F360955

General Info

Members Datasets Scaffolds Average Seq Length
249 189 498 104

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0169770|Ga0466965_0169770_754_1119
Length 121
Sequence MVTVIGSLTDPSKVRGVSVVKINAISVPDGAGVELERRFAARAGAVEGAPGFLGFQLLRPTAGESRYFVVTHWESEEAFAAWRDGDARSAHATAPGEEPRRPVSTGADLLEFEVVLDVRPG

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
66 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
67 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
68 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
79 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
80 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
81 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
82 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
94 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
135 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
136 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
137 2643221561 Nocardioides sp. Root151 Isolate Unclassified
138 2643221576 Nocardioides sp. Root614 Isolate Unclassified
139 2643221590 Nocardioides sp. Root682 Isolate Unclassified
140 2643221604 Nocardioides sp. Root190 Isolate Unclassified
141 2643221617 Nocardioides sp. Root79 Isolate Unclassified
142 2643221620 Nocardioides sp. Root240 Isolate Unclassified
143 2643221696 Nocardioides sp. Root140 Isolate Unclassified
144 2738541305 Nocardioides sp. CF167 Isolate Unclassified
145 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
146 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
147 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
148 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
149 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
150 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
151 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
152 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
153 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
154 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
155 2855683550 Micromonospora sp. RP3T Isolate Unclassified
156 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
157 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
158 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
159 2858868258 Micromonospora sp. MH33 Isolate Unclassified
160 2858882152 Micromonospora noduli MED15 Isolate Nodule
161 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
162 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
163 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
164 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
165 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
166 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
167 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
168 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
169 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
170 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
171 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
172 2902582711 Micromonospora sp. AP08 Isolate Unclassified
173 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
174 2922554459 Rhodococcus sp. 66b Isolate Unclassified
175 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
176 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
177 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
178 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
179 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
180 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
181 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
182 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
183 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
184 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
185 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
186 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
187 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
188 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
189 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.31
Metatranscriptomes 1.2
Isolates 22.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 5.62
Nodule 2.41
Rhizoplane 6.43
Rhizosphere 61.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0169770 3300044683 Bacteria 1147
2 Ga0006562J51391_1030556 3300003578 Bacteria 1220
3 Ga0006562J51391_1030557 3300003578 Bacteria 1790
4 Ga0070658_11195919 3300005327 Bacteria 661
5 Ga0070683_100873675 3300005329 Bacteria 862
6 Ga0068868_100592850 3300005338 Bacteria 981
7 Ga0070692_11267800 3300005345 Bacteria 527
8 Ga0070668_100011597 3300005347 Bacteria 6561
9 Ga0070668_100272242 3300005347 Bacteria 1412
10 Ga0070668_100454259 3300005347 Bacteria 1102
11 Ga0070669_100585109 3300005353 Bacteria 934
12 Ga0070671_100008134 3300005355 Bacteria 8396
13 Ga0070674_100133614 3300005356 Bacteria 1853
14 Ga0070674_100267324 3300005356 Bacteria 1350
15 Ga0070673_101576161 3300005364 Bacteria 620
16 Ga0070709_10036437 3300005434 Bacteria 2997
17 Ga0070714_101455508 3300005435 Bacteria 669
18 Ga0070713_100337664 3300005436 Bacteria 1395
19 Ga0070710_10000480 3300005437 Bacteria 18749
20 Ga0070710_10026422 3300005437 Bacteria 3084
21 Ga0070663_100001150 3300005455 Bacteria 14562
22 Ga0070678_100232973 3300005456 Bacteria 1536
23 Ga0070678_101027022 3300005456 Bacteria 759
24 Ga0070678_102065398 3300005456 Bacteria 539
25 Ga0070707_100098234 3300005468 Bacteria 2836
26 Ga0070698_100025163 3300005471 Bacteria 6202
27 Ga0070686_100146289 3300005544 Bacteria 1650
28 Ga0070665_100012179 3300005548 Bacteria 8672
29 Ga0070665_100341505 3300005548 Bacteria 1502
30 Ga0070704_101708155 3300005549 Bacteria 581
31 Ga0070664_101130733 3300005564 Bacteria 738
32 Ga0068866_10124331 3300005718 Bacteria 1458
33 Ga0068863_100554610 3300005841 Bacteria 1135
34 Ga0068863_100735178 3300005841 Bacteria 982
35 Ga0068860_100010061 3300005843 Bacteria 9372
36 Ga0081538_10056260 3300005981 Bacteria 2306
37 Ga0075365_10152261 3300006038 Bacteria 1609
38 Ga0075363_100277526 3300006048 Bacteria 969
39 Ga0075364_10079278 3300006051 Bacteria 2170
40 Ga0075364_10824014 3300006051 Bacteria 632
41 Ga0075364_10923696 3300006051 Bacteria 594
42 Ga0070712_100392247 3300006175 Bacteria 1145
43 Ga0097621_100126534 3300006237 Bacteria 2171
44 Ga0097621_100923984 3300006237 Bacteria 813
45 Ga0075370_10119391 3300006353 Bacteria 1534
46 Ga0075370_10516102 3300006353 Bacteria 722
47 Ga0105242_10993788 3300009176 Bacteria 846
48 Ga0105248_12335583 3300009177 Bacteria 609
49 Ga0157376_12383450 3300014969 Bacteria 569
50 Ga0182007_10415979 3300015262 Bacteria 514
51 Ga0206353_10240845 3300020082 Bacteria 5306
52 Ga0209025_1030682 3300025294 Bacteria 2566
53 Ga0209025_1089973 3300025294 Bacteria 1007
54 Ga0207692_10242846 3300025898 Bacteria 1076
55 Ga0207692_11023397 3300025898 Bacteria 546
56 Ga0207710_10125961 3300025900 Bacteria 1227
57 Ga0207688_10749121 3300025901 Bacteria 618
58 Ga0207685_10668464 3300025905 Bacteria 563
59 Ga0207699_10226201 3300025906 Bacteria 1279
60 Ga0207645_10659335 3300025907 Bacteria 711
61 Ga0207705_11334970 3300025909 Bacteria 547
62 Ga0207693_10353910 3300025915 Bacteria 1149
63 Ga0207646_10280080 3300025922 Bacteria 1507
64 Ga0207650_10406367 3300025925 Bacteria 1128
65 Ga0207664_10256030 3300025929 Bacteria 1529
66 Ga0207664_11431626 3300025929 Bacteria 612
67 Ga0207644_10006177 3300025931 Bacteria 7811
68 Ga0207686_10236884 3300025934 Bacteria 1326
69 Ga0207670_10408629 3300025936 Bacteria 1087
70 Ga0207704_10896963 3300025938 Bacteria 745
71 Ga0207679_11196477 3300025945 Bacteria 697
72 Ga0207668_10363476 3300025972 Bacteria 1213
73 Ga0207678_10003221 3300026067 Bacteria 14750
74 Ga0207678_11488962 3300026067 Bacteria 598
75 Ga0207678_11997353 3300026067 Bacteria 505
76 Ga0207708_10589723 3300026075 Bacteria 940
77 Ga0207641_10668311 3300026088 Bacteria 1021
78 Ga0207675_100501238 3300026118 Bacteria 1209
79 Ga0207675_102338522 3300026118 Bacteria 548
80 Ga0207683_10386397 3300026121 Bacteria 1287
81 Ga0207683_10747968 3300026121 Bacteria 907
82 Ga0268266_10004586 3300028379 Bacteria 13196
83 Ga0268266_10303178 3300028379 Bacteria 1491
84 Ga0268265_10373138 3300028380 Bacteria 1310
85 Ga0268265_11692826 3300028380 Bacteria 638
86 Ga0268264_10007082 3300028381 Bacteria 9397
87 Ga0316176_1158357 3300030732 Bacteria 1509
88 Ga0314311_1069992 3300030733 Bacteria 3094
89 Ga0316180_1174695 3300030736 Bacteria 1083
90 Ga0316182_1317490 3300030745 Bacteria 806
91 Ga0265327_10000004 3300031251 Bacteria 803973
92 Ga0265327_10000154 3300031251 Bacteria 148866
93 Ga0265327_10011149 3300031251 Bacteria 6232
94 Ga0307513_10437341 3300031456 Bacteria 1035
95 Ga0307514_10228090 3300031649 Bacteria 1133
96 Ga0307413_10148757 3300031824 Bacteria 1629
97 Ga0307410_11467403 3300031852 Bacteria 600
98 Ga0307407_10119233 3300031903 Bacteria 1670
99 Ga0307409_100448333 3300031995 Bacteria 1245
100 Ga0307409_100687422 3300031995 Bacteria 1021
101 Ga0307415_100925567 3300032126 Bacteria 805
102 Ga0307415_101877752 3300032126 Bacteria 581
103 Ga0307507_10614961 3300033179 Bacteria 558
104 Ga0373952_0033321 3300035092 Bacteria 1155
105 Ga0373939_0114310 3300035114 Bacteria 944
106 Ga0373960_0181832 3300035121 Bacteria 734
107 Ga0373942_0048926 3300035207 Bacteria 1179
108 Ga0373961_0070215 3300035241 Bacteria 1082
109 Ga0373931_0123305 3300035691 Bacteria 1483
110 Ga0395899_0435070 3300037312 Bacteria 862
111 Ga0395900_0114466 3300037418 Bacteria 2768
112 Ga0395900_0136955 3300037418 Bacteria 2508
113 Ga0395898_0041089 3300037466 Bacteria 4570
114 Ga0395905_0078107 3300037471 Bacteria 3102
115 Ga0395901_0339847 3300038443 Bacteria 1551
116 Ga0436363_0602839 3300039450 Bacteria 1349
117 Ga0439438_132665 3300041405 Bacteria 597
118 Ga0439465_0056059 3300041413 Bacteria 1298
119 Ga0451791_1517268 3300041451 Bacteria 633
120 Ga0451837_0255016 3300041494 Bacteria 681
121 Ga0451837_0874289 3300041494 Bacteria 517
122 Ga0451847_0652744 3300041503 Bacteria 1016
123 Ga0451853_1355043 3300041512 Bacteria 505
124 Ga0439431_0054468 3300041997 Bacteria 1044
125 Ga0439431_0109487 3300041997 Bacteria 764
126 Ga0439432_075965 3300042006 Bacteria 1021
127 Ga0466969_0111683 3300044656 Bacteria 1279
128 Ga0466972_0011215 3300044658 Bacteria 4498
129 Ga0466972_0012694 3300044658 Bacteria 4230
130 Ga0466972_0016774 3300044658 Bacteria 3661
131 Ga0466972_0066552 3300044658 Bacteria 1722
132 Ga0466972_0395590 3300044658 Bacteria 647
133 Ga0466965_0004361 3300044683 Bacteria 6291
134 Ga0466965_0007357 3300044683 Bacteria 5051
135 Ga0466965_0008218 3300044683 Bacteria 4820
136 Ga0466965_0009245 3300044683 Bacteria 4579
137 Ga0466965_0098670 3300044683 Bacteria 1492
138 Ga0466965_0266852 3300044683 Bacteria 921
139 Ga0466971_0026784 3300044719 Bacteria 2579
140 Ga0466968_0017832 3300044735 Bacteria 2842
141 Ga0466968_0024325 3300044735 Bacteria 2473
142 Ga0466968_0111476 3300044735 Bacteria 1230
143 Ga0466970_0008294 3300044765 Bacteria 5225
144 Ga0466970_0010043 3300044765 Bacteria 4794
145 Ga0466970_0154727 3300044765 Bacteria 1267
146 Ga0466970_0163293 3300044765 Bacteria 1232
147 Ga0466970_0754639 3300044765 Bacteria 569
148 Ga0466957_0020675 3300044842 Bacteria 3874
149 Ga0466957_0342307 3300044842 Bacteria 1013
150 Ga0466960_0000165 3300044901 Bacteria 22393
151 Ga0466960_0000701 3300044901 Bacteria 11681
152 Ga0466960_0009291 3300044901 Bacteria 4048
153 Ga0466960_0037203 3300044901 Bacteria 2282
154 Ga0466960_0457864 3300044901 Bacteria 742
155 Ga0466960_0765727 3300044901 Bacteria 583
156 Ga0466960_0818257 3300044901 Bacteria 565
157 Ga0466959_0075013 3300045049 Bacteria 2444
158 Ga0466958_0015586 3300045836 Bacteria 4359
159 Ga0466958_0957615 3300045836 Bacteria 558
160 Ga0466967_0007791 3300045976 Bacteria 7777
161 Ga0466967_0872229 3300045976 Bacteria 895
162 Ga0495588_0692408 3300046674 Bacteria 533
163 Ga0496100_0002965 3300048903 Bacteria 8730
164 Ga0496101_0001048 3300048904 Bacteria 16336
165 Ga0496101_1160161 3300048904 Bacteria 606
166 Ga0496104_0047509 3300048907 Bacteria 4045
167 Ga0496105_0042929 3300048908 Bacteria 3729
168 Ga0496106_0004664 3300048909 Bacteria 10162
169 Ga0496106_0027974 3300048909 Bacteria 4197
170 Ga0496107_0048047 3300048910 Bacteria 3073
171 Ga0496107_0100205 3300048910 Bacteria 2123
172 Ga0496108_0387875 3300048911 Bacteria 1220
173 Ga0496109_1246949 3300048912 Bacteria 680
174 Ga0496112_0225072 3300048915 Bacteria 1831
175 Ga0496113_0395418 3300048916 Bacteria 1109
176 Ga0496114_0009610 3300048917 Bacteria 7681
177 Ga0496115_0041718 3300048918 Bacteria 3653
178 Ga0496119_0307729 3300048922 Bacteria 779
179 Ga0496120_0051604 3300048923 Bacteria 2348
180 Ga0496122_0028163 3300048925 Bacteria 4778
181 Ga0496123_0030113 3300048926 Bacteria 3978
182 Ga0496124_0423538 3300048927 Bacteria 916
183 Ga0496125_0299826 3300048928 Bacteria 985
184 Ga0496125_0751204 3300048928 Bacteria 511
185 Ga0496126_0002243 3300048929 Bacteria 26677
186 Ga0501081_0376101 3300049743 Bacteria 1049
187 nmdc:mga03n38_412922_c1 3300050490 Bacteria 745
188 nmdc:mga03n38_441987_c1 3300050490 Bacteria 722
189 nmdc:mga00v17_695861_c1 3300050491 Bacteria 652
190 nmdc:mga0yw44_225848_c1 3300050492 Bacteria 1242
191 nmdc:mga07m45_194886_c1 3300050496 Bacteria 866
192 Ga0466962_0204235 3300061719 Bacteria 966
193 Ga0466962_0344090 3300061719 Bacteria 742
194 2523384965 2523231044 Bacteria 6434991
195 2566991818 2565956761 Bacteria 6601618
196 2623587807 2622736626 Bacteria 7181580
197 2643827177 2643221561 Bacteria 4984412
198 2643890471 2643221576 Bacteria 5214352
199 2643959527 2643221590 Bacteria 5214697
200 2644032997 2643221604 Bacteria 5014917
201 2644100007 2643221617 Bacteria 5139111
202 2644117613 2643221620 Bacteria 5134593
203 2644533991 2643221696 Bacteria 5431823
204 2738871894 2738541305 Bacteria 4910150
205 2753038585 2751185725 Bacteria 5740550
206 2753326950 2751185792 Bacteria 5739090
207 2772644447 2772190715 Bacteria 6959372
208 2774396095 2773857762 Bacteria 5971770
209 2812331000 2811994874 Bacteria 5367947
210 2812347777 2811994878 Bacteria 5992952
211 2832005927 2832004796 Bacteria 6538017
212 2855390923 2855386786 Bacteria 4752232
213 2855674659 2855670206 Bacteria 7120389
214 2855678368 2855676851 Bacteria 7063653
215 2855687095 2855683550 Bacteria 7134265
216 2856861838 2856858025 Bacteria 7255264
217 2857294807 2857288857 Bacteria 7189066
218 2858854964 2858848962 Bacteria 6963058
219 2858875213 2858868258 Bacteria 7683772
220 2858885911 2858882152 Bacteria 7230291
221 2858889212 2858888857 Bacteria 7060307
222 2858900421 2858895516 Bacteria 7378898
223 2858906331 2858902515 Bacteria 7086037
224 2866067783 2866065130 Bacteria 6518152
225 2867507989 2867507094 Bacteria 6506033
226 2869050424 2869048445 Bacteria 6875584
227 2869063118 2869061728 Bacteria 7112407
228 2869073691 2869068681 Bacteria 7205615
229 2880492285 2880489317 Bacteria 7096270
230 2880499998 2880495981 Bacteria 7340502
231 2891968814 2891968417 Bacteria 5821697
232 2902586885 2902582711 Bacteria 6187705
233 2904540515 2904535858 Bacteria 6308016
234 2922554599 2922554459 Bacteria 6683962
235 2929218134 2929212328 Bacteria 7708288
236 2929221907 2929219909 Bacteria 6984360
237 2929228561 2929226422 Bacteria 7248583
238 2932400308 2932398195 Bacteria 3847976
239 2984578466 2984576629 Bacteria 4248407
240 2990259275 2990256926 Bacteria 4252839
241 2996227757 2996221748 Bacteria 6799777
242 3001120548 3001119090 Bacteria 3449530
243 8003319904 8003314358 Bacteria 10575343
244 8003874041 8003870546 Bacteria 7396674
245 8047714070 8047710418 Bacteria 11023148
246 8054707433 8054704163 Bacteria 7247792
247 8054729414 8054727385 Bacteria 7558670
248 8054739472 8054734606 Bacteria 6947278
249 8055413793 8055412473 Bacteria 6257500
250 Ga0466965_0169770
251 Ga0006562J51391_1030556
252 Ga0006562J51391_1030557
253 Ga0070658_11195919
254 Ga0070683_100873675
255 Ga0068868_100592850
256 Ga0070692_11267800
257 Ga0070668_100011597
258 Ga0070668_100272242
259 Ga0070668_100454259
260 Ga0070669_100585109
261 Ga0070671_100008134
262 Ga0070674_100133614
263 Ga0070674_100267324
264 Ga0070673_101576161
265 Ga0070709_10036437
266 Ga0070714_101455508
267 Ga0070713_100337664
268 Ga0070710_10000480
269 Ga0070710_10026422
270 Ga0070663_100001150
271 Ga0070678_100232973
272 Ga0070678_101027022
273 Ga0070678_102065398
274 Ga0070707_100098234
275 Ga0070698_100025163
276 Ga0070686_100146289
277 Ga0070665_100012179
278 Ga0070665_100341505
279 Ga0070704_101708155
280 Ga0070664_101130733
281 Ga0068866_10124331
282 Ga0068863_100554610
283 Ga0068863_100735178
284 Ga0068860_100010061
285 Ga0081538_10056260
286 Ga0075365_10152261
287 Ga0075363_100277526
288 Ga0075364_10079278
289 Ga0075364_10824014
290 Ga0075364_10923696
291 Ga0070712_100392247
292 Ga0097621_100126534
293 Ga0097621_100923984
294 Ga0075370_10119391
295 Ga0075370_10516102
296 Ga0105242_10993788
297 Ga0105248_12335583
298 Ga0157376_12383450
299 Ga0182007_10415979
300 Ga0206353_10240845
301 Ga0209025_1030682
302 Ga0209025_1089973
303 Ga0207692_10242846
304 Ga0207692_11023397
305 Ga0207710_10125961
306 Ga0207688_10749121
307 Ga0207685_10668464
308 Ga0207699_10226201
309 Ga0207645_10659335
310 Ga0207705_11334970
311 Ga0207693_10353910
312 Ga0207646_10280080
313 Ga0207650_10406367
314 Ga0207664_10256030
315 Ga0207664_11431626
316 Ga0207644_10006177
317 Ga0207686_10236884
318 Ga0207670_10408629
319 Ga0207704_10896963
320 Ga0207679_11196477
321 Ga0207668_10363476
322 Ga0207678_10003221
323 Ga0207678_11488962
324 Ga0207678_11997353
325 Ga0207708_10589723
326 Ga0207641_10668311
327 Ga0207675_100501238
328 Ga0207675_102338522
329 Ga0207683_10386397
330 Ga0207683_10747968
331 Ga0268266_10004586
332 Ga0268266_10303178
333 Ga0268265_10373138
334 Ga0268265_11692826
335 Ga0268264_10007082
336 Ga0316176_1158357
337 Ga0314311_1069992
338 Ga0316180_1174695
339 Ga0316182_1317490
340 Ga0265327_10000004
341 Ga0265327_10000154
342 Ga0265327_10011149
343 Ga0307513_10437341
344 Ga0307514_10228090
345 Ga0307413_10148757
346 Ga0307410_11467403
347 Ga0307407_10119233
348 Ga0307409_100448333
349 Ga0307409_100687422
350 Ga0307415_100925567
351 Ga0307415_101877752
352 Ga0307507_10614961
353 Ga0373952_0033321
354 Ga0373939_0114310
355 Ga0373960_0181832
356 Ga0373942_0048926
357 Ga0373961_0070215
358 Ga0373931_0123305
359 Ga0395899_0435070
360 Ga0395900_0114466
361 Ga0395900_0136955
362 Ga0395898_0041089
363 Ga0395905_0078107
364 Ga0395901_0339847
365 Ga0436363_0602839
366 Ga0439438_132665
367 Ga0439465_0056059
368 Ga0451791_1517268
369 Ga0451837_0255016
370 Ga0451837_0874289
371 Ga0451847_0652744
372 Ga0451853_1355043
373 Ga0439431_0054468
374 Ga0439431_0109487
375 Ga0439432_075965
376 Ga0466969_0111683
377 Ga0466972_0011215
378 Ga0466972_0012694
379 Ga0466972_0016774
380 Ga0466972_0066552
381 Ga0466972_0395590
382 Ga0466965_0004361
383 Ga0466965_0007357
384 Ga0466965_0008218
385 Ga0466965_0009245
386 Ga0466965_0098670
387 Ga0466965_0266852
388 Ga0466971_0026784
389 Ga0466968_0017832
390 Ga0466968_0024325
391 Ga0466968_0111476
392 Ga0466970_0008294
393 Ga0466970_0010043
394 Ga0466970_0154727
395 Ga0466970_0163293
396 Ga0466970_0754639
397 Ga0466957_0020675
398 Ga0466957_0342307
399 Ga0466960_0000165
400 Ga0466960_0000701
401 Ga0466960_0009291
402 Ga0466960_0037203
403 Ga0466960_0457864
404 Ga0466960_0765727
405 Ga0466960_0818257
406 Ga0466959_0075013
407 Ga0466958_0015586
408 Ga0466958_0957615
409 Ga0466967_0007791
410 Ga0466967_0872229
411 Ga0495588_0692408
412 Ga0496100_0002965
413 Ga0496101_0001048
414 Ga0496101_1160161
415 Ga0496104_0047509
416 Ga0496105_0042929
417 Ga0496106_0004664
418 Ga0496106_0027974
419 Ga0496107_0048047
420 Ga0496107_0100205
421 Ga0496108_0387875
422 Ga0496109_1246949
423 Ga0496112_0225072
424 Ga0496113_0395418
425 Ga0496114_0009610
426 Ga0496115_0041718
427 Ga0496119_0307729
428 Ga0496120_0051604
429 Ga0496122_0028163
430 Ga0496123_0030113
431 Ga0496124_0423538
432 Ga0496125_0299826
433 Ga0496125_0751204
434 Ga0496126_0002243
435 Ga0501081_0376101
436 nmdc:mga03n38_412922_c1
437 nmdc:mga03n38_441987_c1
438 nmdc:mga00v17_695861_c1
439 nmdc:mga0yw44_225848_c1
440 nmdc:mga07m45_194886_c1
441 Ga0466962_0204235
442 Ga0466962_0344090
443 2523384965
444 2566991818
445 2623587807
446 2643827177
447 2643890471
448 2643959527
449 2644032997
450 2644100007
451 2644117613
452 2644533991
453 2738871894
454 2753038585
455 2753326950
456 2772644447
457 2774396095
458 2812331000
459 2812347777
460 2832005927
461 2855390923
462 2855674659
463 2855678368
464 2855687095
465 2856861838
466 2857294807
467 2858854964
468 2858875213
469 2858885911
470 2858889212
471 2858900421
472 2858906331
473 2866067783
474 2867507989
475 2869050424
476 2869063118
477 2869073691
478 2880492285
479 2880499998
480 2891968814
481 2902586885
482 2904540515
483 2922554599
484 2929218134
485 2929221907
486 2929228561
487 2932400308
488 2984578466
489 2990259275
490 2996227757
491 3001120548
492 8003319904
493 8003874041
494 8047714070
495 8054707433
496 8054729414
497 8054739472
498 8055413793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

18

94

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.9334 2 66
3hx9-assembly1.cif.gz_B structure of heme-degrader, mhud (rv3592), from mycobacterium tuberculosis with two hemes bound in its active site 0.9249 3 103
6ds8-assembly1.cif.gz_B crystal structure of mhud r26s mutant with two manganese protoporphyrin ix bound per active site 0.9242 3 104
5uq4-assembly1.cif.gz_B crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein 0.9209 1 104
3hx9-assembly1.cif.gz_B structure of heme-degrader, mhud (rv3592), from mycobacterium tuberculosis with two hemes bound in its active site 0.9071 3 103
ID Description Score Start End Superfamily
3hx9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9249 3 103 3.30.70.100
3hx9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9071 3 103 3.30.70.100
5uq4A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9054 1 103 3.30.70.100
5uq4A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8952 1 103 3.30.70.100
af_Q2FV13_1_138_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8864 2 75 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A656TKS8-F1-model_v4 deleted 0.9744 1 75
AF-A0A2D1I8E2-F1-model_v4 deleted 0.9733 1 105
AF-A0A846XYW2-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9687 1 104 GO:0004497
AF-A0A6G9Y5I0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9681 1 105 GO:0004497
AF-A0A3N9WLU1-F1-model_v4 deleted 0.9645 1 88

Map