F360837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 169 | 232 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300031240|Ga0265320_10297523|Ga0265320_102975231 |
| Length | 173 |
| Sequence | MADTTGTTSKPKKTAATAEPETTPRAAGVLKVHHLRPAPGSHKPKTRVGRGEASKGKTAGRGTKGTKARYQVPERFEGGQMPLHMRLPKLKGFTNRFRTEYQVVNLEWIAAHYPKGGAVTPDDLVAKGAVRKGELVKVLGDGEIGVKLQVSAHGFSASAKDKIEAAGGSATKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 3 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 4 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 5 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 6 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 7 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 8 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 9 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 10 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 11 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 12 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 13 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 14 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 15 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 16 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 17 | 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Metatranscriptome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 92 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 93 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 113 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 114 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 115 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 116 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 117 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 120 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 121 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 148 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 149 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 150 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 151 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 165 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 169 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.31 |
| Metatranscriptomes | 14.86 |
| Isolates | 6.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 1.61 |
| Rhizoplane | 5.22 |
| Rhizosphere | 85.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | bgg_mtDRAFT_1030866 | 3300000305 | Bacteria | 1488 |
| 2 | JGI24735J21928_10013080 | 3300002067 | Bacteria | 2614 |
| 3 | Ga0070658_10877974 | 3300005327 | Bacteria | 780 |
| 4 | Ga0070658_10879887 | 3300005327 | Bacteria | 779 |
| 5 | Ga0070683_100107256 | 3300005329 | Bacteria | 2633 |
| 6 | Ga0070677_10467306 | 3300005333 | Bacteria | 678 |
| 7 | Ga0070680_100141101 | 3300005336 | Bacteria | 2020 |
| 8 | Ga0070682_100757059 | 3300005337 | Bacteria | 785 |
| 9 | Ga0070660_100108402 | 3300005339 | Bacteria | 2207 |
| 10 | Ga0070660_100175526 | 3300005339 | Bacteria | 1733 |
| 11 | Ga0070660_100603824 | 3300005339 | Bacteria | 917 |
| 12 | Ga0070661_101014252 | 3300005344 | Bacteria | 689 |
| 13 | Ga0070709_10087554 | 3300005434 | Bacteria | 2047 |
| 14 | Ga0070714_100260417 | 3300005435 | Bacteria | 1606 |
| 15 | Ga0070714_101054392 | 3300005435 | Bacteria | 792 |
| 16 | Ga0070714_101159287 | 3300005435 | Bacteria | 754 |
| 17 | Ga0070710_10000376 | 3300005437 | Bacteria | 20895 |
| 18 | Ga0070708_100341306 | 3300005445 | Bacteria | 1411 |
| 19 | Ga0070678_100626317 | 3300005456 | Bacteria | 963 |
| 20 | Ga0070678_100736456 | 3300005456 | Bacteria | 891 |
| 21 | Ga0070681_10236229 | 3300005458 | Bacteria | 1742 |
| 22 | Ga0070681_10459072 | 3300005458 | Bacteria | 1186 |
| 23 | Ga0070706_100015860 | 3300005467 | Bacteria | 6955 |
| 24 | Ga0070706_100353481 | 3300005467 | Bacteria | 1369 |
| 25 | Ga0070706_101052626 | 3300005467 | Bacteria | 750 |
| 26 | Ga0070707_100046095 | 3300005468 | Bacteria | 4171 |
| 27 | Ga0070707_100070399 | 3300005468 | Bacteria | 3369 |
| 28 | Ga0070707_100136467 | 3300005468 | Bacteria | 2387 |
| 29 | Ga0070707_100276465 | 3300005468 | Bacteria | 1632 |
| 30 | Ga0070698_100112103 | 3300005471 | Bacteria | 2693 |
| 31 | Ga0070679_100283199 | 3300005530 | Bacteria | 1610 |
| 32 | Ga0070679_100739466 | 3300005530 | Bacteria | 926 |
| 33 | Ga0070679_101036258 | 3300005530 | Bacteria | 765 |
| 34 | Ga0070684_100182097 | 3300005535 | Bacteria | 1910 |
| 35 | Ga0070684_101559924 | 3300005535 | Bacteria | 623 |
| 36 | Ga0070686_100167961 | 3300005544 | Bacteria | 1550 |
| 37 | Ga0068855_100009577 | 3300005563 | Bacteria | 11689 |
| 38 | Ga0068855_101170462 | 3300005563 | Bacteria | 801 |
| 39 | Ga0068856_100855256 | 3300005614 | Bacteria | 929 |
| 40 | Ga0068852_100033979 | 3300005616 | Bacteria | 4241 |
| 41 | Ga0068852_100211064 | 3300005616 | Bacteria | 1842 |
| 42 | Ga0068852_100703126 | 3300005616 | Bacteria | 1021 |
| 43 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 44 | Ga0068858_101104430 | 3300005842 | Bacteria | 779 |
| 45 | Ga0070716_100201247 | 3300006173 | Bacteria | 1324 |
| 46 | Ga0097621_100520515 | 3300006237 | Bacteria | 1080 |
| 47 | Ga0075370_10810541 | 3300006353 | Bacteria | 571 |
| 48 | Ga0068865_100734255 | 3300006881 | Bacteria | 847 |
| 49 | Ga0105240_10002670 | 3300009093 | Bacteria | 28391 |
| 50 | Ga0105240_10217324 | 3300009093 | Bacteria | 2229 |
| 51 | Ga0105247_10000616 | 3300009101 | Bacteria | 28650 |
| 52 | Ga0105243_10757720 | 3300009148 | Bacteria | 952 |
| 53 | Ga0105241_10251515 | 3300009174 | Bacteria | 1498 |
| 54 | Ga0105242_11764941 | 3300009176 | Bacteria | 656 |
| 55 | Ga0105246_10467242 | 3300011119 | Bacteria | 1064 |
| 56 | Ga0157370_10007858 | 3300013104 | Bacteria | 11558 |
| 57 | Ga0157370_10913407 | 3300013104 | Bacteria | 796 |
| 58 | Ga0157369_10001467 | 3300013105 | Bacteria | 28921 |
| 59 | Ga0157369_10469428 | 3300013105 | Bacteria | 1303 |
| 60 | Ga0157369_10503819 | 3300013105 | Bacteria | 1252 |
| 61 | Ga0157378_11077150 | 3300013297 | Bacteria | 840 |
| 62 | Ga0157372_10784506 | 3300013307 | Bacteria | 1107 |
| 63 | Ga0157372_11121154 | 3300013307 | Bacteria | 910 |
| 64 | Ga0157372_11349914 | 3300013307 | Bacteria | 822 |
| 65 | Ga0157372_11422601 | 3300013307 | Bacteria | 799 |
| 66 | Ga0157372_13128586 | 3300013307 | Bacteria | 528 |
| 67 | Ga0163163_10218193 | 3300014325 | Bacteria | 1956 |
| 68 | Ga0163163_11449365 | 3300014325 | Bacteria | 748 |
| 69 | Ga0157380_10812066 | 3300014326 | Bacteria | 953 |
| 70 | Ga0157379_10009461 | 3300014968 | Bacteria | 8492 |
| 71 | Ga0157376_10635652 | 3300014969 | Bacteria | 1066 |
| 72 | Ga0157376_10784105 | 3300014969 | Bacteria | 965 |
| 73 | Ga0157376_12314130 | 3300014969 | Bacteria | 577 |
| 74 | Ga0197907_10064221 | 3300020069 | Bacteria | 3965 |
| 75 | Ga0197907_10381301 | 3300020069 | Bacteria | 1103 |
| 76 | Ga0197907_10544001 | 3300020069 | Bacteria | 1364 |
| 77 | Ga0197907_10665365 | 3300020069 | Bacteria | 1656 |
| 78 | Ga0197907_10788872 | 3300020069 | Bacteria | 1442 |
| 79 | Ga0206356_10055854 | 3300020070 | Bacteria | 4191 |
| 80 | Ga0206356_10436325 | 3300020070 | Bacteria | 1244 |
| 81 | Ga0206356_10711707 | 3300020070 | Bacteria | 2770 |
| 82 | Ga0206356_11742728 | 3300020070 | Bacteria | 1775 |
| 83 | Ga0206352_10653387 | 3300020078 | Bacteria | 5763 |
| 84 | Ga0206352_11096998 | 3300020078 | Bacteria | 1516 |
| 85 | Ga0206350_10194576 | 3300020080 | Bacteria | 2907 |
| 86 | Ga0206350_11648271 | 3300020080 | Bacteria | 1865 |
| 87 | Ga0206354_10539415 | 3300020081 | Bacteria | 674 |
| 88 | Ga0206354_10905345 | 3300020081 | Bacteria | 507 |
| 89 | Ga0206354_11016645 | 3300020081 | Bacteria | 2550 |
| 90 | Ga0206354_11694990 | 3300020081 | Bacteria | 712 |
| 91 | Ga0206353_10860423 | 3300020082 | Bacteria | 1640 |
| 92 | Ga0206353_11448016 | 3300020082 | Bacteria | 509 |
| 93 | Ga0224712_10040600 | 3300022467 | Bacteria | 1752 |
| 94 | Ga0224712_10050374 | 3300022467 | Bacteria | 1617 |
| 95 | Ga0224712_10067043 | 3300022467 | Bacteria | 1447 |
| 96 | Ga0224712_10069079 | 3300022467 | Bacteria | 1429 |
| 97 | Ga0224712_10132543 | 3300022467 | Bacteria | 1089 |
| 98 | Ga0224712_10144111 | 3300022467 | Bacteria | 1051 |
| 99 | Ga0207692_10448236 | 3300025898 | Bacteria | 812 |
| 100 | Ga0207710_10000048 | 3300025900 | Bacteria | 189597 |
| 101 | Ga0207647_10026877 | 3300025904 | Bacteria | 3759 |
| 102 | Ga0207705_10001318 | 3300025909 | Bacteria | 19884 |
| 103 | Ga0207705_10157782 | 3300025909 | Bacteria | 1703 |
| 104 | Ga0207705_10983980 | 3300025909 | Bacteria | 652 |
| 105 | Ga0207684_10049264 | 3300025910 | Bacteria | 3574 |
| 106 | Ga0207684_10069797 | 3300025910 | Bacteria | 2986 |
| 107 | Ga0207684_10075576 | 3300025910 | Bacteria | 2863 |
| 108 | Ga0207654_10248518 | 3300025911 | Bacteria | 1191 |
| 109 | Ga0207707_10633696 | 3300025912 | Bacteria | 902 |
| 110 | Ga0207695_10067881 | 3300025913 | Bacteria | 3656 |
| 111 | Ga0207660_10884333 | 3300025917 | Bacteria | 729 |
| 112 | Ga0207657_10097078 | 3300025919 | Bacteria | 2450 |
| 113 | Ga0207657_10125840 | 3300025919 | Bacteria | 2105 |
| 114 | Ga0207649_10058052 | 3300025920 | Bacteria | 2422 |
| 115 | Ga0207652_10034738 | 3300025921 | Bacteria | 4251 |
| 116 | Ga0207652_11094782 | 3300025921 | Bacteria | 697 |
| 117 | Ga0207646_10005100 | 3300025922 | Bacteria | 13929 |
| 118 | Ga0207646_10025217 | 3300025922 | Bacteria | 5441 |
| 119 | Ga0207646_10049032 | 3300025922 | Bacteria | 3783 |
| 120 | Ga0207646_10085897 | 3300025922 | Bacteria | 2814 |
| 121 | Ga0207646_11100634 | 3300025922 | Bacteria | 699 |
| 122 | Ga0207664_10269908 | 3300025929 | Bacteria | 1490 |
| 123 | Ga0207664_10439227 | 3300025929 | Bacteria | 1164 |
| 124 | Ga0207669_11010152 | 3300025937 | Bacteria | 699 |
| 125 | Ga0207661_10053311 | 3300025944 | Bacteria | 3236 |
| 126 | Ga0207661_10400752 | 3300025944 | Bacteria | 1244 |
| 127 | Ga0207661_10803820 | 3300025944 | Bacteria | 866 |
| 128 | Ga0207667_10017929 | 3300025949 | Bacteria | 7956 |
| 129 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 130 | Ga0207678_11822304 | 3300026067 | Bacteria | 532 |
| 131 | Ga0207702_10539873 | 3300026078 | Bacteria | 1140 |
| 132 | Ga0207702_11159124 | 3300026078 | Bacteria | 767 |
| 133 | Ga0207683_10260383 | 3300026121 | Bacteria | 1584 |
| 134 | Ga0207698_10047610 | 3300026142 | Bacteria | 3250 |
| 135 | Ga0207698_10116479 | 3300026142 | Bacteria | 2252 |
| 136 | Ga0268266_10762169 | 3300028379 | Bacteria | 934 |
| 137 | Ga0268264_10348594 | 3300028381 | Bacteria | 1409 |
| 138 | Ga0316181_1115940 | 3300030744 | Bacteria | 1364 |
| 139 | Ga0316182_1160810 | 3300030745 | Bacteria | 4679 |
| 140 | Ga0265762_1028034 | 3300030760 | Bacteria | 1059 |
| 141 | Ga0265767_105877 | 3300030836 | Bacteria | 753 |
| 142 | Ga0265777_112286 | 3300030877 | Bacteria | 644 |
| 143 | Ga0265776_102973 | 3300030880 | Bacteria | 806 |
| 144 | Ga0265764_106359 | 3300030882 | Bacteria | 678 |
| 145 | Ga0265761_100952 | 3300030889 | Bacteria | 1204 |
| 146 | Ga0265320_10297523 | 3300031240 | Bacteria | 714 |
| 147 | Ga0265325_10056723 | 3300031241 | Bacteria | 1999 |
| 148 | Ga0265340_10011241 | 3300031247 | Bacteria | 4766 |
| 149 | Ga0265340_10041866 | 3300031247 | Bacteria | 2250 |
| 150 | Ga0265340_10291848 | 3300031247 | Bacteria | 724 |
| 151 | Ga0265339_10155583 | 3300031249 | Bacteria | 1153 |
| 152 | Ga0265316_10107171 | 3300031344 | Bacteria | 2119 |
| 153 | Ga0265313_10092342 | 3300031595 | Bacteria | 1356 |
| 154 | Ga0310103_108965 | 3300031614 | Bacteria | 1351 |
| 155 | Ga0265314_10100950 | 3300031711 | Bacteria | 1855 |
| 156 | Ga0373947_0277441 | 3300035725 | Bacteria | 1114 |
| 157 | Ga0395900_0084638 | 3300037418 | Bacteria | 3259 |
| 158 | Ga0395900_0399311 | 3300037418 | Bacteria | 1339 |
| 159 | Ga0395898_0089110 | 3300037466 | Bacteria | 2969 |
| 160 | Ga0395898_1242431 | 3300037466 | Bacteria | 675 |
| 161 | Ga0395905_0463893 | 3300037471 | Bacteria | 1165 |
| 162 | Ga0395901_0742407 | 3300038443 | Bacteria | 975 |
| 163 | Ga0400485_08169 | 3300038735 | Bacteria | 55719 |
| 164 | Ga0400488_51295 | 3300038741 | Bacteria | 9736 |
| 165 | Ga0400486_03564 | 3300038742 | Bacteria | 38786 |
| 166 | Ga0439461_0039288 | 3300041410 | Bacteria | 1017 |
| 167 | Ga0439445_0083218 | 3300042004 | Bacteria | 896 |
| 168 | Ga0439434_0005739 | 3300042435 | Bacteria | 3623 |
| 169 | Ga0451577_0460192 | 3300042876 | Bacteria | 1155 |
| 170 | Ga0466972_0000467 | 3300044658 | Bacteria | 20502 |
| 171 | Ga0466963_0162677 | 3300044694 | Bacteria | 1554 |
| 172 | Ga0466970_0199369 | 3300044765 | Bacteria | 1113 |
| 173 | Ga0466957_0431671 | 3300044842 | Bacteria | 905 |
| 174 | Ga0466958_0274383 | 3300045836 | Bacteria | 1080 |
| 175 | Ga0466967_0043782 | 3300045976 | Bacteria | 3878 |
| 176 | Ga0466967_0054980 | 3300045976 | Bacteria | 3506 |
| 177 | Ga0466967_0207358 | 3300045976 | Bacteria | 1858 |
| 178 | Ga0466967_1321875 | 3300045976 | Bacteria | 718 |
| 179 | Ga0495629_0132089 | 3300046459 | Bacteria | 1739 |
| 180 | Ga0495629_0634713 | 3300046459 | Bacteria | 713 |
| 181 | Ga0495653_0079028 | 3300046463 | Bacteria | 2438 |
| 182 | Ga0495607_0021701 | 3300046501 | Bacteria | 4038 |
| 183 | Ga0495665_0223483 | 3300046531 | Bacteria | 973 |
| 184 | Ga0495667_0285290 | 3300046559 | Bacteria | 1048 |
| 185 | Ga0495635_0179284 | 3300046663 | Bacteria | 1440 |
| 186 | Ga0495588_0078629 | 3300046674 | Bacteria | 1721 |
| 187 | Ga0495599_0418203 | 3300046678 | Bacteria | 797 |
| 188 | Ga0495647_0248788 | 3300046681 | Bacteria | 791 |
| 189 | Ga0495658_0294850 | 3300046683 | Bacteria | 1025 |
| 190 | Ga0495581_0524488 | 3300047315 | Bacteria | 688 |
| 191 | Ga0495674_0361276 | 3300047319 | Bacteria | 1177 |
| 192 | Ga0495684_0978219 | 3300047471 | Bacteria | 539 |
| 193 | Ga0495593_0097880 | 3300047673 | Bacteria | 1507 |
| 194 | Ga0495614_0528290 | 3300048089 | Bacteria | 563 |
| 195 | Ga0496102_0686222 | 3300048905 | Bacteria | 947 |
| 196 | Ga0496102_1260706 | 3300048905 | Bacteria | 658 |
| 197 | Ga0496104_0004123 | 3300048907 | Bacteria | 12619 |
| 198 | Ga0496105_0457108 | 3300048908 | Bacteria | 1007 |
| 199 | Ga0496108_0002443 | 3300048911 | Bacteria | 14848 |
| 200 | Ga0496109_0087981 | 3300048912 | Bacteria | 2870 |
| 201 | Ga0496109_0717416 | 3300048912 | Bacteria | 937 |
| 202 | Ga0496110_0004143 | 3300048913 | Bacteria | 11207 |
| 203 | Ga0496111_0000712 | 3300048914 | Bacteria | 17656 |
| 204 | Ga0496114_0097964 | 3300048917 | Bacteria | 2499 |
| 205 | Ga0496114_0171645 | 3300048917 | Bacteria | 1890 |
| 206 | Ga0496115_0269262 | 3300048918 | Bacteria | 1400 |
| 207 | Ga0496115_0402402 | 3300048918 | Bacteria | 1111 |
| 208 | Ga0496119_0013889 | 3300048922 | Bacteria | 6356 |
| 209 | Ga0496121_0017835 | 3300048924 | Bacteria | 7209 |
| 210 | Ga0496124_0528561 | 3300048927 | Bacteria | 784 |
| 211 | Ga0496126_0041790 | 3300048929 | Bacteria | 4240 |
| 212 | Ga0501318_036332 | 3300049534 | Bacteria | 689 |
| 213 | Ga0501032_0205482 | 3300049569 | Bacteria | 1285 |
| 214 | Ga0501042_0007737 | 3300049578 | Bacteria | 7059 |
| 215 | Ga0501043_0419364 | 3300049579 | Bacteria | 1009 |
| 216 | Ga0501070_0006424 | 3300049586 | Bacteria | 10005 |
| 217 | Ga0501070_0013575 | 3300049586 | Bacteria | 6866 |
| 218 | Ga0501070_0018699 | 3300049586 | Bacteria | 5813 |
| 219 | Ga0501073_0249815 | 3300049589 | Bacteria | 1224 |
| 220 | Ga0501074_0003938 | 3300049590 | Bacteria | 10580 |
| 221 | Ga0501074_0308078 | 3300049590 | Bacteria | 1125 |
| 222 | Ga0501079_0001234 | 3300049741 | Bacteria | 17906 |
| 223 | Ga0501080_0040761 | 3300049742 | Bacteria | 4330 |
| 224 | Ga0501080_0072771 | 3300049742 | Bacteria | 3198 |
| 225 | Ga0501080_0102198 | 3300049742 | Bacteria | 2659 |
| 226 | Ga0501044_0476818 | 3300049823 | Bacteria | 1151 |
| 227 | Ga0501084_0144319 | 3300054114 | Bacteria | 2005 |
| 228 | Ga0590075_032288 | 3300059424 | Bacteria | 1328 |
| 229 | Ga0587080_082575 | 3300059503 | Bacteria | 662 |
| 230 | Ga0587128_089023 | 3300059630 | Bacteria | 630 |
| 231 | Ga0587076_168208 | 3300059645 | Bacteria | 544 |
| 232 | Ga0466962_0412726 | 3300061719 | Bacteria | 677 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049534 | Ga0501318_036332 | Ga0501318_036332_74_577 | 128 |
| 2 | iso_pu_bacteria | 2744054611 | 2744956974 | 131 |
| 3 | iso_pu_bacteria | 8047710418 | 8047717762 | 131 |
| 4 | 3300005333 | Ga0070677_10467306 | Ga0070677_104673061 | 133 |
| 5 | 3300049586 | Ga0501070_0018699 | Ga0501070_0018699_478_915 | 133 |
| 6 | 3300049742 | Ga0501080_0072771 | Ga0501080_0072771_1985_2422 | 133 |
| 7 | iso_pu_bacteria | 2675903060 | 2676494473 | 133 |
| 8 | iso_pu_bacteria | 2856741275 | 2856746616 | 133 |
| 9 | iso_pu_bacteria | 2873314349 | 2873322128 | 133 |
| 10 | iso_pu_bacteria | 2884693830 | 2884694832 | 133 |
| 11 | iso_pu_bacteria | 2891395885 | 2891401903 | 133 |
| 12 | iso_pu_bacteria | 2891554331 | 2891560644 | 133 |
| 13 | iso_pu_bacteria | 2891562705 | 2891566108 | 133 |
| 14 | iso_pu_bacteria | 2895427314 | 2895432689 | 133 |
| 15 | iso_pu_bacteria | 2895442618 | 2895446472 | 133 |
| 16 | 3300005544 | Ga0070686_100167961 | Ga0070686_1001679613 | 134 |
| 17 | 3300005842 | Ga0068858_100000010 | Ga0068858_100000010147 | 134 |
| 18 | 3300009101 | Ga0105247_10000616 | Ga0105247_100006167 | 134 |
| 19 | 3300014968 | Ga0157379_10009461 | Ga0157379_1000946110 | 134 |
| 20 | 3300022467 | Ga0224712_10144111 | Ga0224712_101441111 | 134 |
| 21 | 3300025900 | Ga0207710_10000048 | Ga0207710_1000004816 | 134 |
| 22 | 3300026035 | Ga0207703_10000002 | Ga0207703_10000002124 | 134 |
| 23 | 3300030760 | Ga0265762_1028034 | Ga0265762_10280342 | 134 |
| 24 | 3300030836 | Ga0265767_105877 | Ga0265767_1058771 | 134 |
| 25 | 3300030877 | Ga0265777_112286 | Ga0265777_1122861 | 134 |
| 26 | 3300030880 | Ga0265776_102973 | Ga0265776_1029733 | 134 |
| 27 | 3300030882 | Ga0265764_106359 | Ga0265764_1063592 | 134 |
| 28 | 3300030889 | Ga0265761_100952 | Ga0265761_1009522 | 134 |
| 29 | 3300031614 | Ga0310103_108965 | Ga0310103_1089652 | 134 |
| 30 | 3300041410 | Ga0439461_0039288 | Ga0439461_0039288_510_956 | 134 |
| 31 | 3300042004 | Ga0439445_0083218 | Ga0439445_0083218_92_535 | 134 |
| 32 | 3300042435 | Ga0439434_0005739 | Ga0439434_0005739_170_613 | 134 |
| 33 | 3300048905 | Ga0496102_1260706 | Ga0496102_1260706_50_544 | 134 |
| 34 | 3300048922 | Ga0496119_0013889 | Ga0496119_0013889_1305_1799 | 134 |
| 35 | 3300048924 | Ga0496121_0017835 | Ga0496121_0017835_1775_2269 | 134 |
| 36 | 3300059503 | Ga0587080_082575 | Ga0587080_082575_44_544 | 134 |
| 37 | 3300000305 | bgg_mtDRAFT_1030866 | bgg_mtDRAFT_10308664 | 135 |
| 38 | 3300002067 | JGI24735J21928_10013080 | JGI24735J21928_100130803 | 135 |
| 39 | 3300005327 | Ga0070658_10877974 | Ga0070658_108779741 | 135 |
| 40 | 3300005327 | Ga0070658_10879887 | Ga0070658_108798872 | 135 |
| 41 | 3300005329 | Ga0070683_100107256 | Ga0070683_1001072562 | 135 |
| 42 | 3300005336 | Ga0070680_100141101 | Ga0070680_1001411011 | 135 |
| 43 | 3300005337 | Ga0070682_100757059 | Ga0070682_1007570593 | 135 |
| 44 | 3300005339 | Ga0070660_100108402 | Ga0070660_1001084024 | 135 |
| 45 | 3300005339 | Ga0070660_100175526 | Ga0070660_1001755261 | 135 |
| 46 | 3300005339 | Ga0070660_100603824 | Ga0070660_1006038242 | 135 |
| 47 | 3300005344 | Ga0070661_101014252 | Ga0070661_1010142521 | 135 |
| 48 | 3300005434 | Ga0070709_10087554 | Ga0070709_100875543 | 135 |
| 49 | 3300005435 | Ga0070714_100260417 | Ga0070714_1002604172 | 135 |
| 50 | 3300005435 | Ga0070714_101054392 | Ga0070714_1010543921 | 135 |
| 51 | 3300005435 | Ga0070714_101159287 | Ga0070714_1011592872 | 135 |
| 52 | 3300005437 | Ga0070710_10000376 | Ga0070710_100003761 | 135 |
| 53 | 3300005445 | Ga0070708_100341306 | Ga0070708_1003413063 | 135 |
| 54 | 3300005456 | Ga0070678_100626317 | Ga0070678_1006263173 | 135 |
| 55 | 3300005456 | Ga0070678_100736456 | Ga0070678_1007364561 | 135 |
| 56 | 3300005458 | Ga0070681_10236229 | Ga0070681_102362291 | 135 |
| 57 | 3300005458 | Ga0070681_10459072 | Ga0070681_104590722 | 135 |
| 58 | 3300005467 | Ga0070706_100015860 | Ga0070706_1000158602 | 135 |
| 59 | 3300005467 | Ga0070706_100353481 | Ga0070706_1003534812 | 135 |
| 60 | 3300005467 | Ga0070706_101052626 | Ga0070706_1010526261 | 135 |
| 61 | 3300005468 | Ga0070707_100046095 | Ga0070707_1000460952 | 135 |
| 62 | 3300005468 | Ga0070707_100070399 | Ga0070707_1000703993 | 135 |
| 63 | 3300005468 | Ga0070707_100136467 | Ga0070707_1001364675 | 135 |
| 64 | 3300005468 | Ga0070707_100276465 | Ga0070707_1002764653 | 135 |
| 65 | 3300005471 | Ga0070698_100112103 | Ga0070698_1001121031 | 135 |
| 66 | 3300005530 | Ga0070679_100283199 | Ga0070679_1002831993 | 135 |
| 67 | 3300005530 | Ga0070679_100739466 | Ga0070679_1007394662 | 135 |
| 68 | 3300005530 | Ga0070679_101036258 | Ga0070679_1010362582 | 135 |
| 69 | 3300005535 | Ga0070684_100182097 | Ga0070684_1001820973 | 135 |
| 70 | 3300005535 | Ga0070684_101559924 | Ga0070684_1015599241 | 135 |
| 71 | 3300005563 | Ga0068855_100009577 | Ga0068855_1000095776 | 135 |
| 72 | 3300005563 | Ga0068855_101170462 | Ga0068855_1011704621 | 135 |
| 73 | 3300005614 | Ga0068856_100855256 | Ga0068856_1008552562 | 135 |
| 74 | 3300005616 | Ga0068852_100033979 | Ga0068852_1000339792 | 135 |
| 75 | 3300005616 | Ga0068852_100211064 | Ga0068852_1002110643 | 135 |
| 76 | 3300005616 | Ga0068852_100703126 | Ga0068852_1007031262 | 135 |
| 77 | 3300005842 | Ga0068858_101104430 | Ga0068858_1011044301 | 135 |
| 78 | 3300006173 | Ga0070716_100201247 | Ga0070716_1002012473 | 135 |
| 79 | 3300006237 | Ga0097621_100520515 | Ga0097621_1005205151 | 135 |
| 80 | 3300006353 | Ga0075370_10810541 | Ga0075370_108105411 | 135 |
| 81 | 3300006881 | Ga0068865_100734255 | Ga0068865_1007342551 | 135 |
| 82 | 3300009093 | Ga0105240_10002670 | Ga0105240_1000267017 | 135 |
| 83 | 3300009093 | Ga0105240_10217324 | Ga0105240_102173242 | 135 |
| 84 | 3300009148 | Ga0105243_10757720 | Ga0105243_107577201 | 135 |
| 85 | 3300009174 | Ga0105241_10251515 | Ga0105241_102515153 | 135 |
| 86 | 3300009176 | Ga0105242_11764941 | Ga0105242_117649412 | 135 |
| 87 | 3300011119 | Ga0105246_10467242 | Ga0105246_104672421 | 135 |
| 88 | 3300013104 | Ga0157370_10007858 | Ga0157370_100078587 | 135 |
| 89 | 3300013104 | Ga0157370_10913407 | Ga0157370_109134072 | 135 |
| 90 | 3300013105 | Ga0157369_10001467 | Ga0157369_1000146717 | 135 |
| 91 | 3300013105 | Ga0157369_10469428 | Ga0157369_104694281 | 135 |
| 92 | 3300013105 | Ga0157369_10503819 | Ga0157369_105038192 | 135 |
| 93 | 3300013297 | Ga0157378_11077150 | Ga0157378_110771503 | 135 |
| 94 | 3300013307 | Ga0157372_10784506 | Ga0157372_107845063 | 135 |
| 95 | 3300013307 | Ga0157372_11121154 | Ga0157372_111211542 | 135 |
| 96 | 3300013307 | Ga0157372_11349914 | Ga0157372_113499142 | 135 |
| 97 | 3300013307 | Ga0157372_11422601 | Ga0157372_114226011 | 135 |
| 98 | 3300013307 | Ga0157372_13128586 | Ga0157372_131285861 | 135 |
| 99 | 3300014325 | Ga0163163_10218193 | Ga0163163_102181933 | 135 |
| 100 | 3300014325 | Ga0163163_11449365 | Ga0163163_114493651 | 135 |
| 101 | 3300014326 | Ga0157380_10812066 | Ga0157380_108120662 | 135 |
| 102 | 3300014969 | Ga0157376_10635652 | Ga0157376_106356522 | 135 |
| 103 | 3300014969 | Ga0157376_10784105 | Ga0157376_107841052 | 135 |
| 104 | 3300014969 | Ga0157376_12314130 | Ga0157376_123141301 | 135 |
| 105 | 3300020069 | Ga0197907_10064221 | Ga0197907_100642214 | 135 |
| 106 | 3300020069 | Ga0197907_10381301 | Ga0197907_103813012 | 135 |
| 107 | 3300020069 | Ga0197907_10544001 | Ga0197907_105440012 | 135 |
| 108 | 3300020069 | Ga0197907_10665365 | Ga0197907_106653653 | 135 |
| 109 | 3300020069 | Ga0197907_10788872 | Ga0197907_107888722 | 135 |
| 110 | 3300020070 | Ga0206356_10055854 | Ga0206356_100558548 | 135 |
| 111 | 3300020070 | Ga0206356_10436325 | Ga0206356_104363252 | 135 |
| 112 | 3300020070 | Ga0206356_10711707 | Ga0206356_107117075 | 135 |
| 113 | 3300020070 | Ga0206356_11742728 | Ga0206356_117427282 | 135 |
| 114 | 3300020078 | Ga0206352_10653387 | Ga0206352_106533874 | 135 |
| 115 | 3300020078 | Ga0206352_11096998 | Ga0206352_110969982 | 135 |
| 116 | 3300020080 | Ga0206350_10194576 | Ga0206350_101945763 | 135 |
| 117 | 3300020080 | Ga0206350_11648271 | Ga0206350_116482713 | 135 |
| 118 | 3300020081 | Ga0206354_10539415 | Ga0206354_105394151 | 135 |
| 119 | 3300020081 | Ga0206354_10905345 | Ga0206354_109053451 | 135 |
| 120 | 3300020081 | Ga0206354_11016645 | Ga0206354_110166452 | 135 |
| 121 | 3300020081 | Ga0206354_11694990 | Ga0206354_116949902 | 135 |
| 122 | 3300020082 | Ga0206353_10860423 | Ga0206353_108604233 | 135 |
| 123 | 3300020082 | Ga0206353_11448016 | Ga0206353_114480161 | 135 |
| 124 | 3300022467 | Ga0224712_10040600 | Ga0224712_100406002 | 135 |
| 125 | 3300022467 | Ga0224712_10050374 | Ga0224712_100503742 | 135 |
| 126 | 3300022467 | Ga0224712_10067043 | Ga0224712_100670431 | 135 |
| 127 | 3300022467 | Ga0224712_10069079 | Ga0224712_100690792 | 135 |
| 128 | 3300022467 | Ga0224712_10132543 | Ga0224712_101325432 | 135 |
| 129 | 3300025898 | Ga0207692_10448236 | Ga0207692_104482361 | 135 |
| 130 | 3300025904 | Ga0207647_10026877 | Ga0207647_100268773 | 135 |
| 131 | 3300025909 | Ga0207705_10001318 | Ga0207705_100013189 | 135 |
| 132 | 3300025909 | Ga0207705_10157782 | Ga0207705_101577822 | 135 |
| 133 | 3300025909 | Ga0207705_10983980 | Ga0207705_109839801 | 135 |
| 134 | 3300025910 | Ga0207684_10049264 | Ga0207684_100492642 | 135 |
| 135 | 3300025910 | Ga0207684_10069797 | Ga0207684_100697974 | 135 |
| 136 | 3300025910 | Ga0207684_10075576 | Ga0207684_100755762 | 135 |
| 137 | 3300025911 | Ga0207654_10248518 | Ga0207654_102485182 | 135 |
| 138 | 3300025912 | Ga0207707_10633696 | Ga0207707_106336962 | 135 |
| 139 | 3300025913 | Ga0207695_10067881 | Ga0207695_100678813 | 135 |
| 140 | 3300025917 | Ga0207660_10884333 | Ga0207660_108843332 | 135 |
| 141 | 3300025919 | Ga0207657_10097078 | Ga0207657_100970782 | 135 |
| 142 | 3300025919 | Ga0207657_10125840 | Ga0207657_101258402 | 135 |
| 143 | 3300025920 | Ga0207649_10058052 | Ga0207649_100580523 | 135 |
| 144 | 3300025921 | Ga0207652_10034738 | Ga0207652_100347384 | 135 |
| 145 | 3300025921 | Ga0207652_11094782 | Ga0207652_110947821 | 135 |
| 146 | 3300025922 | Ga0207646_10005100 | Ga0207646_100051002 | 135 |
| 147 | 3300025922 | Ga0207646_10025217 | Ga0207646_100252176 | 135 |
| 148 | 3300025922 | Ga0207646_10049032 | Ga0207646_100490321 | 135 |
| 149 | 3300025922 | Ga0207646_10085897 | Ga0207646_100858974 | 135 |
| 150 | 3300025922 | Ga0207646_11100634 | Ga0207646_111006341 | 135 |
| 151 | 3300025929 | Ga0207664_10269908 | Ga0207664_102699083 | 135 |
| 152 | 3300025929 | Ga0207664_10439227 | Ga0207664_104392272 | 135 |
| 153 | 3300025937 | Ga0207669_11010152 | Ga0207669_110101522 | 135 |
| 154 | 3300025944 | Ga0207661_10053311 | Ga0207661_100533112 | 135 |
| 155 | 3300025944 | Ga0207661_10400752 | Ga0207661_104007522 | 135 |
| 156 | 3300025944 | Ga0207661_10803820 | Ga0207661_108038201 | 135 |
| 157 | 3300025949 | Ga0207667_10017929 | Ga0207667_1001792914 | 135 |
| 158 | 3300026067 | Ga0207678_11822304 | Ga0207678_118223041 | 135 |
| 159 | 3300026078 | Ga0207702_10539873 | Ga0207702_105398732 | 135 |
| 160 | 3300026078 | Ga0207702_11159124 | Ga0207702_111591242 | 135 |
| 161 | 3300026121 | Ga0207683_10260383 | Ga0207683_102603832 | 135 |
| 162 | 3300026142 | Ga0207698_10047610 | Ga0207698_100476106 | 135 |
| 163 | 3300026142 | Ga0207698_10116479 | Ga0207698_101164792 | 135 |
| 164 | 3300028379 | Ga0268266_10762169 | Ga0268266_107621691 | 135 |
| 165 | 3300028381 | Ga0268264_10348594 | Ga0268264_103485942 | 135 |
| 166 | 3300030744 | Ga0316181_1115940 | Ga0316181_11159403 | 135 |
| 167 | 3300030745 | Ga0316182_1160810 | Ga0316182_11608108 | 135 |
| 168 | 3300031240 | Ga0265320_10297523 | Ga0265320_102975231 | 135 |
| 169 | 3300031241 | Ga0265325_10056723 | Ga0265325_100567231 | 135 |
| 170 | 3300031247 | Ga0265340_10011241 | Ga0265340_100112416 | 135 |
| 171 | 3300031247 | Ga0265340_10041866 | Ga0265340_100418662 | 135 |
| 172 | 3300031247 | Ga0265340_10291848 | Ga0265340_102918482 | 135 |
| 173 | 3300031249 | Ga0265339_10155583 | Ga0265339_101555832 | 135 |
| 174 | 3300031344 | Ga0265316_10107171 | Ga0265316_101071715 | 135 |
| 175 | 3300031595 | Ga0265313_10092342 | Ga0265313_100923422 | 135 |
| 176 | 3300031711 | Ga0265314_10100950 | Ga0265314_101009502 | 135 |
| 177 | 3300035725 | Ga0373947_0277441 | Ga0373947_0277441_206_694 | 135 |
| 178 | 3300037418 | Ga0395900_0084638 | Ga0395900_0084638_1596_2036 | 135 |
| 179 | 3300037418 | Ga0395900_0399311 | Ga0395900_0399311_177_659 | 135 |
| 180 | 3300037466 | Ga0395898_0089110 | Ga0395898_0089110_468_950 | 135 |
| 181 | 3300037466 | Ga0395898_1242431 | Ga0395898_1242431_19_459 | 135 |
| 182 | 3300037471 | Ga0395905_0463893 | Ga0395905_0463893_506_946 | 135 |
| 183 | 3300038443 | Ga0395901_0742407 | Ga0395901_0742407_279_719 | 135 |
| 184 | 3300038735 | Ga0400485_08169 | Ga0400485_08169_25316_25792 | 135 |
| 185 | 3300038741 | Ga0400488_51295 | Ga0400488_51295_6310_6807 | 135 |
| 186 | 3300038742 | Ga0400486_03564 | Ga0400486_03564_25306_25782 | 135 |
| 187 | 3300042876 | Ga0451577_0460192 | Ga0451577_0460192_404_844 | 135 |
| 188 | 3300044658 | Ga0466972_0000467 | Ga0466972_0000467_16991_17437 | 135 |
| 189 | 3300044694 | Ga0466963_0162677 | Ga0466963_0162677_466_906 | 135 |
| 190 | 3300044765 | Ga0466970_0199369 | Ga0466970_0199369_385_831 | 135 |
| 191 | 3300044842 | Ga0466957_0431671 | Ga0466957_0431671_95_535 | 135 |
| 192 | 3300045836 | Ga0466958_0274383 | Ga0466958_0274383_397_837 | 135 |
| 193 | 3300045976 | Ga0466967_0043782 | Ga0466967_0043782_3252_3692 | 135 |
| 194 | 3300045976 | Ga0466967_0054980 | Ga0466967_0054980_1262_1714 | 135 |
| 195 | 3300045976 | Ga0466967_0207358 | Ga0466967_0207358_738_1178 | 135 |
| 196 | 3300045976 | Ga0466967_1321875 | Ga0466967_1321875_181_621 | 135 |
| 197 | 3300046459 | Ga0495629_0132089 | Ga0495629_0132089_1113_1556 | 135 |
| 198 | 3300046459 | Ga0495629_0634713 | Ga0495629_0634713_231_683 | 135 |
| 199 | 3300046463 | Ga0495653_0079028 | Ga0495653_0079028_723_1166 | 135 |
| 200 | 3300046501 | Ga0495607_0021701 | Ga0495607_0021701_714_1160 | 135 |
| 201 | 3300046531 | Ga0495665_0223483 | Ga0495665_0223483_257_700 | 135 |
| 202 | 3300046559 | Ga0495667_0285290 | Ga0495667_0285290_397_840 | 135 |
| 203 | 3300046663 | Ga0495635_0179284 | Ga0495635_0179284_688_1131 | 135 |
| 204 | 3300046674 | Ga0495588_0078629 | Ga0495588_0078629_1112_1555 | 135 |
| 205 | 3300046678 | Ga0495599_0418203 | Ga0495599_0418203_97_540 | 135 |
| 206 | 3300046681 | Ga0495647_0248788 | Ga0495647_0248788_184_627 | 135 |
| 207 | 3300046683 | Ga0495658_0294850 | Ga0495658_0294850_219_662 | 135 |
| 208 | 3300047315 | Ga0495581_0524488 | Ga0495581_0524488_121_564 | 135 |
| 209 | 3300047319 | Ga0495674_0361276 | Ga0495674_0361276_587_1030 | 135 |
| 210 | 3300047471 | Ga0495684_0978219 | Ga0495684_0978219_46_489 | 135 |
| 211 | 3300047673 | Ga0495593_0097880 | Ga0495593_0097880_884_1327 | 135 |
| 212 | 3300048089 | Ga0495614_0528290 | Ga0495614_0528290_59_502 | 135 |
| 213 | 3300048905 | Ga0496102_0686222 | Ga0496102_0686222_210_653 | 135 |
| 214 | 3300048907 | Ga0496104_0004123 | Ga0496104_0004123_3889_4332 | 135 |
| 215 | 3300048908 | Ga0496105_0457108 | Ga0496105_0457108_375_818 | 135 |
| 216 | 3300048911 | Ga0496108_0002443 | Ga0496108_0002443_13674_14117 | 135 |
| 217 | 3300048912 | Ga0496109_0087981 | Ga0496109_0087981_2178_2618 | 135 |
| 218 | 3300048912 | Ga0496109_0717416 | Ga0496109_0717416_376_819 | 135 |
| 219 | 3300048913 | Ga0496110_0004143 | Ga0496110_0004143_1937_2380 | 135 |
| 220 | 3300048914 | Ga0496111_0000712 | Ga0496111_0000712_11934_12377 | 135 |
| 221 | 3300048917 | Ga0496114_0097964 | Ga0496114_0097964_1350_1793 | 135 |
| 222 | 3300048917 | Ga0496114_0171645 | Ga0496114_0171645_169_612 | 135 |
| 223 | 3300048918 | Ga0496115_0269262 | Ga0496115_0269262_291_731 | 135 |
| 224 | 3300048918 | Ga0496115_0402402 | Ga0496115_0402402_229_672 | 135 |
| 225 | 3300048927 | Ga0496124_0528561 | Ga0496124_0528561_319_762 | 135 |
| 226 | 3300048929 | Ga0496126_0041790 | Ga0496126_0041790_707_1177 | 135 |
| 227 | 3300049569 | Ga0501032_0205482 | Ga0501032_0205482_242_682 | 135 |
| 228 | 3300049578 | Ga0501042_0007737 | Ga0501042_0007737_5502_5996 | 135 |
| 229 | 3300049579 | Ga0501043_0419364 | Ga0501043_0419364_120_560 | 135 |
| 230 | 3300049586 | Ga0501070_0006424 | Ga0501070_0006424_7834_8274 | 135 |
| 231 | 3300049586 | Ga0501070_0013575 | Ga0501070_0013575_1857_2297 | 135 |
| 232 | 3300049589 | Ga0501073_0249815 | Ga0501073_0249815_715_1155 | 135 |
| 233 | 3300049590 | Ga0501074_0003938 | Ga0501074_0003938_6999_7439 | 135 |
| 234 | 3300049590 | Ga0501074_0308078 | Ga0501074_0308078_424_924 | 135 |
| 235 | 3300049741 | Ga0501079_0001234 | Ga0501079_0001234_10988_11428 | 135 |
| 236 | 3300049742 | Ga0501080_0040761 | Ga0501080_0040761_131_571 | 135 |
| 237 | 3300049742 | Ga0501080_0102198 | Ga0501080_0102198_1378_1818 | 135 |
| 238 | 3300049823 | Ga0501044_0476818 | Ga0501044_0476818_518_958 | 135 |
| 239 | 3300054114 | Ga0501084_0144319 | Ga0501084_0144319_592_1032 | 135 |
| 240 | 3300059424 | Ga0590075_032288 | Ga0590075_032288_500_955 | 135 |
| 241 | 3300059630 | Ga0587128_089023 | Ga0587128_089023_150_590 | 135 |
| 242 | 3300059645 | Ga0587076_168208 | Ga0587076_168208_61_501 | 135 |
| 243 | 3300061719 | Ga0466962_0412726 | Ga0466962_0412726_224_664 | 135 |
| 244 | iso_pu_bacteria | 2506783011 | 2506868507 | 135 |
| 245 | iso_pu_bacteria | 2671180195 | 2671835725 | 135 |
| 246 | iso_pu_bacteria | 2684623035 | 2686539262 | 135 |
| 247 | iso_pu_bacteria | 2773857922 | 2774853881 | 135 |
| 248 | iso_pu_bacteria | 2773857933 | 2774902888 | 135 |
| 249 | iso_pu_bacteria | 2895880812 | 2895884593 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1p90-assembly1.cif.gz_A | the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution | 0.8715 | 112 | 134 |
| 6th6-assembly1.cif.gz_BR | cryo-em structure of t. kodakarensis 70s ribosome | 0.8306 | 57 | 135 |
| 1w2b-assembly1.cif.gz_N | trigger factor ribosome binding domain in complex with 50s | 0.8027 | 63 | 133 |
| 8hl5-assembly1.cif.gz_L18E | cryo-em structures and translocation mechanism of crenarchaeota ribosome | 0.7692 | 66 | 135 |
| 6zu5-assembly1.cif.gz_LQ0 | structure of the paranosema locustae ribosome in complex with lso2 | 0.7604 | 65 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5v7qL01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9624 | 63 | 133 | 3.100.10.10 |
| 5v7qL01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9371 | 63 | 133 | 3.100.10.10 |
| af_P0A0F8_66_146_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9175 | 55 | 135 | 3.100.10.10 |
| af_P54022_5_121_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9142 | 63 | 135 | 3.100.10.10 |
| 4qjsP01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9085 | 63 | 135 | 3.100.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3F858-F1-model_v4 | 50S ribosomal protein L15 | 1.001 | 57 | 135 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7K0Z8M8-F1-model_v4 | 50S ribosomal protein L15 | 0.9892 | 56 | 135 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7K0NA90-F1-model_v4 | 50S ribosomal protein L15 | 0.9821 | 80 | 135 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7K0Z8M8-F1-model_v4 | 50S ribosomal protein L15 | 0.977 | 56 | 135 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A6B3F858-F1-model_v4 | 50S ribosomal protein L15 | 0.976 | 57 | 135 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar