243 Ga0055537_100024334 256
85 3300003773 Ga0055537_1008715 Ga0055537_10087152 256
86 3300003775 Ga0055524_1000213 Ga0055524_100021353 256
87 3300003781 Ga0055536_1000526 Ga0055536_10005267 256
88 3300003784 Ga0055534_1002616 Ga0055534_10026164 256
89 3300003790 Ga0055528_1000316 Ga0055528_100031634 256
90 3300003791 Ga0055530_10001521 Ga0055530_100015213 256
91 3300003791 Ga0055530_10003710 Ga0055530_100037105 256
92 3300003792 Ga0055540_1000176 Ga0055540_100017634 256
93 3300003794 Ga0055531_10000850 Ga0055531_1000085019 256
94 3300003794 Ga0055531_10001384 Ga0055531_100013843 256
95 3300005327 Ga0070658_10334863 Ga0070658_103348632 256
96 3300025245 Ga0207425_1002808 Ga0207425_10028083 256
97 3300025263 Ga0209565_1000026 Ga0209565_10000263 256
98 3300025263 Ga0209565_1002341 Ga0209565_10023414 256
99 3300025273 Ga0209673_1000009 Ga0209673_100000912 256
100 3300025284 Ga0209130_1001571 Ga0209130_10015713 256
101 3300025291 Ga0209675_1000473 Ga0209675_10004734 256
102 3300025291 Ga0209675_1008467 Ga0209675_10084672 256
103 3300025292 Ga0209676_1000013 Ga0209676_1000013233 256
104 3300025294 Ga0209025_1006033 Ga0209025_10060333 256
105 3300025294 Ga0209025_1012088 Ga0209025_10120884 256
106 3300025295 Ga0209564_1000579 Ga0209564_10005793 256
107 3300025295 Ga0209564_1000620 Ga0209564_100062048 256
108 3300025298 Ga0209050_1000008 Ga0209050_1000008233 256
109 3300025299 Ga0209256_1000003 Ga0209256_1000003167 256
110 3300025302 Ga0207426_1004353 Ga0207426_10043535 256
111 3300025303 Ga0209051_1000005 Ga0209051_1000005233 256
112 3300025304 Ga0209257_1000048 Ga0209257_1000048233 256
113 3300025934 Ga0207686_10004484 Ga0207686_100044842 256
114 3300031548 Ga0307408_100090219 Ga0307408_1000902193 256
115 3300037418 Ga0395900_0536822 Ga0395900_0536822_326_1099 256
116 3300037471 Ga0395905_0001977 Ga0395905_0001977_19058_19831 256
117 3300053145 Ga0500586_007041 Ga0500586_007041_2029_2883 256
118 3300006195 Ga0075366_10303660 Ga0075366_103036601 257
119 3300031548 Ga0307408_100142316 Ga0307408_1001423162 257
120 3300031901 Ga0307406_10207751 Ga0307406_102077512 257
121 3300031911 Ga0307412_10416302 Ga0307412_104163022 257
122 3300041498 Ga0451841_1433608 Ga0451841_1433608_397_1179 257
123 3300042876 Ga0451577_0013611 Ga0451577_0013611_3726_4529 257
124 3300044712 Ga0453684_0030817 Ga0453684_0030817_5708_6511 257
125 3300045051 Ga0451576_0121689 Ga0451576_0121689_1679_2482 257
126 iso_pu_bacteria 2511231002 2511245327 257
127 iso_pu_bacteria 2547132374 2548501473 257
128 iso_pu_bacteria 2643221570 2643868306 257
129 iso_pu_bacteria 2643221596 2643994407 257
130 iso_pu_bacteria 2643221652 2644295244 257
131 iso_pu_bacteria 2643221717 2644648980 257
132 iso_pu_bacteria 2894023352 2894023681 257
133 iso_pu_bacteria 2928115317 2928120549 257
134 iso_pu_bacteria 2990710928 2990715332 257
135 3300027682 Ga0209971_1023726 Ga0209971_10237261 258
136 3300027876 Ga0209974_10067511 Ga0209974_100675112 258
137 3300037471 Ga0395905_0113073 Ga0395905_0113073_1203_1988 258
138 3300038443 Ga0395901_0194527 Ga0395901_0194527_936_1721 258
139 3300048924 Ga0496121_0015791 Ga0496121_0015791_6983_7846 258
140 3300048928 Ga0496125_0004947 Ga0496125_0004947_7240_8103 258
141 3300006051 Ga0075364_10019151 Ga0075364_100191515 259
142 3300021361 Ga0213872_10002909 Ga0213872_100029096 259
143 3300039447 Ga0436361_0063474 Ga0436361_0063474_14306_15220 259
144 3300048913 Ga0496110_0092051 Ga0496110_0092051_1775_2554 259
145 3300048917 Ga0496114_0133480 Ga0496114_0133480_553_1335 259
146 3300053108 Ga0500562_022204 Ga0500562_022204_30_956 259
147 iso_pu_bacteria 2599185214 2599622129 259
148 iso_pu_bacteria 2599185226 2599676434 259
149 iso_pu_bacteria 2599185227 2599680464 259
150 iso_pu_bacteria 2599185229 2599692480 259
151 iso_pu_bacteria 2838054893 2838058715 259
152 iso_pu_bacteria 2885198086 2885202572 259
153 iso_pu_bacteria 2885211737 2885216225 259
154 iso_pu_bacteria 2899924645 2899929708 259
155 iso_pu_bacteria 2928037797 2928042352 259
156 iso_pu_bacteria 2928044640 2928050121 259
157 iso_pu_bacteria 2928051484 2928054702 259
158 iso_pu_bacteria 2928064002 2928070291 259
159 iso_pu_bacteria 2928070936 2928074024 259
160 3300031548 Ga0307408_100000111 Ga0307408_10000011117 260
161 3300031901 Ga0307406_10000046 Ga0307406_1000004670 260
162 3300046462 Ga0495651_0148829 Ga0495651_0148829_297_1079 260
163 3300002774 JGI25150J39212_1005391 JGI25150J39212_10053913 261
164 3300002987 JGI25159J45721_1001172 JGI25159J45721_100117210 261
165 3300003187 JGI25151J46595_10002989 JGI25151J46595_100029897 261
166 3300003187 JGI25151J46595_10051643 JGI25151J46595_100516432 261
167 3300003354 JGI25160J50197_1000188 JGI25160J50197_100018824 261
168 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000755 261
169 3300003781 Ga0055536_1013080 Ga0055536_10130802 261
170 3300004625 Ga0055543_1000842 Ga0055543_10008429 261
171 3300006038 Ga0075365_10436475 Ga0075365_104364751 261
172 3300006353 Ga0075370_10254678 Ga0075370_102546782 261
173 3300025245 Ga0207425_1002837 Ga0207425_10028373 261
174 3300025258 Ga0209129_1024166 Ga0209129_10241662 261
175 3300025258 Ga0209129_1026203 Ga0209129_10262031 261
176 3300025284 Ga0209130_1000289 Ga0209130_10002893 261
177 3300025292 Ga0209676_1008088 Ga0209676_10080883 261
178 3300025294 Ga0209025_1000728 Ga0209025_100072819 261
179 3300025294 Ga0209025_1002159 Ga0209025_10021593 261
180 3300025295 Ga0209564_1012266 Ga0209564_10122662 261
181 3300025298 Ga0209050_1002038 Ga0209050_100203815 261
182 3300025302 Ga0207426_1000091 Ga0207426_1000091165 261
183 3300025304 Ga0209257_1055086 Ga0209257_10550862 261
184 3300031456 Ga0307513_10000246 Ga0307513_1000024622 261
185 3300031548 Ga0307408_100002072 Ga0307408_1000020726 261
186 3300031901 Ga0307406_10059522 Ga0307406_100595222 261
187 3300041456 Ga0451795_1546150 Ga0451795_1546150_371_1201 261
188 3300041459 Ga0451800_0156206 Ga0451800_0156206_274_1104 261
189 3300053088 Ga0500644_0011562 Ga0500644_0011562_616_1446 261
190 3300053094 Ga0500566_0087795 Ga0500566_0087795_286_1116 261
191 3300053098 Ga0500650_0030747 Ga0500650_0030747_417_1247 261
192 3300053129 Ga0500628_022219 Ga0500628_022219_82_912 261
193 3300053730 Ga0500645_001378 Ga0500645_001378_2653_3483 261
194 3300055283 Ga0500661_003659 Ga0500661_003659_601_1431 261
195 3300001989 JGI24739J22299_10086445 JGI24739J22299_100864452 263
196 3300002774 JGI25150J39212_1000649 JGI25150J39212_10006493 263
197 3300002987 JGI25159J45721_1006223 JGI25159J45721_10062233 263
198 3300003354 JGI25160J50197_1002467 JGI25160J50197_10024676 263
199 3300003578 Ga0006562J51391_1129089 Ga0006562J51391_11290892 263
200 3300003578 Ga0006562J51391_1129091 Ga0006562J51391_11290912 263
201 3300003761 Ga0055535_1000460 Ga0055535_100046011 263
202 3300003762 Ga0055542_1000092 Ga0055542_100009262 263
203 3300003781 Ga0055536_1019090 Ga0055536_10190902 263
204 3300003784 Ga0055534_1001447 Ga0055534_10014473 263
205 3300005344 Ga0070661_100217986 Ga0070661_1002179861 263
206 3300005834 Ga0068851_10004697 Ga0068851_100046973 263
207 3300006358 Ga0068871_100260813 Ga0068871_1002608132 263
208 3300009093 Ga0105240_10394891 Ga0105240_103948912 263
209 3300013100 Ga0157373_10537355 Ga0157373_105373551 263
210 3300014497 Ga0182008_10010292 Ga0182008_100102922 263
211 3300014969 Ga0157376_10361075 Ga0157376_103610752 263
212 3300025242 Ga0209258_100020 Ga0209258_10002095 263
213 3300025245 Ga0207425_1000554 Ga0207425_100055421 263
214 3300025254 Ga0209148_1000031 Ga0209148_100003195 263
215 3300025258 Ga0209129_1000136 Ga0209129_100013650 263
216 3300025258 Ga0209129_1001641 Ga0209129_10016418 263
217 3300025273 Ga0209673_1000266 Ga0209673_100026614 263
218 3300025273 Ga0209673_1001437 Ga0209673_100143717 263
219 3300025284 Ga0209130_1003032 Ga0209130_10030322 263
220 3300025284 Ga0209130_1003326 Ga0209130_10033262 263
221 3300025291 Ga0209675_1016532 Ga0209675_10165322 263
222 3300025294 Ga0209025_1000620 Ga0209025_100062047 263
223 3300025294 Ga0209025_1004012 Ga0209025_100401211 263
224 3300025295 Ga0209564_1000101 Ga0209564_100010195 263
225 3300025295 Ga0209564_1000156 Ga0209564_100015678 263
226 3300025297 Ga0209758_1000127 Ga0209758_1000127107 263
227 3300025297 Ga0209758_1010234 Ga0209758_10102347 263
228 3300025299 Ga0209256_1000104 Ga0209256_1000104107 263
229 3300025299 Ga0209256_1000137 Ga0209256_1000137100 263
230 3300025302 Ga0207426_1000149 Ga0207426_1000149107 263
231 3300025302 Ga0207426_1000478 Ga0207426_100047814 263
232 3300025303 Ga0209051_1014851 Ga0209051_10148512 263
233 3300025304 Ga0209257_1003830 Ga0209257_100383012 263
234 3300025321 Ga0207656_10001611 Ga0207656_100016114 263
235 3300025913 Ga0207695_10134847 Ga0207695_101348472 263
236 3300025981 Ga0207640_10276487 Ga0207640_102764872 263
237 3300026041 Ga0207639_10066857 Ga0207639_100668572 263
238 3300026067 Ga0207678_10364883 Ga0207678_103648831 263
239 3300026116 Ga0207674_10074952 Ga0207674_100749522 263
240 3300026142 Ga0207698_10067595 Ga0207698_100675952 263
241 3300048905 Ga0496102_0160938 Ga0496102_0160938_1123_1914 263
242 3300048919 Ga0496116_0031010 Ga0496116_0031010_2650_3441 263
243 3300048920 Ga0496117_0037244 Ga0496117_0037244_947_1738 263
244 3300048921 Ga0496118_0007907 Ga0496118_0007907_8983_9774 263
245 3300048921 Ga0496118_0011223 Ga0496118_0011223_5128_5919 263
246 3300048927 Ga0496124_0015334 Ga0496124_0015334_4745_5536 263
247 3300048928 Ga0496125_0012250 Ga0496125_0012250_801_1595 263
248 3300053093 Ga0500651_0000026 Ga0500651_0000026_114602_115396 263
249 3300053134 Ga0500658_0001421 Ga0500658_0001421_7707_8501 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02810

SEC-C

SEC-C motif

289

307

0.97

PF03695

UPF0149

Uncharacterised protein family (UPF0149)

51

273

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gyt-assembly1.cif.gz_B-2 crystal structure of lpg0076 protein from legionella pneumophila 0.6391 26 230
1izm-assembly1.cif.gz_A-2 structure of ygfb from haemophilus influenzae (hi0817), a conserved hypothetical protein 0.6206 26 231
1izm-assembly1.cif.gz_A-2 structure of ygfb from haemophilus influenzae (hi0817), a conserved hypothetical protein 0.6086 26 231
4gyt-assembly1.cif.gz_B-2 crystal structure of lpg0076 protein from legionella pneumophila 0.6083 26 230
4llc-assembly2.cif.gz_B the crystal structure of r60e mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.5946 145 229
ID Description Score Start End Superfamily
af_P0AD05_6_194_1.20.120.740 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);YgfB uncharacterised protein family PF03695 0.6918 21 239 1.20.120.740
af_P0AD05_6_194_1.20.120.740 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);YgfB uncharacterised protein family PF03695 0.6855 21 239 1.20.120.740
4gytB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);YgfB uncharacterised protein family PF03695 0.6391 26 230 1.20.120.740
4gytB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);YgfB uncharacterised protein family PF03695 0.6083 26 230 1.20.120.740
1izmA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);YgfB uncharacterised protein family PF03695 0.5906 34 231 1.20.120.740
ID Description Score Start End GO Terms
AF-A0A4Q3MHK3-F1-model_v4 deleted 0.9385 20 262
AF-A0A4Q3MHK3-F1-model_v4 deleted 0.9274 20 262
AF-A0A7X9K6G6-F1-model_v4 deleted 0.924 16 262
AF-A0A6L9KSN8-F1-model_v4 UPF0149 family protein 0.9215 18 263
AF-A0A520GC97-F1-model_v4 Zinc chelation protein SecC 0.9179 18 263

Feature Viewer

pLDDT pTM Quality
90.43 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map