F361124

General Info

Members Datasets Scaffolds Average Seq Length
249 158 249 197

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_98714_c1|nmdc:mga06z11_98714_c1_294_953
Length 219
Sequence MAAFRNPASRRSRDEPRRGTPADLLVVGLGNPGTEYDGTRHNVGFEVIDLLASRHGGSLRKGKEKALVDEVRIGGSRVALAKPQTFMNLSGESVAPLVRRFGIEELDRLVIVHDELDLPLGRMKVKHGGGLAGHNGLRSIKAHLHTDGFARIRLGVGKPPSKEHGVDHVLKKVGKAERKVLAEIVVLAADAVELILSDGVDAAMMRYNGTDLLADAGDR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 3.61
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10107182 3300005293 Bacteria 2785
2 Ga0065707_10139993 3300005295 Bacteria 1786
3 Ga0070670_100747631 3300005331 Bacteria 881
4 Ga0070680_100023830 3300005336 Bacteria 4885
5 Ga0068868_100138281 3300005338 Bacteria 1998
6 Ga0070669_100001822 3300005353 Bacteria 15344
7 Ga0070671_100736699 3300005355 Bacteria 856
8 Ga0070674_100723084 3300005356 Unclassified 853
9 Ga0070688_100258256 3300005365 Bacteria 1243
10 Ga0070709_10151747 3300005434 Bacteria 1602
11 Ga0070708_100010253 3300005445 Bacteria 7586
12 Ga0070708_100573195 3300005445 Bacteria 1064
13 Ga0070663_100926325 3300005455 Bacteria 754
14 Ga0070681_10022881 3300005458 Bacteria 6281
15 Ga0070679_100444590 3300005530 Bacteria 1241
16 Ga0070672_100105139 3300005543 Bacteria 2295
17 Ga0068855_101640166 3300005563 Bacteria 657
18 Ga0070664_101142595 3300005564 Bacteria 734
19 Ga0070702_100543613 3300005615 Bacteria 861
20 Ga0068864_101313073 3300005618 Bacteria 724
21 Ga0068870_10107805 3300005840 Bacteria 1585
22 Ga0068863_100254796 3300005841 Bacteria 1696
23 Ga0068860_100416985 3300005843 Bacteria 1330
24 Ga0068860_101129534 3300005843 Bacteria 803
25 Ga0068862_100003872 3300005844 Bacteria 12736
26 Ga0081455_10094259 3300005937 Bacteria 2419
27 Ga0081455_10210777 3300005937 Bacteria 1448
28 Ga0081538_10000321 3300005981 Bacteria 54890
29 Ga0081538_10028577 3300005981 Bacteria 3831
30 Ga0081538_10084214 3300005981 Bacteria 1676
31 Ga0075365_10027164 3300006038 Bacteria 3639
32 Ga0075365_10225532 3300006038 Bacteria 1315
33 Ga0075367_10096851 3300006178 Bacteria 1799
34 Ga0075367_10100821 3300006178 Bacteria 1765
35 Ga0075428_100002582 3300006844 Bacteria 19672
36 Ga0075428_100031710 3300006844 Bacteria 5838
37 Ga0075428_100217077 3300006844 Bacteria 2066
38 Ga0075428_100291532 3300006844 Bacteria 1755
39 Ga0075428_101013158 3300006844 Bacteria 879
40 Ga0075430_100004221 3300006846 Bacteria 12126
41 Ga0075430_100005168 3300006846 Bacteria 10991
42 Ga0075430_100005423 3300006846 Bacteria 10774
43 Ga0075430_100202209 3300006846 Bacteria 1649
44 Ga0075430_100375381 3300006846 Bacteria 1174
45 Ga0075431_100009372 3300006847 Bacteria 9828
46 Ga0075431_100045025 3300006847 Bacteria 4549
47 Ga0075431_100161117 3300006847 Bacteria 2307
48 Ga0075431_100416836 3300006847 Bacteria 1342
49 Ga0075433_10291891 3300006852 Bacteria 1444
50 Ga0075429_100000675 3300006880 Bacteria 26483
51 Ga0075429_100009715 3300006880 Bacteria 8339
52 Ga0075429_100067649 3300006880 Bacteria 3108
53 Ga0075429_100085045 3300006880 Bacteria 2757
54 Ga0075429_100181479 3300006880 Bacteria 1844
55 Ga0075429_100720282 3300006880 Bacteria 874
56 Ga0105240_11395762 3300009093 Unclassified 736
57 Ga0111539_10005147 3300009094 Bacteria 16952
58 Ga0111539_10007496 3300009094 Bacteria 13967
59 Ga0111539_10154872 3300009094 Bacteria 2682
60 Ga0111539_10210936 3300009094 Bacteria 2263
61 Ga0111539_10296336 3300009094 Bacteria 1882
62 Ga0105245_10477643 3300009098 Unclassified 1259
63 Ga0114129_10001953 3300009147 Bacteria 28198
64 Ga0114129_10057436 3300009147 Bacteria 5446
65 Ga0114129_10092007 3300009147 Bacteria 4202
66 Ga0105248_11193794 3300009177 Bacteria 860
67 Ga0105249_10005969 3300009553 Bacteria 10554
68 Ga0105249_10383513 3300009553 Bacteria 1432
69 Ga0105246_10076735 3300011119 Bacteria 2368
70 Ga0163162_10887936 3300013306 Bacteria 1005
71 Ga0157380_10367929 3300014326 Unclassified 1352
72 Ga0182008_10306501 3300014497 Bacteria 832
73 Ga0157377_10114352 3300014745 Bacteria 1627
74 Ga0157377_10137881 3300014745 Bacteria 1496
75 Ga0163161_10575257 3300017792 Unclassified 926
76 Ga0213876_10068172 3300021384 Bacteria 1879
77 Ga0213875_10202184 3300021388 Bacteria 934
78 Ga0207643_10122984 3300025908 Bacteria 1539
79 Ga0207646_10066042 3300025922 Bacteria 3230
80 Ga0207646_10367869 3300025922 Bacteria 1299
81 Ga0207681_10004627 3300025923 Bacteria 8460
82 Ga0207650_10551864 3300025925 Bacteria 966
83 Ga0207664_10333844 3300025929 Bacteria 1339
84 Ga0207669_11013120 3300025937 Bacteria 698
85 Ga0207691_10286883 3300025940 Bacteria 1416
86 Ga0207667_11204758 3300025949 Unclassified 737
87 Ga0207651_10498014 3300025960 Bacteria 1053
88 Ga0207712_10038469 3300025961 Bacteria 3272
89 Ga0207658_10598252 3300025986 Bacteria 991
90 Ga0207677_10209635 3300026023 Bacteria 1555
91 Ga0207678_10778688 3300026067 Bacteria 844
92 Ga0207708_10462365 3300026075 Bacteria 1058
93 Ga0207676_11067283 3300026095 Bacteria 798
94 Ga0207674_10906756 3300026116 Bacteria 849
95 Ga0207675_100668662 3300026118 Bacteria 1046
96 Ga0207683_10748640 3300026121 Bacteria 907
97 Ga0207428_10004630 3300027907 Bacteria 13038
98 Ga0207428_10013792 3300027907 Bacteria 7043
99 Ga0207428_10171243 3300027907 Bacteria 1644
100 Ga0268265_10112537 3300028380 Bacteria 2225
101 Ga0268264_10802978 3300028381 Bacteria 940
102 Ga0265327_10017215 3300031251 Bacteria 4545
103 Ga0265327_10033617 3300031251 Bacteria 2855
104 Ga0265327_10090010 3300031251 Bacteria 1498
105 Ga0316575_10191972 3300031665 Bacteria 849
106 Ga0316576_10069749 3300031727 Bacteria 2592
107 Ga0316576_10089931 3300031727 Bacteria 2286
108 Ga0316578_10052282 3300031728 Bacteria 2393
109 Ga0316577_10033976 3300031733 Bacteria 2850
110 Ga0307410_10102216 3300031852 Bacteria 2056
111 Ga0307407_10031385 3300031903 Bacteria 2877
112 Ga0307412_10409130 3300031911 Bacteria 1107
113 Ga0307409_100019356 3300031995 Bacteria 4606
114 Ga0307416_100155276 3300032002 Bacteria 2106
115 Ga0307416_100203784 3300032002 Bacteria 1880
116 Ga0307416_100397328 3300032002 Bacteria 1415
117 Ga0307414_10121749 3300032004 Bacteria 2007
118 Ga0307415_100143888 3300032126 Bacteria 1825
119 Ga0307415_100180663 3300032126 Bacteria 1655
120 Ga0316592_1014440 3300033524 Bacteria 1639
121 Ga0373955_0061377 3300035172 Bacteria 2076
122 Ga0316574_0011255 3300035398 Bacteria 5080
123 Ga0373935_0691048 3300035692 Bacteria 750
124 Ga0316582_0218300 3300036647 Unclassified 1303
125 Ga0316584_0017171 3300036712 Bacteria 5198
126 Ga0436364_0331210 3300037853 Bacteria 2777
127 Ga0395901_0991363 3300038443 Bacteria 817
128 Ga0400489_87074 3300039093 Bacteria 4718
129 Ga0436365_0792833 3300039437 Bacteria 4471
130 Ga0451837_1014076 3300041494 Bacteria 2069
131 Ga0451853_1747576 3300041512 Bacteria 676
132 Ga0439434_0010593 3300042435 Bacteria 2719
133 Ga0439435_0026107 3300042436 Bacteria 1553
134 Ga0439440_0123646 3300042993 Unclassified 722
135 Ga0466961_0194255 3300044693 Bacteria 1257
136 Ga0495580_0027242 3300046472 Bacteria 4159
137 Ga0495630_0309386 3300046517 Bacteria 1208
138 Ga0495587_0079427 3300046536 Bacteria 1902
139 Ga0495667_0086838 3300046559 Bacteria 2028
140 Ga0495634_0469464 3300046642 Bacteria 740
141 Ga0495623_0312292 3300046679 Bacteria 865
142 Ga0495604_0075475 3300047317 Bacteria 2538
143 Ga0495674_0293869 3300047319 Bacteria 1328
144 Ga0495680_0266652 3300047322 Bacteria 1210
145 Ga0496102_0470418 3300048905 Bacteria 1178
146 Ga0496105_0892199 3300048908 Bacteria 671
147 Ga0496106_0229482 3300048909 Bacteria 1482
148 Ga0496108_0206104 3300048911 Unclassified 1706
149 Ga0496110_0305122 3300048913 Bacteria 1450
150 Ga0496111_0555429 3300048914 Bacteria 843
151 Ga0496112_0642457 3300048915 Bacteria 991
152 Ga0496113_0315937 3300048916 Bacteria 1252
153 Ga0496114_0350025 3300048917 Bacteria 1307
154 Ga0501031_0128543 3300049568 Bacteria 1655
155 Ga0501031_0605080 3300049568 Bacteria 705
156 Ga0501032_0025265 3300049569 Bacteria 4096
157 Ga0501032_0170420 3300049569 Bacteria 1428
158 Ga0501033_0001410 3300049570 Bacteria 21350
159 Ga0501033_0037253 3300049570 Bacteria 3641
160 Ga0501034_0745890 3300049571 Bacteria 875
161 Ga0501036_0006983 3300049572 Bacteria 9189
162 Ga0501036_0162582 3300049572 Bacteria 1882
163 Ga0501038_0586015 3300049574 Bacteria 845
164 Ga0501039_0121333 3300049575 Bacteria 2048
165 Ga0501040_0043568 3300049576 Bacteria 3059
166 Ga0501040_0370660 3300049576 Bacteria 1027
167 Ga0501041_0003785 3300049577 Bacteria 8708
168 Ga0501041_0038335 3300049577 Bacteria 2906
169 Ga0501042_0001008 3300049578 Bacteria 16000
170 Ga0501043_0114761 3300049579 Bacteria 2114
171 Ga0501043_0846724 3300049579 Bacteria 659
172 Ga0501046_0011227 3300049580 Bacteria 7671
173 Ga0501046_0023077 3300049580 Bacteria 5123
174 Ga0501047_0230059 3300049581 Bacteria 1708
175 Ga0501048_0013553 3300049582 Bacteria 6048
176 Ga0501048_0118317 3300049582 Bacteria 1872
177 Ga0501048_0185528 3300049582 Bacteria 1474
178 Ga0501068_0000627 3300049584 Bacteria 18034
179 Ga0501068_0227925 3300049584 Bacteria 1185
180 Ga0501069_0146489 3300049585 Bacteria 1356
181 Ga0501069_0248305 3300049585 Bacteria 1038
182 Ga0501070_0000085 3300049586 Bacteria 79090
183 Ga0501070_0005532 3300049586 Bacteria 10771
184 Ga0501070_0045528 3300049586 Bacteria 3649
185 Ga0501071_0004554 3300049587 Bacteria 8798
186 Ga0501071_0012103 3300049587 Bacteria 5835
187 Ga0501071_0188047 3300049587 Bacteria 1548
188 Ga0501072_0012889 3300049588 Bacteria 6394
189 Ga0501072_0017091 3300049588 Bacteria 5573
190 Ga0501073_0002571 3300049589 Bacteria 13568
191 Ga0501073_0250350 3300049589 Bacteria 1223
192 Ga0501074_0000098 3300049590 Bacteria 42189
193 Ga0501074_0134609 3300049590 Bacteria 1768
194 Ga0501074_0340094 3300049590 Bacteria 1065
195 Ga0501075_0003990 3300049591 Bacteria 9959
196 Ga0501075_0024829 3300049591 Bacteria 4399
197 Ga0501076_0002223 3300049592 Bacteria 13300
198 Ga0501076_0019504 3300049592 Bacteria 5184
199 Ga0501076_0275748 3300049592 Bacteria 1377
200 Ga0501077_0002227 3300049593 Bacteria 11694
201 Ga0501077_0163472 3300049593 Bacteria 1413
202 Ga0501079_0027271 3300049741 Bacteria 4379
203 Ga0501080_0001891 3300049742 Bacteria 18030
204 Ga0501080_0007544 3300049742 Bacteria 9830
205 Ga0501080_0033170 3300049742 Bacteria 4820
206 Ga0501081_0002495 3300049743 Bacteria 11594
207 Ga0501081_0092785 3300049743 Bacteria 2125
208 Ga0501083_0063996 3300049744 Bacteria 2452
209 Ga0501035_0022121 3300049822 Bacteria 5840
210 Ga0501035_0140178 3300049822 Bacteria 2103
211 Ga0501035_0212288 3300049822 Bacteria 1656
212 Ga0501044_0215457 3300049823 Bacteria 1873
213 Ga0501044_0923479 3300049823 Bacteria 747
214 Ga0501045_0002976 3300049824 Bacteria 11588
215 Ga0501045_0022435 3300049824 Bacteria 4520
216 nmdc:mga00v17_7701_c1 3300050491 Bacteria 3379
217 nmdc:mga0yw44_11958_c1 3300050492 Bacteria 4505
218 nmdc:mga0yw44_386453_c1 3300050492 Bacteria 945
219 nmdc:mga06z11_73132_c1 3300050494 Bacteria 1819
220 nmdc:mga06z11_98714_c1 3300050494 Bacteria 1598
221 nmdc:mga04h51_110041_c1 3300050495 Bacteria 1014
222 nmdc:mga05p37_1425_c1 3300050507 Bacteria 27812
223 nmdc:mga05p37_188659_c1 3300050507 Bacteria 2505
224 nmdc:mga05p37_287012_c1 3300050507 Bacteria 1960
225 nmdc:mga05p37_338239_c1 3300050507 Bacteria 1776
226 nmdc:mga09592_1950_c1 3300050508 Bacteria 16610
227 nmdc:mga09592_2629_c1 3300050508 Bacteria 14531
228 nmdc:mga0qj67_1660_c1 3300050509 Bacteria 15684
229 nmdc:mga0qj67_35347_c1 3300050509 Bacteria 3906
230 nmdc:mga0qj67_55147_c1 3300050509 Bacteria 3148
231 nmdc:mga0qj67_60812_c1 3300050509 Bacteria 2998
232 nmdc:mga06r32_291507_c1 3300050510 Bacteria 1619
233 nmdc:mga06r32_3642_c1 3300050510 Bacteria 13764
234 nmdc:mga06r32_4036_c1 3300050510 Bacteria 13163
235 nmdc:mga06r32_442466_c1 3300050510 Bacteria 1280
236 nmdc:mga06r32_48141_c1 3300050510 Bacteria 4075
237 nmdc:mga08y16_263146_c1 3300050511 Bacteria 1781
238 nmdc:mga08y16_5443_c1 3300050511 Bacteria 13311
239 nmdc:mga08y16_7358_c1 3300050511 Bacteria 11548
240 nmdc:mga08y16_85043_c1 3300050511 Bacteria 3296
241 Ga0495619_0091958 3300053085 Bacteria 2054
242 Ga0500604_0015371 3300053151 Bacteria 2096
243 Ga0501084_0006981 3300054114 Bacteria 9306
244 Ga0501084_0050087 3300054114 Bacteria 3496
245 Ga0501084_0569794 3300054114 Bacteria 957
246 Ga0501084_0683035 3300054114 Bacteria 866
247 Ga0501082_0027740 3300060353 Bacteria 4875
248 Ga0530510_0001538 3300061734 Bacteria 15563
249 Ga0530510_0198619 3300061734 Bacteria 1489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100736699 Ga0070671_1007366992 164
2 3300005543 Ga0070672_100105139 Ga0070672_1001051393 164
3 3300005615 Ga0070702_100543613 Ga0070702_1005436132 164
4 3300009094 Ga0111539_10210936 Ga0111539_102109364 164
5 3300025940 Ga0207691_10286883 Ga0207691_102868832 164
6 3300025960 Ga0207651_10498014 Ga0207651_104980141 164
7 3300026067 Ga0207678_10778688 Ga0207678_107786881 164
8 3300048916 Ga0496113_0315937 Ga0496113_0315937_432_1049 164
9 3300050511 nmdc:mga08y16_85043_c1 nmdc:mga08y16_85043_c1_834_1454 164
10 3300006844 Ga0075428_100217077 Ga0075428_1002170773 165
11 3300006846 Ga0075430_100375381 Ga0075430_1003753812 165
12 3300026118 Ga0207675_100668662 Ga0207675_1006686622 165
13 3300049591 Ga0501075_0024829 Ga0501075_0024829_230_745 165
14 3300006846 Ga0075430_100005168 Ga0075430_1000051689 167
15 3300006852 Ga0075433_10291891 Ga0075433_102918911 167
16 3300006880 Ga0075429_100067649 Ga0075429_1000676494 167
17 3300009147 Ga0114129_10057436 Ga0114129_100574362 167
18 3300049568 Ga0501031_0605080 Ga0501031_0605080_41_613 167
19 3300049579 Ga0501043_0846724 Ga0501043_0846724_37_609 167
20 3300050507 nmdc:mga05p37_287012_c1 nmdc:mga05p37_287012_c1_247_867 167
21 3300050510 nmdc:mga06r32_48141_c1 nmdc:mga06r32_48141_c1_2050_2670 167
22 3300005937 Ga0081455_10094259 Ga0081455_100942592 168
23 3300006844 Ga0075428_100031710 Ga0075428_1000317102 168
24 3300006846 Ga0075430_100202209 Ga0075430_1002022092 168
25 3300006847 Ga0075431_100416836 Ga0075431_1004168362 168
26 3300006880 Ga0075429_100085045 Ga0075429_1000850454 168
27 3300006880 Ga0075429_100181479 Ga0075429_1001814792 168
28 3300009094 Ga0111539_10154872 Ga0111539_101548723 168
29 3300009147 Ga0114129_10092007 Ga0114129_100920072 168
30 3300027907 Ga0207428_10171243 Ga0207428_101712432 168
31 3300050507 nmdc:mga05p37_188659_c1 nmdc:mga05p37_188659_c1_359_982 168
32 3300050507 nmdc:mga05p37_338239_c1 nmdc:mga05p37_338239_c1_1134_1757 168
33 3300050510 nmdc:mga06r32_291507_c1 nmdc:mga06r32_291507_c1_25_648 168
34 3300031251 Ga0265327_10090010 Ga0265327_100900102 169
35 3300049572 Ga0501036_0162582 Ga0501036_0162582_158_787 169
36 3300049574 Ga0501038_0586015 Ga0501038_0586015_53_682 169
37 3300049575 Ga0501039_0121333 Ga0501039_0121333_50_679 169
38 3300049577 Ga0501041_0003785 Ga0501041_0003785_8053_8682 169
39 3300049582 Ga0501048_0185528 Ga0501048_0185528_132_761 169
40 3300049584 Ga0501068_0227925 Ga0501068_0227925_539_1168 169
41 3300049587 Ga0501071_0188047 Ga0501071_0188047_160_789 169
42 3300049590 Ga0501074_0134609 Ga0501074_0134609_251_880 169
43 3300049592 Ga0501076_0019504 Ga0501076_0019504_4520_5149 169
44 3300049593 Ga0501077_0163472 Ga0501077_0163472_71_700 169
45 3300049741 Ga0501079_0027271 Ga0501079_0027271_232_861 169
46 3300049743 Ga0501081_0092785 Ga0501081_0092785_243_872 169
47 3300049822 Ga0501035_0140178 Ga0501035_0140178_1378_2007 169
48 3300049823 Ga0501044_0923479 Ga0501044_0923479_44_673 169
49 3300049824 Ga0501045_0002976 Ga0501045_0002976_258_887 169
50 3300054114 Ga0501084_0006981 Ga0501084_0006981_6076_6705 169
51 3300060353 Ga0501082_0027740 Ga0501082_0027740_4147_4776 169
52 3300061734 Ga0530510_0198619 Ga0530510_0198619_748_1377 169
53 3300021384 Ga0213876_10068172 Ga0213876_100681722 171
54 3300039437 Ga0436365_0792833 Ga0436365_0792833_2273_2875 171
55 3300048915 Ga0496112_0642457 Ga0496112_0642457_224_829 171
56 3300049569 Ga0501032_0025265 Ga0501032_0025265_34_663 173
57 3300049568 Ga0501031_0128543 Ga0501031_0128543_48_680 174
58 3300049570 Ga0501033_0037253 Ga0501033_0037253_1937_2569 174
59 3300049572 Ga0501036_0006983 Ga0501036_0006983_6905_7537 174
60 3300049576 Ga0501040_0043568 Ga0501040_0043568_1248_1880 174
61 3300049577 Ga0501041_0038335 Ga0501041_0038335_1183_1815 174
62 3300049578 Ga0501042_0001008 Ga0501042_0001008_3227_3859 174
63 3300049580 Ga0501046_0011227 Ga0501046_0011227_4089_4721 174
64 3300049582 Ga0501048_0013553 Ga0501048_0013553_3909_4541 174
65 3300049585 Ga0501069_0146489 Ga0501069_0146489_472_1104 174
66 3300049587 Ga0501071_0004554 Ga0501071_0004554_8085_8717 174
67 3300049588 Ga0501072_0012889 Ga0501072_0012889_4634_5266 174
68 3300049590 Ga0501074_0340094 Ga0501074_0340094_188_820 174
69 3300049591 Ga0501075_0003990 Ga0501075_0003990_4267_4899 174
70 3300049592 Ga0501076_0002223 Ga0501076_0002223_7980_8612 174
71 3300049593 Ga0501077_0002227 Ga0501077_0002227_1965_2597 174
72 3300049743 Ga0501081_0002495 Ga0501081_0002495_9161_9793 174
73 3300049822 Ga0501035_0022121 Ga0501035_0022121_3825_4457 174
74 3300049824 Ga0501045_0022435 Ga0501045_0022435_848_1480 174
75 3300054114 Ga0501084_0050087 Ga0501084_0050087_2569_3201 174
76 3300061734 Ga0530510_0001538 Ga0530510_0001538_1040_1672 174
77 3300049576 Ga0501040_0370660 Ga0501040_0370660_282_830 176
78 3300035692 Ga0373935_0691048 Ga0373935_0691048_107_661 177
79 3300044693 Ga0466961_0194255 Ga0466961_0194255_555_1109 178
80 3300021388 Ga0213875_10202184 Ga0213875_102021842 179
81 3300026023 Ga0207677_10209635 Ga0207677_102096352 179
82 3300037853 Ga0436364_0331210 Ga0436364_0331210_1080_1640 179
83 3300005434 Ga0070709_10151747 Ga0070709_101517472 180
84 3300005445 Ga0070708_100010253 Ga0070708_1000102537 180
85 3300005455 Ga0070663_100926325 Ga0070663_1009263251 180
86 3300005458 Ga0070681_10022881 Ga0070681_100228812 180
87 3300005530 Ga0070679_100444590 Ga0070679_1004445902 180
88 3300005563 Ga0068855_101640166 Ga0068855_1016401661 180
89 3300009093 Ga0105240_11395762 Ga0105240_113957622 180
90 3300014497 Ga0182008_10306501 Ga0182008_103065011 180
91 3300025929 Ga0207664_10333844 Ga0207664_103338442 180
92 3300025949 Ga0207667_11204758 Ga0207667_112047581 180
93 3300025986 Ga0207658_10598252 Ga0207658_105982522 180
94 3300026121 Ga0207683_10748640 Ga0207683_107486402 180
95 3300031251 Ga0265327_10017215 Ga0265327_100172153 180
96 3300031251 Ga0265327_10033617 Ga0265327_100336171 180
97 3300031852 Ga0307410_10102216 Ga0307410_101022162 180
98 3300031903 Ga0307407_10031385 Ga0307407_100313853 180
99 3300031995 Ga0307409_100019356 Ga0307409_1000193564 180
100 3300032002 Ga0307416_100203784 Ga0307416_1002037842 180
101 3300032004 Ga0307414_10121749 Ga0307414_101217493 180
102 3300032126 Ga0307415_100180663 Ga0307415_1001806632 180
103 3300046642 Ga0495634_0469464 Ga0495634_0469464_30_614 180
104 3300048909 Ga0496106_0229482 Ga0496106_0229482_395_979 180
105 3300049579 Ga0501043_0114761 Ga0501043_0114761_858_1442 180
106 3300049580 Ga0501046_0023077 Ga0501046_0023077_1941_2525 180
107 3300049582 Ga0501048_0118317 Ga0501048_0118317_1030_1614 180
108 3300049586 Ga0501070_0005532 Ga0501070_0005532_10007_10591 180
109 3300049589 Ga0501073_0250350 Ga0501073_0250350_298_882 180
110 3300049742 Ga0501080_0033170 Ga0501080_0033170_2294_2878 180
111 3300049823 Ga0501044_0215457 Ga0501044_0215457_300_884 180
112 3300005356 Ga0070674_100723084 Ga0070674_1007230841 181
113 3300005618 Ga0068864_101313073 Ga0068864_1013130731 181
114 3300005841 Ga0068863_100254796 Ga0068863_1002547963 181
115 3300005843 Ga0068860_100416985 Ga0068860_1004169852 181
116 3300014326 Ga0157380_10367929 Ga0157380_103679292 181
117 3300017792 Ga0163161_10575257 Ga0163161_105752572 181
118 3300026095 Ga0207676_11067283 Ga0207676_110672832 181
119 3300028381 Ga0268264_10802978 Ga0268264_108029782 181
120 3300048911 Ga0496108_0206104 Ga0496108_0206104_941_1519 181
121 3300049570 Ga0501033_0001410 Ga0501033_0001410_4111_4689 181
122 3300049585 Ga0501069_0248305 Ga0501069_0248305_66_644 181
123 3300053151 Ga0500604_0015371 Ga0500604_0015371_389_1021 181
124 3300009098 Ga0105245_10477643 Ga0105245_104776432 182
125 3300009177 Ga0105248_11193794 Ga0105248_111937942 182
126 3300041494 Ga0451837_1014076 Ga0451837_1014076_1401_1985 182
127 3300041512 Ga0451853_1747576 Ga0451853_1747576_72_662 182
128 3300048908 Ga0496105_0892199 Ga0496105_0892199_29_619 182
129 3300049586 Ga0501070_0000085 Ga0501070_0000085_44259_44834 182
130 3300049587 Ga0501071_0012103 Ga0501071_0012103_1049_1624 182
131 3300049742 Ga0501080_0001891 Ga0501080_0001891_13820_14395 182
132 3300005336 Ga0070680_100023830 Ga0070680_1000238306 183
133 3300005445 Ga0070708_100573195 Ga0070708_1005731952 183
134 3300006178 Ga0075367_10096851 Ga0075367_100968512 183
135 3300006844 Ga0075428_100291532 Ga0075428_1002915322 183
136 3300006844 Ga0075428_101013158 Ga0075428_1010131581 183
137 3300006846 Ga0075430_100004221 Ga0075430_1000042217 183
138 3300006847 Ga0075431_100009372 Ga0075431_1000093725 183
139 3300006880 Ga0075429_100009715 Ga0075429_1000097156 183
140 3300009094 Ga0111539_10005147 Ga0111539_100051477 183
141 3300009553 Ga0105249_10383513 Ga0105249_103835131 183
142 3300014745 Ga0157377_10137881 Ga0157377_101378812 183
143 3300025922 Ga0207646_10066042 Ga0207646_100660422 183
144 3300025922 Ga0207646_10367869 Ga0207646_103678692 183
145 3300025937 Ga0207669_11013120 Ga0207669_110131201 183
146 3300027907 Ga0207428_10013792 Ga0207428_100137925 183
147 3300032002 Ga0307416_100155276 Ga0307416_1001552762 183
148 3300033524 Ga0316592_1014440 Ga0316592_10144403 183
149 3300035172 Ga0373955_0061377 Ga0373955_0061377_409_981 183
150 3300036647 Ga0316582_0218300 Ga0316582_0218300_231_791 183
151 3300038443 Ga0395901_0991363 Ga0395901_0991363_122_703 183
152 3300042435 Ga0439434_0010593 Ga0439434_0010593_214_789 183
153 3300046472 Ga0495580_0027242 Ga0495580_0027242_656_1228 183
154 3300046517 Ga0495630_0309386 Ga0495630_0309386_269_841 183
155 3300046536 Ga0495587_0079427 Ga0495587_0079427_502_1134 183
156 3300046559 Ga0495667_0086838 Ga0495667_0086838_688_1320 183
157 3300046679 Ga0495623_0312292 Ga0495623_0312292_215_847 183
158 3300047317 Ga0495604_0075475 Ga0495604_0075475_732_1364 183
159 3300047319 Ga0495674_0293869 Ga0495674_0293869_387_959 183
160 3300050492 nmdc:mga0yw44_386453_c1 nmdc:mga0yw44_386453_c1_27_650 183
161 3300050508 nmdc:mga09592_1950_c1 nmdc:mga09592_1950_c1_5359_5985 183
162 3300050509 nmdc:mga0qj67_35347_c1 nmdc:mga0qj67_35347_c1_1892_2518 183
163 3300050510 nmdc:mga06r32_4036_c1 nmdc:mga06r32_4036_c1_4777_5403 183
164 3300050511 nmdc:mga08y16_5443_c1 nmdc:mga08y16_5443_c1_5852_6475 183
165 3300053085 Ga0495619_0091958 Ga0495619_0091958_827_1459 183
166 3300006038 Ga0075365_10225532 Ga0075365_102255322 184
167 3300031665 Ga0316575_10191972 Ga0316575_101919721 184
168 3300031727 Ga0316576_10069749 Ga0316576_100697493 184
169 3300031727 Ga0316576_10089931 Ga0316576_100899312 184
170 3300031728 Ga0316578_10052282 Ga0316578_100522822 184
171 3300031733 Ga0316577_10033976 Ga0316577_100339762 184
172 3300035398 Ga0316574_0011255 Ga0316574_0011255_1463_2083 184
173 3300036712 Ga0316584_0017171 Ga0316584_0017171_1879_2499 184
174 3300048913 Ga0496110_0305122 Ga0496110_0305122_291_911 184
175 3300048914 Ga0496111_0555429 Ga0496111_0555429_79_699 184
176 3300048917 Ga0496114_0350025 Ga0496114_0350025_489_1109 184
177 3300049581 Ga0501047_0230059 Ga0501047_0230059_651_1271 184
178 3300049744 Ga0501083_0063996 Ga0501083_0063996_806_1426 184
179 3300050492 nmdc:mga0yw44_11958_c1 nmdc:mga0yw44_11958_c1_492_1112 184
180 3300054114 Ga0501084_0569794 Ga0501084_0569794_283_903 184
181 3300005338 Ga0068868_100138281 Ga0068868_1001382813 185
182 3300005843 Ga0068860_101129534 Ga0068860_1011295341 185
183 3300031911 Ga0307412_10409130 Ga0307412_104091301 185
184 3300048905 Ga0496102_0470418 Ga0496102_0470418_180_767 185
185 3300049569 Ga0501032_0170420 Ga0501032_0170420_299_877 185
186 3300049584 Ga0501068_0000627 Ga0501068_0000627_11962_12585 185
187 3300049586 Ga0501070_0045528 Ga0501070_0045528_1063_1686 185
188 3300049588 Ga0501072_0017091 Ga0501072_0017091_2145_2768 185
189 3300049589 Ga0501073_0002571 Ga0501073_0002571_3172_3795 185
190 3300049590 Ga0501074_0000098 Ga0501074_0000098_2335_2958 185
191 3300049592 Ga0501076_0275748 Ga0501076_0275748_270_893 185
192 3300049742 Ga0501080_0007544 Ga0501080_0007544_5953_6576 185
193 3300049822 Ga0501035_0212288 Ga0501035_0212288_278_856 185
194 3300005937 Ga0081455_10210777 Ga0081455_102107772 186
195 3300005981 Ga0081538_10000321 Ga0081538_1000032119 186
196 3300005981 Ga0081538_10028577 Ga0081538_100285775 186
197 3300005981 Ga0081538_10084214 Ga0081538_100842142 186
198 3300006178 Ga0075367_10100821 Ga0075367_101008212 186
199 3300006844 Ga0075428_100002582 Ga0075428_10000258210 186
200 3300006846 Ga0075430_100005423 Ga0075430_1000054239 186
201 3300006847 Ga0075431_100045025 Ga0075431_1000450255 186
202 3300006880 Ga0075429_100000675 Ga0075429_10000067515 186
203 3300009094 Ga0111539_10296336 Ga0111539_102963363 186
204 3300009147 Ga0114129_10001953 Ga0114129_1000195313 186
205 3300049571 Ga0501034_0745890 Ga0501034_0745890_245_838 186
206 3300050491 nmdc:mga00v17_7701_c1 nmdc:mga00v17_7701_c1_1739_2356 186
207 3300050494 nmdc:mga06z11_73132_c1 nmdc:mga06z11_73132_c1_708_1325 186
208 3300050507 nmdc:mga05p37_1425_c1 nmdc:mga05p37_1425_c1_20929_21561 186
209 3300050508 nmdc:mga09592_2629_c1 nmdc:mga09592_2629_c1_7933_8565 186
210 3300050509 nmdc:mga0qj67_1660_c1 nmdc:mga0qj67_1660_c1_9367_9999 186
211 3300050510 nmdc:mga06r32_3642_c1 nmdc:mga06r32_3642_c1_7933_8565 186
212 3300050511 nmdc:mga08y16_263146_c1 nmdc:mga08y16_263146_c1_107_739 186
213 3300054114 Ga0501084_0683035 Ga0501084_0683035_240_803 186
214 3300006847 Ga0075431_100161117 Ga0075431_1001611172 187
215 3300032126 Ga0307415_100143888 Ga0307415_1001438881 187
216 3300047322 Ga0495680_0266652 Ga0495680_0266652_324_926 187
217 3300050509 nmdc:mga0qj67_55147_c1 nmdc:mga0qj67_55147_c1_148_783 187
218 3300050510 nmdc:mga06r32_442466_c1 nmdc:mga06r32_442466_c1_360_995 187
219 3300006038 Ga0075365_10027164 Ga0075365_100271642 188
220 3300039093 Ga0400489_87074 Ga0400489_87074_2160_2732 188
221 3300050509 nmdc:mga0qj67_60812_c1 nmdc:mga0qj67_60812_c1_1202_1840 188
222 3300005295 Ga0065707_10139993 Ga0065707_101399931 189
223 3300005331 Ga0070670_100747631 Ga0070670_1007476311 189
224 3300005353 Ga0070669_100001822 Ga0070669_1000018226 189
225 3300005365 Ga0070688_100258256 Ga0070688_1002582561 189
226 3300005564 Ga0070664_101142595 Ga0070664_1011425951 189
227 3300005840 Ga0068870_10107805 Ga0068870_101078052 189
228 3300005844 Ga0068862_100003872 Ga0068862_10000387212 189
229 3300006880 Ga0075429_100720282 Ga0075429_1007202822 189
230 3300009094 Ga0111539_10007496 Ga0111539_100074963 189
231 3300009553 Ga0105249_10005969 Ga0105249_100059693 189
232 3300011119 Ga0105246_10076735 Ga0105246_100767352 189
233 3300013306 Ga0163162_10887936 Ga0163162_108879362 189
234 3300014745 Ga0157377_10114352 Ga0157377_101143522 189
235 3300025908 Ga0207643_10122984 Ga0207643_101229842 189
236 3300025923 Ga0207681_10004627 Ga0207681_100046275 189
237 3300025925 Ga0207650_10551864 Ga0207650_105518642 189
238 3300025961 Ga0207712_10038469 Ga0207712_100384693 189
239 3300026075 Ga0207708_10462365 Ga0207708_104623652 189
240 3300026116 Ga0207674_10906756 Ga0207674_109067562 189
241 3300027907 Ga0207428_10004630 Ga0207428_1000463012 189
242 3300028380 Ga0268265_10112537 Ga0268265_101125375 189
243 3300032002 Ga0307416_100397328 Ga0307416_1003973282 189
244 3300050494 nmdc:mga06z11_98714_c1 nmdc:mga06z11_98714_c1_294_953 189
245 3300050495 nmdc:mga04h51_110041_c1 nmdc:mga04h51_110041_c1_219_878 189
246 3300050511 nmdc:mga08y16_7358_c1 nmdc:mga08y16_7358_c1_331_900 189
247 3300005293 Ga0065715_10107182 Ga0065715_101071824 192
248 3300042436 Ga0439435_0026107 Ga0439435_0026107_348_935 192
249 3300042993 Ga0439440_0123646 Ga0439440_0123646_106_693 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

25

208

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.967 1 182
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9567 2 172
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9561 2 171
4yly-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9518 1 182
4qt4-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, streptococcus pyogenes at 2.19 angstrom resolution shows the closed structure of the substrate binding cleft 0.9422 2 182
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.967 1 182 3.40.50.1470
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9614 58 183 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.942 2 182 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9412 1 183 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9205 1 182 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A2V8ATG6-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9829 1 183 GO:0004045
GO:0005737
GO:0006412
AF-A0A2D8GAZ6-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9811 1 83 GO:0004045
AF-A0A7C2U2S7-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9769 2 183 GO:0004045
GO:0005737
GO:0006412
AF-A0A2S3QE42-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9763 1 183 GO:0004045
GO:0005737
GO:0006412
AF-A0A223KX47-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9737 1 183 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
93.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map