F361135

General Info

Members Datasets Scaffolds Average Seq Length
249 168 498 186

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_72444_c1|nmdc:mga0n895_72444_c1_2187_2864
Length 225
Sequence VVVLVLSSTLTQRRGASVFAASVASRETPYIEINTTAGEVAMKGKTLLAIATATWALTILGAVTSAQDKYNLRVPGGLAFSEFRGYEDWAVIAIDHTDDLMKAIVGNPVAVDAFRAGIPGNGRPFPDGTKIAKVEWRPTKSPDAPYDINVPSTVYDLDFMVKDAKRFAGSGGWGYAVFKYESGAGTYTPATLTHKPPQANDARCGSACHTIAKAKDYVFTEYARR

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0.4
Rhizoplane 10.44
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 8.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_72444_c1 3300050512 Unclassified 3418
2 Ga0070683_100027134 3300005329 Bacteria 5163
3 Ga0070670_100028917 3300005331 Bacteria 4771
4 Ga0070666_10004400 3300005335 Bacteria 8580
5 Ga0070666_10787765 3300005335 Bacteria 700
6 Ga0070689_100156184 3300005340 Bacteria 1842
7 Ga0070661_100684347 3300005344 Bacteria 835
8 Ga0070675_100034364 3300005354 Bacteria 4114
9 Ga0070671_100048345 3300005355 Bacteria 3537
10 Ga0070671_100698968 3300005355 Bacteria 879
11 Ga0070673_100003804 3300005364 Bacteria 9468
12 Ga0070688_100106293 3300005365 Bacteria 1859
13 Ga0070667_100004584 3300005367 Bacteria 11616
14 Ga0070667_100131937 3300005367 Bacteria 2181
15 Ga0070709_10015084 3300005434 Bacteria 4389
16 Ga0070714_100418773 3300005435 Bacteria 1269
17 Ga0070713_100106180 3300005436 Bacteria 2441
18 Ga0070713_100233206 3300005436 Bacteria 1674
19 Ga0070713_100482696 3300005436 Bacteria 1167
20 Ga0070713_100719915 3300005436 Bacteria 954
21 Ga0070711_100035637 3300005439 Bacteria 3328
22 Ga0070711_100050771 3300005439 Bacteria 2845
23 Ga0070705_100200481 3300005440 Bacteria 1368
24 Ga0070708_100377067 3300005445 Bacteria 1337
25 Ga0070681_10125562 3300005458 Bacteria 2499
26 Ga0070706_100449183 3300005467 Bacteria 1200
27 Ga0070707_100206276 3300005468 Bacteria 1916
28 Ga0070679_100029926 3300005530 Bacteria 5373
29 Ga0070697_100017713 3300005536 Bacteria 5612
30 Ga0070697_100232543 3300005536 Bacteria 1572
31 Ga0070697_100651324 3300005536 Bacteria 928
32 Ga0068853_100734839 3300005539 Bacteria 943
33 Ga0070672_100079769 3300005543 Bacteria 2621
34 Ga0070695_100258308 3300005545 Unclassified 1271
35 Ga0070696_100738375 3300005546 Bacteria 805
36 Ga0070693_100965055 3300005547 Unclassified 643
37 Ga0070665_100108301 3300005548 Bacteria 2781
38 Ga0070665_100775344 3300005548 Bacteria 972
39 Ga0070665_100942292 3300005548 Bacteria 876
40 Ga0070704_100158508 3300005549 Bacteria 1787
41 Ga0070664_100000439 3300005564 Bacteria 31278
42 Ga0070664_100770608 3300005564 Unclassified 899
43 Ga0070664_101372466 3300005564 Bacteria 668
44 Ga0068856_100130785 3300005614 Bacteria 2515
45 Ga0068856_101121273 3300005614 Bacteria 804
46 Ga0068856_101227508 3300005614 Bacteria 766
47 Ga0070702_100017407 3300005615 Bacteria 3707
48 Ga0070702_100896359 3300005615 Bacteria 694
49 Ga0068852_100291662 3300005616 Bacteria 1576
50 Ga0068859_100008953 3300005617 Bacteria 10110
51 Ga0068859_101212214 3300005617 Unclassified 831
52 Ga0068859_101215619 3300005617 Unclassified 830
53 Ga0068864_100012720 3300005618 Bacteria 6956
54 Ga0068864_101132578 3300005618 Bacteria 779
55 Ga0068851_10522578 3300005834 Bacteria 714
56 Ga0068863_100422859 3300005841 Bacteria 1305
57 Ga0068863_100788277 3300005841 Unclassified 947
58 Ga0068858_100004840 3300005842 Bacteria 13199
59 Ga0068858_100743424 3300005842 Unclassified 955
60 Ga0068858_101148627 3300005842 Bacteria 763
61 Ga0068860_100053760 3300005843 Bacteria 3829
62 Ga0068862_100049529 3300005844 Bacteria 3588
63 Ga0068862_100220026 3300005844 Bacteria 1719
64 Ga0068862_100330799 3300005844 Bacteria 1409
65 Ga0068862_100618302 3300005844 Bacteria 1042
66 Ga0081455_10016579 3300005937 Bacteria 7105
67 Ga0070717_10281321 3300006028 Bacteria 1475
68 Ga0070717_10297434 3300006028 Bacteria 1434
69 Ga0070717_10432298 3300006028 Bacteria 1185
70 Ga0070717_11064244 3300006028 Bacteria 737
71 Ga0070712_100084438 3300006175 Bacteria 2309
72 Ga0070712_100159629 3300006175 Bacteria 1740
73 Ga0097621_100080579 3300006237 Bacteria 2708
74 Ga0097621_100261721 3300006237 Bacteria 1518
75 Ga0068871_101066665 3300006358 Bacteria 754
76 Ga0075428_100356163 3300006844 Bacteria 1570
77 Ga0075430_100260423 3300006846 Bacteria 1436
78 Ga0075433_10513637 3300006852 Bacteria 1054
79 Ga0075434_100018157 3300006871 Bacteria 6789
80 Ga0075436_100013230 3300006914 Bacteria 5656
81 Ga0075436_100117983 3300006914 Bacteria 1855
82 Ga0075436_100121313 3300006914 Bacteria 1829
83 Ga0097620_100008953 3300006931 Bacteria 10110
84 Ga0097620_100367421 3300006931 Bacteria 1534
85 Ga0097620_101215709 3300006931 Unclassified 830
86 Ga0075435_100055819 3300007076 Unclassified 3191
87 Ga0075435_100265185 3300007076 Bacteria 1464
88 Ga0111539_10034417 3300009094 Bacteria 6142
89 Ga0111539_10463567 3300009094 Bacteria 1475
90 Ga0105245_10004351 3300009098 Bacteria 12534
91 Ga0105245_11601630 3300009098 Bacteria 703
92 Ga0105247_10005778 3300009101 Bacteria 7747
93 Ga0114129_10328516 3300009147 Bacteria 2031
94 Ga0105243_11038523 3300009148 Bacteria 824
95 Ga0105242_10055388 3300009176 Bacteria 3244
96 Ga0105248_10078505 3300009177 Bacteria 3711
97 Ga0105248_10896425 3300009177 Unclassified 1001
98 Ga0105248_11196876 3300009177 Bacteria 859
99 Ga0105238_10645351 3300009551 Bacteria 1068
100 Ga0105239_10154910 3300010375 Bacteria 2559
101 Ga0105239_11023755 3300010375 Bacteria 950
102 Ga0105246_10566183 3300011119 Bacteria 976
103 Ga0105246_10605364 3300011119 Unclassified 947
104 Ga0157370_10100280 3300013104 Bacteria 2713
105 Ga0157370_11423226 3300013104 Bacteria 624
106 Ga0157369_10078202 3300013105 Bacteria 3545
107 Ga0157374_10541266 3300013296 Bacteria 1171
108 Ga0157374_10834312 3300013296 Bacteria 938
109 Ga0157374_10842058 3300013296 Unclassified 934
110 Ga0163162_10436366 3300013306 Bacteria 1442
111 Ga0163162_11283918 3300013306 Unclassified 832
112 Ga0157375_10055767 3300013308 Bacteria 3898
113 Ga0157375_11380248 3300013308 Bacteria 830
114 Ga0163163_10018925 3300014325 Bacteria 6460
115 Ga0157379_10079340 3300014968 Bacteria 2939
116 Ga0157379_10593091 3300014968 Unclassified 1034
117 Ga0157376_10077790 3300014969 Bacteria 2838
118 Ga0157376_10160285 3300014969 Bacteria 2038
119 Ga0157376_10745218 3300014969 Unclassified 988
120 Ga0163161_10600249 3300017792 Bacteria 907
121 Ga0213873_10028653 3300021358 Bacteria 1367
122 Ga0213873_10040199 3300021358 Bacteria 1201
123 Ga0213872_10038423 3300021361 Bacteria 2185
124 Ga0213872_10196614 3300021361 Bacteria 866
125 Ga0213871_10013917 3300021441 Bacteria 1899
126 Ga0213871_10018506 3300021441 Bacteria 1705
127 Ga0207710_10017395 3300025900 Bacteria 3049
128 Ga0207680_10031905 3300025903 Bacteria 2988
129 Ga0207699_10011622 3300025906 Bacteria 4453
130 Ga0207699_10047013 3300025906 Bacteria 2528
131 Ga0207684_10407855 3300025910 Bacteria 1168
132 Ga0207693_10077945 3300025915 Bacteria 2594
133 Ga0207693_10129374 3300025915 Bacteria 1984
134 Ga0207693_10631549 3300025915 Bacteria 833
135 Ga0207663_10051756 3300025916 Bacteria 2559
136 Ga0207652_10069372 3300025921 Bacteria 3061
137 Ga0207694_10254647 3300025924 Bacteria 1437
138 Ga0207650_10062528 3300025925 Bacteria 2782
139 Ga0207687_10022569 3300025927 Bacteria 4190
140 Ga0207700_10417673 3300025928 Bacteria 1178
141 Ga0207700_10570869 3300025928 Bacteria 1005
142 Ga0207700_10571487 3300025928 Bacteria 1005
143 Ga0207664_10088797 3300025929 Bacteria 2530
144 Ga0207644_10017593 3300025931 Bacteria 4832
145 Ga0207644_10127863 3300025931 Bacteria 1941
146 Ga0207706_10136066 3300025933 Bacteria 2162
147 Ga0207686_10722789 3300025934 Bacteria 793
148 Ga0207670_10022622 3300025936 Bacteria 3899
149 Ga0207665_11079887 3300025939 Bacteria 639
150 Ga0207711_10008823 3300025941 Bacteria 8430
151 Ga0207661_10114180 3300025944 Bacteria 2290
152 Ga0207679_10524853 3300025945 Unclassified 1059
153 Ga0207651_10003524 3300025960 Bacteria 7694
154 Ga0207712_11088262 3300025961 Bacteria 711
155 Ga0207668_10423596 3300025972 Bacteria 1130
156 Ga0207640_10580124 3300025981 Bacteria 946
157 Ga0207658_10426506 3300025986 Bacteria 1170
158 Ga0207703_10007027 3300026035 Bacteria 8957
159 Ga0207703_10712558 3300026035 Unclassified 955
160 Ga0207641_10020352 3300026088 Bacteria 5449
161 Ga0207641_10942322 3300026088 Unclassified 858
162 Ga0207676_10010596 3300026095 Bacteria 6570
163 Ga0207676_11301843 3300026095 Bacteria 721
164 Ga0207675_100386471 3300026118 Bacteria 1377
165 Ga0207698_10185678 3300026142 Bacteria 1847
166 Ga0207428_10042829 3300027907 Bacteria 3660
167 Ga0268266_10034514 3300028379 Bacteria 4303
168 Ga0268265_10097775 3300028380 Bacteria 2362
169 Ga0268265_10106476 3300028380 Bacteria 2278
170 Ga0268265_10562463 3300028380 Bacteria 1084
171 Ga0268264_10075615 3300028381 Bacteria 2864
172 Ga0265334_10156503 3300028573 Bacteria 802
173 Ga0265331_10006866 3300031250 Bacteria 6652
174 Ga0307516_10000056 3300031730 Bacteria 122840
175 Ga0373944_0041098 3300035089 Bacteria 1430
176 Ga0373962_0093824 3300035242 Bacteria 928
177 Ga0395899_0013533 3300037312 Bacteria 6238
178 Ga0395900_0028386 3300037418 Bacteria 5730
179 Ga0395901_0025428 3300038443 Bacteria 6077
180 Ga0436360_0422886 3300039438 Bacteria 2996
181 Ga0436360_0749080 3300039438 Bacteria 1497
182 Ga0436361_0291247 3300039447 Bacteria 2335
183 Ga0436361_1090522 3300039447 Bacteria 2014
184 Ga0436363_1582483 3300039450 Bacteria 2168
185 Ga0436362_0679557 3300039453 Bacteria 1614
186 Ga0436362_1066109 3300039453 Bacteria 1526
187 Ga0436362_1278536 3300039453 Bacteria 654
188 Ga0451791_0392265 3300041451 Bacteria 11644
189 Ga0451804_0553219 3300041463 Bacteria 716
190 Ga0451807_0390516 3300041486 Bacteria 6235
191 Ga0451837_1003930 3300041494 Bacteria 8924
192 Ga0451843_0995424 3300041509 Bacteria 5006
193 Ga0466957_0050536 3300044842 Bacteria 2530
194 Ga0451576_0064566 3300045051 Bacteria 3813
195 Ga0466967_0137701 3300045976 Bacteria 2271
196 Ga0495650_0014913 3300046471 Bacteria 4011
197 Ga0495618_0378253 3300046514 Bacteria 869
198 Ga0495647_0133917 3300046681 Bacteria 1052
199 Ga0495658_0088894 3300046683 Bacteria 1826
200 Ga0495671_0013956 3300046692 Bacteria 4332
201 Ga0495674_0724812 3300047319 Bacteria 779
202 Ga0496100_0159520 3300048903 Bacteria 1616
203 Ga0496101_0106780 3300048904 Bacteria 2103
204 Ga0496102_0008039 3300048905 Bacteria 9020
205 Ga0496102_0975951 3300048905 Bacteria 768
206 Ga0496102_1153232 3300048905 Bacteria 694
207 Ga0496103_0059296 3300048906 Bacteria 2378
208 Ga0496107_0391104 3300048910 Bacteria 1034
209 Ga0496109_0162260 3300048912 Bacteria 2094
210 Ga0496109_0178177 3300048912 Bacteria 1996
211 Ga0496109_0332018 3300048912 Bacteria 1436
212 Ga0496110_0111246 3300048913 Bacteria 2462
213 Ga0496110_0448054 3300048913 Bacteria 1176
214 Ga0496110_0592446 3300048913 Bacteria 1006
215 Ga0496111_0134084 3300048914 Bacteria 1834
216 Ga0496112_0007465 3300048915 Bacteria 9707
217 Ga0496112_0018666 3300048915 Bacteria 6536
218 Ga0496112_0045711 3300048915 Bacteria 4292
219 Ga0496112_0172081 3300048915 Bacteria 2131
220 Ga0496112_0662183 3300048915 Unclassified 973
221 Ga0496113_0049878 3300048916 Bacteria 3118
222 Ga0496113_1125235 3300048916 Unclassified 615
223 Ga0496115_0031180 3300048918 Bacteria 4198
224 Ga0496115_0047399 3300048918 Bacteria 3437
225 Ga0496118_0007097 3300048921 Bacteria 12026
226 Ga0496119_0089632 3300048922 Bacteria 1751
227 Ga0496121_0100555 3300048924 Bacteria 2232
228 Ga0496125_0123677 3300048928 Bacteria 1839
229 Ga0496126_0403012 3300048929 Bacteria 1109
230 Ga0501068_0016942 3300049584 Bacteria 4209
231 Ga0501070_0334630 3300049586 Bacteria 1230
232 Ga0501070_0771899 3300049586 Bacteria 756
233 Ga0501073_0611801 3300049589 Bacteria 752
234 Ga0501044_0023715 3300049823 Bacteria 6525
235 nmdc:mga05p37_181162_c1 3300050507 Bacteria 2563
236 nmdc:mga09592_400324_c1 3300050508 Bacteria 1187
237 nmdc:mga0qj67_76565_c1 3300050509 Bacteria 2676
238 nmdc:mga06r32_752452_c1 3300050510 Bacteria 938
239 nmdc:mga08y16_69415_c1 3300050511 Bacteria 3674
240 nmdc:mga0rr50_69719_c1 3300050513 Unclassified 2677
241 nmdc:mga08x19_103496_c1 3300050514 Bacteria 1891
242 nmdc:mga08x19_104752_c1 3300050514 Bacteria 1880
243 nmdc:mga0a205_402687_c1 3300050515 Bacteria 1232
244 Ga0495612_0325328 3300053078 Bacteria 692
245 Ga0500556_0000477 3300053104 Bacteria 27974
246 Ga0500595_005655 3300053119 Bacteria 5429
247 Ga0500616_0007340 3300053153 Bacteria 7027
248 Ga0587070_073028 3300059491 Bacteria 736
249 2903756371 2903748898 Bacteria 9972761
250 nmdc:mga0n895_72444_c1
251 Ga0070683_100027134
252 Ga0070670_100028917
253 Ga0070666_10004400
254 Ga0070666_10787765
255 Ga0070689_100156184
256 Ga0070661_100684347
257 Ga0070675_100034364
258 Ga0070671_100048345
259 Ga0070671_100698968
260 Ga0070673_100003804
261 Ga0070688_100106293
262 Ga0070667_100004584
263 Ga0070667_100131937
264 Ga0070709_10015084
265 Ga0070714_100418773
266 Ga0070713_100106180
267 Ga0070713_100233206
268 Ga0070713_100482696
269 Ga0070713_100719915
270 Ga0070711_100035637
271 Ga0070711_100050771
272 Ga0070705_100200481
273 Ga0070708_100377067
274 Ga0070681_10125562
275 Ga0070706_100449183
276 Ga0070707_100206276
277 Ga0070679_100029926
278 Ga0070697_100017713
279 Ga0070697_100232543
280 Ga0070697_100651324
281 Ga0068853_100734839
282 Ga0070672_100079769
283 Ga0070695_100258308
284 Ga0070696_100738375
285 Ga0070693_100965055
286 Ga0070665_100108301
287 Ga0070665_100775344
288 Ga0070665_100942292
289 Ga0070704_100158508
290 Ga0070664_100000439
291 Ga0070664_100770608
292 Ga0070664_101372466
293 Ga0068856_100130785
294 Ga0068856_101121273
295 Ga0068856_101227508
296 Ga0070702_100017407
297 Ga0070702_100896359
298 Ga0068852_100291662
299 Ga0068859_100008953
300 Ga0068859_101212214
301 Ga0068859_101215619
302 Ga0068864_100012720
303 Ga0068864_101132578
304 Ga0068851_10522578
305 Ga0068863_100422859
306 Ga0068863_100788277
307 Ga0068858_100004840
308 Ga0068858_100743424
309 Ga0068858_101148627
310 Ga0068860_100053760
311 Ga0068862_100049529
312 Ga0068862_100220026
313 Ga0068862_100330799
314 Ga0068862_100618302
315 Ga0081455_10016579
316 Ga0070717_10281321
317 Ga0070717_10297434
318 Ga0070717_10432298
319 Ga0070717_11064244
320 Ga0070712_100084438
321 Ga0070712_100159629
322 Ga0097621_100080579
323 Ga0097621_100261721
324 Ga0068871_101066665
325 Ga0075428_100356163
326 Ga0075430_100260423
327 Ga0075433_10513637
328 Ga0075434_100018157
329 Ga0075436_100013230
330 Ga0075436_100117983
331 Ga0075436_100121313
332 Ga0097620_100008953
333 Ga0097620_100367421
334 Ga0097620_101215709
335 Ga0075435_100055819
336 Ga0075435_100265185
337 Ga0111539_10034417
338 Ga0111539_10463567
339 Ga0105245_10004351
340 Ga0105245_11601630
341 Ga0105247_10005778
342 Ga0114129_10328516
343 Ga0105243_11038523
344 Ga0105242_10055388
345 Ga0105248_10078505
346 Ga0105248_10896425
347 Ga0105248_11196876
348 Ga0105238_10645351
349 Ga0105239_10154910
350 Ga0105239_11023755
351 Ga0105246_10566183
352 Ga0105246_10605364
353 Ga0157370_10100280
354 Ga0157370_11423226
355 Ga0157369_10078202
356 Ga0157374_10541266
357 Ga0157374_10834312
358 Ga0157374_10842058
359 Ga0163162_10436366
360 Ga0163162_11283918
361 Ga0157375_10055767
362 Ga0157375_11380248
363 Ga0163163_10018925
364 Ga0157379_10079340
365 Ga0157379_10593091
366 Ga0157376_10077790
367 Ga0157376_10160285
368 Ga0157376_10745218
369 Ga0163161_10600249
370 Ga0213873_10028653
371 Ga0213873_10040199
372 Ga0213872_10038423
373 Ga0213872_10196614
374 Ga0213871_10013917
375 Ga0213871_10018506
376 Ga0207710_10017395
377 Ga0207680_10031905
378 Ga0207699_10011622
379 Ga0207699_10047013
380 Ga0207684_10407855
381 Ga0207693_10077945
382 Ga0207693_10129374
383 Ga0207693_10631549
384 Ga0207663_10051756
385 Ga0207652_10069372
386 Ga0207694_10254647
387 Ga0207650_10062528
388 Ga0207687_10022569
389 Ga0207700_10417673
390 Ga0207700_10570869
391 Ga0207700_10571487
392 Ga0207664_10088797
393 Ga0207644_10017593
394 Ga0207644_10127863
395 Ga0207706_10136066
396 Ga0207686_10722789
397 Ga0207670_10022622
398 Ga0207665_11079887
399 Ga0207711_10008823
400 Ga0207661_10114180
401 Ga0207679_10524853
402 Ga0207651_10003524
403 Ga0207712_11088262
404 Ga0207668_10423596
405 Ga0207640_10580124
406 Ga0207658_10426506
407 Ga0207703_10007027
408 Ga0207703_10712558
409 Ga0207641_10020352
410 Ga0207641_10942322
411 Ga0207676_10010596
412 Ga0207676_11301843
413 Ga0207675_100386471
414 Ga0207698_10185678
415 Ga0207428_10042829
416 Ga0268266_10034514
417 Ga0268265_10097775
418 Ga0268265_10106476
419 Ga0268265_10562463
420 Ga0268264_10075615
421 Ga0265334_10156503
422 Ga0265331_10006866
423 Ga0307516_10000056
424 Ga0373944_0041098
425 Ga0373962_0093824
426 Ga0395899_0013533
427 Ga0395900_0028386
428 Ga0395901_0025428
429 Ga0436360_0422886
430 Ga0436360_0749080
431 Ga0436361_0291247
432 Ga0436361_1090522
433 Ga0436363_1582483
434 Ga0436362_0679557
435 Ga0436362_1066109
436 Ga0436362_1278536
437 Ga0451791_0392265
438 Ga0451804_0553219
439 Ga0451807_0390516
440 Ga0451837_1003930
441 Ga0451843_0995424
442 Ga0466957_0050536
443 Ga0451576_0064566
444 Ga0466967_0137701
445 Ga0495650_0014913
446 Ga0495618_0378253
447 Ga0495647_0133917
448 Ga0495658_0088894
449 Ga0495671_0013956
450 Ga0495674_0724812
451 Ga0496100_0159520
452 Ga0496101_0106780
453 Ga0496102_0008039
454 Ga0496102_0975951
455 Ga0496102_1153232
456 Ga0496103_0059296
457 Ga0496107_0391104
458 Ga0496109_0162260
459 Ga0496109_0178177
460 Ga0496109_0332018
461 Ga0496110_0111246
462 Ga0496110_0448054
463 Ga0496110_0592446
464 Ga0496111_0134084
465 Ga0496112_0007465
466 Ga0496112_0018666
467 Ga0496112_0045711
468 Ga0496112_0172081
469 Ga0496112_0662183
470 Ga0496113_0049878
471 Ga0496113_1125235
472 Ga0496115_0031180
473 Ga0496115_0047399
474 Ga0496118_0007097
475 Ga0496119_0089632
476 Ga0496121_0100555
477 Ga0496125_0123677
478 Ga0496126_0403012
479 Ga0501068_0016942
480 Ga0501070_0334630
481 Ga0501070_0771899
482 Ga0501073_0611801
483 Ga0501044_0023715
484 nmdc:mga05p37_181162_c1
485 nmdc:mga09592_400324_c1
486 nmdc:mga0qj67_76565_c1
487 nmdc:mga06r32_752452_c1
488 nmdc:mga08y16_69415_c1
489 nmdc:mga0rr50_69719_c1
490 nmdc:mga08x19_103496_c1
491 nmdc:mga08x19_104752_c1
492 nmdc:mga0a205_402687_c1
493 Ga0495612_0325328
494 Ga0500556_0000477
495 Ga0500595_005655
496 Ga0500616_0007340
497 Ga0587070_073028
498 2903756371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

83

220

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7596 46 181
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7396 44 181
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.729 28 181
7zps-assembly1.cif.gz_B cytochrome c prime beta from methylococcus capsulatus (bath): no complex 0.7168 46 181
7zrw-assembly1.cif.gz_B f61v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7166 46 181
ID Description Score Start End Superfamily
3vhxH00 Mainly Beta;Sandwich;Immunoglobulin-like;Kinesin-like protein Kif23, Arf6-interacting domain 0.7371 91 124 2.60.40.4330
af_Q5SPH3_283_512_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6464 51 70 3.50.50.60
af_Q19910_105_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6405 51 70 3.50.50.60
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.6244 46 177 3.50.70.20
af_Q94K34_313_390_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.6192 52 120 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A2V7CPU1-F1-model_v4 Cytochrome P460 0.9397 31 104
AF-A0A366LCX5-F1-model_v4 Cytochrome P460 domain-containing protein 0.9019 35 140
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.9012 30 186
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.8958 30 186
AF-A0A2V2R107-F1-model_v4 deleted 0.8951 30 186

Map