F361020

General Info

Members Datasets Scaffolds Average Seq Length
249 190 498 152

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0208594|Ga0495668_0208594_328_858
Length 176
Sequence MTGATLLGASSGRALLVRVKMTLDGLNDDFRDIVVLFADRGVEFVIVGAYALAFHGAPRASGDIDLYIRPSSENAERVFEALQSFGAPLASHGVVAADFSRPGTIYQIGLPPRRIDVLTEVSGLGFDEVWASRVAALVDGRTVHIIGRDAFVRNKTAAGRPKDMADVARLAKKTGK

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
131 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
132 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
161 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
170 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
171 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
172 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
173 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
180 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 1.2
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 31.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0208594 3300046616 Unclassified 1070
2 JGI24751J29686_10000240 3300002459 Bacteria 21952
3 rootL2_10219691 3300003322 Bacteria 2006
4 rootL2_10306937 3300003322 Unclassified 1341
5 rootH1_10108461 3300003323 Bacteria 5641
6 Ga0065704_10184844 3300005289 Unclassified 1218
7 Ga0065707_10327061 3300005295 Unclassified 956
8 Ga0065707_10452416 3300005295 Unclassified 799
9 Ga0070658_10037718 3300005327 Bacteria 3896
10 Ga0070676_10770564 3300005328 Unclassified 708
11 Ga0070683_100132818 3300005329 Unclassified 2356
12 Ga0070683_100425876 3300005329 Bacteria 1266
13 Ga0070690_100009134 3300005330 Bacteria 5736
14 Ga0070690_100188530 3300005330 Unclassified 1429
15 Ga0070670_100002174 3300005331 Bacteria 16111
16 Ga0068869_100170672 3300005334 Unclassified 1699
17 Ga0070680_100085596 3300005336 Bacteria 2604
18 Ga0070682_100273114 3300005337 Bacteria 1229
19 Ga0068868_100600056 3300005338 Unclassified 975
20 Ga0070689_100374406 3300005340 Bacteria 1199
21 Ga0070687_100363031 3300005343 Unclassified 938
22 Ga0070661_100490381 3300005344 Bacteria 982
23 Ga0070669_100447104 3300005353 Unclassified 1065
24 Ga0070669_101657464 3300005353 Unclassified 557
25 Ga0070673_100181881 3300005364 Bacteria 1800
26 Ga0070659_100023631 3300005366 Bacteria 4706
27 Ga0070667_100228657 3300005367 Bacteria 1658
28 Ga0070667_101881140 3300005367 Bacteria 563
29 Ga0070714_100239390 3300005435 Bacteria 1675
30 Ga0070701_10064788 3300005438 Unclassified 1938
31 Ga0070701_10126875 3300005438 Bacteria 1445
32 Ga0070705_100123369 3300005440 Unclassified 1676
33 Ga0070700_100040161 3300005441 Bacteria 2863
34 Ga0070681_10148229 3300005458 Bacteria 2274
35 Ga0068867_100346818 3300005459 Bacteria 1238
36 Ga0070685_10721043 3300005466 Unclassified 729
37 Ga0070706_100115137 3300005467 Unclassified 2504
38 Ga0070706_100133176 3300005467 Bacteria 2320
39 Ga0070707_100730542 3300005468 Bacteria 953
40 Ga0070707_101589501 3300005468 Bacteria 621
41 Ga0070699_100040055 3300005518 Bacteria 4058
42 Ga0070679_100170345 3300005530 Bacteria 2150
43 Ga0070684_100810691 3300005535 Bacteria 875
44 Ga0070697_100225700 3300005536 Unclassified 1597
45 Ga0068853_100002959 3300005539 Bacteria 12927
46 Ga0070672_100798976 3300005543 Bacteria 830
47 Ga0070686_100068876 3300005544 Bacteria 2309
48 Ga0070695_100129802 3300005545 Unclassified 1736
49 Ga0070695_100626576 3300005545 Bacteria 847
50 Ga0070693_100512511 3300005547 Bacteria 853
51 Ga0070693_100761740 3300005547 Unclassified 714
52 Ga0070704_100348923 3300005549 Unclassified 1249
53 Ga0070704_100618537 3300005549 Unclassified 953
54 Ga0068855_100139168 3300005563 Bacteria 2768
55 Ga0068857_100337461 3300005577 Bacteria 1394
56 Ga0068857_100368077 3300005577 Unclassified 1333
57 Ga0068854_100507624 3300005578 Unclassified 1016
58 Ga0068856_100578451 3300005614 Unclassified 1144
59 Ga0068856_101691100 3300005614 Bacteria 645
60 Ga0070702_100323150 3300005615 Bacteria 1076
61 Ga0068859_100058636 3300005617 Bacteria 3878
62 Ga0068859_100224067 3300005617 Bacteria 1968
63 Ga0068859_100352143 3300005617 Bacteria 1567
64 Ga0068859_100577857 3300005617 Bacteria 1217
65 Ga0068864_100201420 3300005618 Bacteria 1829
66 Ga0068864_101043928 3300005618 Bacteria 812
67 Ga0068861_100359488 3300005719 Bacteria 1280
68 Ga0068870_10286011 3300005840 Bacteria 1035
69 Ga0068863_100314858 3300005841 Unclassified 1519
70 Ga0068858_100124963 3300005842 Bacteria 2408
71 Ga0068858_100339046 3300005842 Unclassified 1439
72 Ga0068860_100112560 3300005843 Unclassified 2602
73 Ga0068860_100404146 3300005843 Unclassified 1351
74 Ga0068862_100005091 3300005844 Bacteria 11064
75 Ga0068862_100329458 3300005844 Bacteria 1411
76 Ga0075366_10070936 3300006195 Bacteria 2076
77 Ga0075433_10086730 3300006852 Bacteria 2764
78 Ga0075433_10311013 3300006852 Unclassified 1394
79 Ga0075429_100090878 3300006880 Bacteria 2663
80 Ga0097620_100058636 3300006931 Bacteria 3878
81 Ga0097620_100224067 3300006931 Bacteria 1968
82 Ga0097620_100352145 3300006931 Bacteria 1567
83 Ga0097620_100577860 3300006931 Bacteria 1217
84 Ga0105240_10802331 3300009093 Bacteria 1020
85 Ga0105243_10487102 3300009148 Unclassified 1165
86 Ga0105241_11704155 3300009174 Unclassified 612
87 Ga0105242_10265558 3300009176 Bacteria 1552
88 Ga0105248_10327645 3300009177 Unclassified 1725
89 Ga0105248_11044138 3300009177 Bacteria 923
90 Ga0105237_10000114 3300009545 Bacteria 113057
91 Ga0105249_10202900 3300009553 Unclassified 1941
92 Ga0105249_10467738 3300009553 Bacteria 1302
93 Ga0105249_13250874 3300009553 Unclassified 523
94 Ga0105239_10260630 3300010375 Bacteria 1948
95 Ga0157373_10924167 3300013100 Unclassified 648
96 Ga0163162_10015456 3300013306 Bacteria 7458
97 Ga0163162_10597075 3300013306 Unclassified 1230
98 Ga0157375_12221096 3300013308 Unclassified 654
99 Ga0157375_12425047 3300013308 Unclassified 626
100 Ga0163163_10002437 3300014325 Bacteria 15737
101 Ga0163163_10528492 3300014325 Bacteria 1242
102 Ga0157379_10165633 3300014968 Unclassified 1995
103 Ga0163161_10254415 3300017792 Bacteria 1370
104 Ga0207643_10411905 3300025908 Unclassified 856
105 Ga0207643_11065502 3300025908 Unclassified 522
106 Ga0207705_10219027 3300025909 Bacteria 1445
107 Ga0207684_10099144 3300025910 Unclassified 2488
108 Ga0207684_10167176 3300025910 Bacteria 1896
109 Ga0207707_10233688 3300025912 Bacteria 1600
110 Ga0207671_10003506 3300025914 Bacteria 15586
111 Ga0207662_10175945 3300025918 Bacteria 1375
112 Ga0207652_10055726 3300025921 Bacteria 3401
113 Ga0207650_10000927 3300025925 Bacteria 22109
114 Ga0207686_10342764 3300025934 Unclassified 1123
115 Ga0207691_10821209 3300025940 Unclassified 780
116 Ga0207711_10191628 3300025941 Bacteria 1863
117 Ga0207661_10655188 3300025944 Bacteria 965
118 Ga0207667_10685220 3300025949 Bacteria 1028
119 Ga0207651_10084700 3300025960 Bacteria 2297
120 Ga0207712_10401131 3300025961 Unclassified 1153
121 Ga0207712_10444686 3300025961 Bacteria 1098
122 Ga0207658_11230930 3300025986 Unclassified 684
123 Ga0207703_10791169 3300026035 Unclassified 905
124 Ga0207639_10000935 3300026041 Bacteria 19775
125 Ga0207708_10023882 3300026075 Bacteria 4623
126 Ga0207702_10273227 3300026078 Bacteria 1595
127 Ga0207702_11505479 3300026078 Bacteria 666
128 Ga0207641_10649890 3300026088 Unclassified 1036
129 Ga0207641_11489246 3300026088 Bacteria 678
130 Ga0207648_10270855 3300026089 Bacteria 1517
131 Ga0207676_11600555 3300026095 Bacteria 649
132 Ga0207674_10311031 3300026116 Bacteria 1524
133 Ga0207674_10468652 3300026116 Unclassified 1217
134 Ga0207675_100058902 3300026118 Bacteria 3584
135 Ga0207675_100397383 3300026118 Unclassified 1358
136 Ga0268265_10178605 3300028380 Bacteria 1822
137 Ga0268264_10139880 3300028381 Bacteria 2157
138 Ga0265338_10746882 3300028800 Bacteria 673
139 Ga0307408_100067355 3300031548 Bacteria 2633
140 Ga0265313_10014838 3300031595 Bacteria 4579
141 Ga0307508_10141159 3300031616 Bacteria 2013
142 Ga0316579_10204731 3300031691 Bacteria 954
143 Ga0265342_10001339 3300031712 Bacteria 23098
144 Ga0265342_10226620 3300031712 Bacteria 1005
145 Ga0316576_10000821 3300031727 Bacteria 15730
146 Ga0316576_10248787 3300031727 Bacteria 1335
147 Ga0316576_10360449 3300031727 Bacteria 1081
148 Ga0316578_10086034 3300031728 Bacteria 1874
149 Ga0316578_10193225 3300031728 Bacteria 1226
150 Ga0307405_10093408 3300031731 Bacteria 1998
151 Ga0316577_10027416 3300031733 Bacteria 3176
152 Ga0316577_10208062 3300031733 Bacteria 1106
153 Ga0307413_10076998 3300031824 Bacteria 2122
154 Ga0307410_10045809 3300031852 Bacteria 2915
155 Ga0307412_10038364 3300031911 Bacteria 3084
156 Ga0307412_10957804 3300031911 Unclassified 754
157 Ga0307409_100047485 3300031995 Bacteria 3259
158 Ga0307409_100061040 3300031995 Bacteria 2944
159 Ga0307416_100195812 3300032002 Bacteria 1911
160 Ga0307414_10137737 3300032004 Bacteria 1906
161 Ga0307411_10138633 3300032005 Bacteria 1790
162 Ga0316583_10124167 3300032133 Bacteria 900
163 Ga0307510_10050412 3300033180 Bacteria 4416
164 Ga0316588_1062777 3300033528 Bacteria 907
165 Ga0373953_0032962 3300035117 Bacteria 2024
166 Ga0373956_0220986 3300035119 Bacteria 899
167 Ga0373961_0000344 3300035241 Bacteria 20385
168 Ga0316574_0168211 3300035398 Bacteria 1411
169 Ga0373935_0005629 3300035692 Bacteria 7395
170 Ga0373933_0026252 3300035724 Bacteria 3344
171 Ga0373937_0036578 3300036401 Bacteria 4474
172 Ga0316582_0023993 3300036647 Bacteria 3643
173 Ga0316582_0055540 3300036647 Bacteria 2524
174 Ga0316582_0398092 3300036647 Unclassified 949
175 Ga0316584_0051551 3300036712 Bacteria 3077
176 Ga0316584_0190297 3300036712 Bacteria 1517
177 Ga0316584_0378969 3300036712 Bacteria 1011
178 Ga0373925_1606457 3300037068 Unclassified 531
179 Ga0316581_0151532 3300037588 Unclassified 715
180 Ga0400484_35856 3300038725 Bacteria 1063
181 Ga0451787_726008 3300041441 Bacteria 1084
182 Ga0451800_1261272 3300041459 Bacteria 1170
183 Ga0451577_0003468 3300042876 Bacteria 17546
184 Ga0451577_0154759 3300042876 Unclassified 2063
185 Ga0453683_0049027 3300044673 Bacteria 2648
186 Ga0453684_0000141 3300044712 Bacteria 316572
187 Ga0451576_1287977 3300045051 Unclassified 762
188 Ga0495651_0414537 3300046462 Bacteria 877
189 Ga0495582_0018678 3300046473 Bacteria 3789
190 Ga0495630_0450686 3300046517 Unclassified 986
191 Ga0495643_0187778 3300046522 Unclassified 1000
192 Ga0495665_0448333 3300046531 Unclassified 652
193 Ga0495658_0345533 3300046683 Bacteria 945
194 Ga0496112_0317746 3300048915 Bacteria 1502
195 Ga0501291_003999 3300049514 Bacteria 1862
196 Ga0501292_016407 3300049515 Unclassified 1164
197 Ga0501298_009673 3300049521 Bacteria 1644
198 Ga0501299_033155 3300049522 Bacteria 1005
199 Ga0501040_0442696 3300049576 Bacteria 935
200 Ga0501043_0493996 3300049579 Bacteria 915
201 Ga0501046_0509604 3300049580 Bacteria 861
202 Ga0501067_0040266 3300049583 Unclassified 2595
203 Ga0501067_0132163 3300049583 Bacteria 1389
204 Ga0501069_0031946 3300049585 Bacteria 2898
205 Ga0501071_0065748 3300049587 Bacteria 2634
206 Ga0501073_0353822 3300049589 Bacteria 1014
207 Ga0501073_0821432 3300049589 Unclassified 640
208 Ga0501075_0000259 3300049591 Bacteria 28820
209 Ga0501075_0243079 3300049591 Bacteria 1372
210 Ga0501076_0198632 3300049592 Bacteria 1637
211 Ga0501077_0013793 3300049593 Bacteria 5068
212 Ga0501202_013652 3300049652 Bacteria 1547
213 Ga0501207_010987 3300049654 Bacteria 1342
214 Ga0501216_014612 3300049660 Bacteria 1314
215 Ga0501217_002803 3300049661 Bacteria 3471
216 Ga0501223_010770 3300049663 Bacteria 1837
217 Ga0501224_010554 3300049664 Bacteria 1355
218 Ga0501227_135097 3300049665 Unclassified 673
219 Ga0501233_028777 3300049668 Bacteria 1242
220 Ga0501235_150341 3300049669 Unclassified 602
221 Ga0501249_171364 3300049679 Unclassified 556
222 Ga0501250_036369 3300049680 Unclassified 705
223 Ga0501251_033123 3300049681 Unclassified 747
224 Ga0501252_023262 3300049682 Unclassified 822
225 Ga0501259_005891 3300049688 Bacteria 1941
226 Ga0501261_009044 3300049690 Unclassified 1295
227 Ga0501225_0013965 3300049705 Bacteria 2245
228 Ga0501234_001891 3300049707 Bacteria 3304
229 Ga0501080_0097318 3300049742 Unclassified 2732
230 Ga0501080_0113014 3300049742 Unclassified 2517
231 Ga0501080_0416926 3300049742 Bacteria 1207
232 Ga0501081_0572652 3300049743 Bacteria 844
233 Ga0501081_0782233 3300049743 Bacteria 718
234 Ga0501083_0069167 3300049744 Unclassified 2349
235 Ga0501083_0394819 3300049744 Bacteria 900
236 Ga0501273_023531 3300049770 Unclassified 846
237 Ga0501274_014072 3300049771 Unclassified 773
238 Ga0501045_0189660 3300049824 Bacteria 1532
239 Ga0501212_002097 3300049851 Bacteria 2365
240 nmdc:mga0k408_98356_c1 3300050493 Bacteria 1724
241 nmdc:mga06z11_630386_c1 3300050494 Bacteria 652
242 nmdc:mga05p37_169832_c1 3300050507 Bacteria 2660
243 nmdc:mga0a205_290205_c1 3300050515 Bacteria 1510
244 nmdc:mga0a205_389010_c1 3300050515 Unclassified 1259
245 Ga0500559_0186424 3300053136 Bacteria 978
246 Ga0500616_0258246 3300053153 Unclassified 741
247 Ga0501082_0000352 3300060353 Bacteria 40671
248 Ga0501082_0179657 3300060353 Unclassified 1840
249 Ga0530510_0263742 3300061734 Bacteria 1285
250 Ga0495668_0208594
251 JGI24751J29686_10000240
252 rootL2_10219691
253 rootL2_10306937
254 rootH1_10108461
255 Ga0065704_10184844
256 Ga0065707_10327061
257 Ga0065707_10452416
258 Ga0070658_10037718
259 Ga0070676_10770564
260 Ga0070683_100132818
261 Ga0070683_100425876
262 Ga0070690_100009134
263 Ga0070690_100188530
264 Ga0070670_100002174
265 Ga0068869_100170672
266 Ga0070680_100085596
267 Ga0070682_100273114
268 Ga0068868_100600056
269 Ga0070689_100374406
270 Ga0070687_100363031
271 Ga0070661_100490381
272 Ga0070669_100447104
273 Ga0070669_101657464
274 Ga0070673_100181881
275 Ga0070659_100023631
276 Ga0070667_100228657
277 Ga0070667_101881140
278 Ga0070714_100239390
279 Ga0070701_10064788
280 Ga0070701_10126875
281 Ga0070705_100123369
282 Ga0070700_100040161
283 Ga0070681_10148229
284 Ga0068867_100346818
285 Ga0070685_10721043
286 Ga0070706_100115137
287 Ga0070706_100133176
288 Ga0070707_100730542
289 Ga0070707_101589501
290 Ga0070699_100040055
291 Ga0070679_100170345
292 Ga0070684_100810691
293 Ga0070697_100225700
294 Ga0068853_100002959
295 Ga0070672_100798976
296 Ga0070686_100068876
297 Ga0070695_100129802
298 Ga0070695_100626576
299 Ga0070693_100512511
300 Ga0070693_100761740
301 Ga0070704_100348923
302 Ga0070704_100618537
303 Ga0068855_100139168
304 Ga0068857_100337461
305 Ga0068857_100368077
306 Ga0068854_100507624
307 Ga0068856_100578451
308 Ga0068856_101691100
309 Ga0070702_100323150
310 Ga0068859_100058636
311 Ga0068859_100224067
312 Ga0068859_100352143
313 Ga0068859_100577857
314 Ga0068864_100201420
315 Ga0068864_101043928
316 Ga0068861_100359488
317 Ga0068870_10286011
318 Ga0068863_100314858
319 Ga0068858_100124963
320 Ga0068858_100339046
321 Ga0068860_100112560
322 Ga0068860_100404146
323 Ga0068862_100005091
324 Ga0068862_100329458
325 Ga0075366_10070936
326 Ga0075433_10086730
327 Ga0075433_10311013
328 Ga0075429_100090878
329 Ga0097620_100058636
330 Ga0097620_100224067
331 Ga0097620_100352145
332 Ga0097620_100577860
333 Ga0105240_10802331
334 Ga0105243_10487102
335 Ga0105241_11704155
336 Ga0105242_10265558
337 Ga0105248_10327645
338 Ga0105248_11044138
339 Ga0105237_10000114
340 Ga0105249_10202900
341 Ga0105249_10467738
342 Ga0105249_13250874
343 Ga0105239_10260630
344 Ga0157373_10924167
345 Ga0163162_10015456
346 Ga0163162_10597075
347 Ga0157375_12221096
348 Ga0157375_12425047
349 Ga0163163_10002437
350 Ga0163163_10528492
351 Ga0157379_10165633
352 Ga0163161_10254415
353 Ga0207643_10411905
354 Ga0207643_11065502
355 Ga0207705_10219027
356 Ga0207684_10099144
357 Ga0207684_10167176
358 Ga0207707_10233688
359 Ga0207671_10003506
360 Ga0207662_10175945
361 Ga0207652_10055726
362 Ga0207650_10000927
363 Ga0207686_10342764
364 Ga0207691_10821209
365 Ga0207711_10191628
366 Ga0207661_10655188
367 Ga0207667_10685220
368 Ga0207651_10084700
369 Ga0207712_10401131
370 Ga0207712_10444686
371 Ga0207658_11230930
372 Ga0207703_10791169
373 Ga0207639_10000935
374 Ga0207708_10023882
375 Ga0207702_10273227
376 Ga0207702_11505479
377 Ga0207641_10649890
378 Ga0207641_11489246
379 Ga0207648_10270855
380 Ga0207676_11600555
381 Ga0207674_10311031
382 Ga0207674_10468652
383 Ga0207675_100058902
384 Ga0207675_100397383
385 Ga0268265_10178605
386 Ga0268264_10139880
387 Ga0265338_10746882
388 Ga0307408_100067355
389 Ga0265313_10014838
390 Ga0307508_10141159
391 Ga0316579_10204731
392 Ga0265342_10001339
393 Ga0265342_10226620
394 Ga0316576_10000821
395 Ga0316576_10248787
396 Ga0316576_10360449
397 Ga0316578_10086034
398 Ga0316578_10193225
399 Ga0307405_10093408
400 Ga0316577_10027416
401 Ga0316577_10208062
402 Ga0307413_10076998
403 Ga0307410_10045809
404 Ga0307412_10038364
405 Ga0307412_10957804
406 Ga0307409_100047485
407 Ga0307409_100061040
408 Ga0307416_100195812
409 Ga0307414_10137737
410 Ga0307411_10138633
411 Ga0316583_10124167
412 Ga0307510_10050412
413 Ga0316588_1062777
414 Ga0373953_0032962
415 Ga0373956_0220986
416 Ga0373961_0000344
417 Ga0316574_0168211
418 Ga0373935_0005629
419 Ga0373933_0026252
420 Ga0373937_0036578
421 Ga0316582_0023993
422 Ga0316582_0055540
423 Ga0316582_0398092
424 Ga0316584_0051551
425 Ga0316584_0190297
426 Ga0316584_0378969
427 Ga0373925_1606457
428 Ga0316581_0151532
429 Ga0400484_35856
430 Ga0451787_726008
431 Ga0451800_1261272
432 Ga0451577_0003468
433 Ga0451577_0154759
434 Ga0453683_0049027
435 Ga0453684_0000141
436 Ga0451576_1287977
437 Ga0495651_0414537
438 Ga0495582_0018678
439 Ga0495630_0450686
440 Ga0495643_0187778
441 Ga0495665_0448333
442 Ga0495658_0345533
443 Ga0496112_0317746
444 Ga0501291_003999
445 Ga0501292_016407
446 Ga0501298_009673
447 Ga0501299_033155
448 Ga0501040_0442696
449 Ga0501043_0493996
450 Ga0501046_0509604
451 Ga0501067_0040266
452 Ga0501067_0132163
453 Ga0501069_0031946
454 Ga0501071_0065748
455 Ga0501073_0353822
456 Ga0501073_0821432
457 Ga0501075_0000259
458 Ga0501075_0243079
459 Ga0501076_0198632
460 Ga0501077_0013793
461 Ga0501202_013652
462 Ga0501207_010987
463 Ga0501216_014612
464 Ga0501217_002803
465 Ga0501223_010770
466 Ga0501224_010554
467 Ga0501227_135097
468 Ga0501233_028777
469 Ga0501235_150341
470 Ga0501249_171364
471 Ga0501250_036369
472 Ga0501251_033123
473 Ga0501252_023262
474 Ga0501259_005891
475 Ga0501261_009044
476 Ga0501225_0013965
477 Ga0501234_001891
478 Ga0501080_0097318
479 Ga0501080_0113014
480 Ga0501080_0416926
481 Ga0501081_0572652
482 Ga0501081_0782233
483 Ga0501083_0069167
484 Ga0501083_0394819
485 Ga0501273_023531
486 Ga0501274_014072
487 Ga0501045_0189660
488 Ga0501212_002097
489 nmdc:mga0k408_98356_c1
490 nmdc:mga06z11_630386_c1
491 nmdc:mga05p37_169832_c1
492 nmdc:mga0a205_290205_c1
493 nmdc:mga0a205_389010_c1
494 Ga0500559_0186424
495 Ga0500616_0258246
496 Ga0501082_0000352
497 Ga0501082_0179657
498 Ga0530510_0263742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09970

DUF2204

Nucleotidyl transferase of unknown function (DUF2204)

27

176

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7401 9 145
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7103 7 145
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.6906 9 145
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.6716 7 145
8an5-assembly1.cif.gz_A menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.6562 9 146
ID Description Score Start End Superfamily
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7397 9 145 3.30.460.40
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6904 9 145 3.30.460.40
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6889 9 146 3.30.460.40
4alzA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6526 7 68 3.30.70.1770
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6473 9 146 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A850BFV4-F1-model_v4 Nucleotidyltransferase 0.986 5 131 GO:0016740
AF-A0A847XXK4-F1-model_v4 DUF6036 domain-containing protein 0.9843 5 146
AF-A0A556MRW4-F1-model_v4 Nucleotidyltransferase family protein 0.9836 5 146
AF-A0A7C8AG44-F1-model_v4 Nucleotidyltransferase family protein 0.9822 3 145
AF-A0A7X2TTH4-F1-model_v4 Nucleotidyltransferase family protein 0.9813 3 146

Map