F360837

General Info

Members Datasets Scaffolds Average Seq Length
249 169 232 152

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10297523|Ga0265320_102975231
Length 173
Sequence MADTTGTTSKPKKTAATAEPETTPRAAGVLKVHHLRPAPGSHKPKTRVGRGEASKGKTAGRGTKGTKARYQVPERFEGGQMPLHMRLPKLKGFTNRFRTEYQVVNLEWIAAHYPKGGAVTPDDLVAKGAVRKGELVKVLGDGEIGVKLQVSAHGFSASAKDKIEAAGGSATKL

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2671180195 Frankia sp. CcI49 Isolate Nodule
3 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
4 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
5 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
6 2773857922 Frankia sp. CcI49 Isolate Nodule
7 2773857933 Frankia sp. BMG5.30 Isolate Nodule
8 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
9 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
10 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
11 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
12 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
13 2891562705 Microbispora tritici MT50 Isolate Unclassified
14 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
15 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
16 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
17 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
93 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
113 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
114 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
115 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.31
Metatranscriptomes 14.86
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 1.61
Rhizoplane 5.22
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 6.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 bgg_mtDRAFT_1030866 3300000305 Bacteria 1488
2 JGI24735J21928_10013080 3300002067 Bacteria 2614
3 Ga0070658_10877974 3300005327 Bacteria 780
4 Ga0070658_10879887 3300005327 Bacteria 779
5 Ga0070683_100107256 3300005329 Bacteria 2633
6 Ga0070677_10467306 3300005333 Bacteria 678
7 Ga0070680_100141101 3300005336 Bacteria 2020
8 Ga0070682_100757059 3300005337 Bacteria 785
9 Ga0070660_100108402 3300005339 Bacteria 2207
10 Ga0070660_100175526 3300005339 Bacteria 1733
11 Ga0070660_100603824 3300005339 Bacteria 917
12 Ga0070661_101014252 3300005344 Bacteria 689
13 Ga0070709_10087554 3300005434 Bacteria 2047
14 Ga0070714_100260417 3300005435 Bacteria 1606
15 Ga0070714_101054392 3300005435 Bacteria 792
16 Ga0070714_101159287 3300005435 Bacteria 754
17 Ga0070710_10000376 3300005437 Bacteria 20895
18 Ga0070708_100341306 3300005445 Bacteria 1411
19 Ga0070678_100626317 3300005456 Bacteria 963
20 Ga0070678_100736456 3300005456 Bacteria 891
21 Ga0070681_10236229 3300005458 Bacteria 1742
22 Ga0070681_10459072 3300005458 Bacteria 1186
23 Ga0070706_100015860 3300005467 Bacteria 6955
24 Ga0070706_100353481 3300005467 Bacteria 1369
25 Ga0070706_101052626 3300005467 Bacteria 750
26 Ga0070707_100046095 3300005468 Bacteria 4171
27 Ga0070707_100070399 3300005468 Bacteria 3369
28 Ga0070707_100136467 3300005468 Bacteria 2387
29 Ga0070707_100276465 3300005468 Bacteria 1632
30 Ga0070698_100112103 3300005471 Bacteria 2693
31 Ga0070679_100283199 3300005530 Bacteria 1610
32 Ga0070679_100739466 3300005530 Bacteria 926
33 Ga0070679_101036258 3300005530 Bacteria 765
34 Ga0070684_100182097 3300005535 Bacteria 1910
35 Ga0070684_101559924 3300005535 Bacteria 623
36 Ga0070686_100167961 3300005544 Bacteria 1550
37 Ga0068855_100009577 3300005563 Bacteria 11689
38 Ga0068855_101170462 3300005563 Bacteria 801
39 Ga0068856_100855256 3300005614 Bacteria 929
40 Ga0068852_100033979 3300005616 Bacteria 4241
41 Ga0068852_100211064 3300005616 Bacteria 1842
42 Ga0068852_100703126 3300005616 Bacteria 1021
43 Ga0068858_100000010 3300005842 Bacteria 234748
44 Ga0068858_101104430 3300005842 Bacteria 779
45 Ga0070716_100201247 3300006173 Bacteria 1324
46 Ga0097621_100520515 3300006237 Bacteria 1080
47 Ga0075370_10810541 3300006353 Bacteria 571
48 Ga0068865_100734255 3300006881 Bacteria 847
49 Ga0105240_10002670 3300009093 Bacteria 28391
50 Ga0105240_10217324 3300009093 Bacteria 2229
51 Ga0105247_10000616 3300009101 Bacteria 28650
52 Ga0105243_10757720 3300009148 Bacteria 952
53 Ga0105241_10251515 3300009174 Bacteria 1498
54 Ga0105242_11764941 3300009176 Bacteria 656
55 Ga0105246_10467242 3300011119 Bacteria 1064
56 Ga0157370_10007858 3300013104 Bacteria 11558
57 Ga0157370_10913407 3300013104 Bacteria 796
58 Ga0157369_10001467 3300013105 Bacteria 28921
59 Ga0157369_10469428 3300013105 Bacteria 1303
60 Ga0157369_10503819 3300013105 Bacteria 1252
61 Ga0157378_11077150 3300013297 Bacteria 840
62 Ga0157372_10784506 3300013307 Bacteria 1107
63 Ga0157372_11121154 3300013307 Bacteria 910
64 Ga0157372_11349914 3300013307 Bacteria 822
65 Ga0157372_11422601 3300013307 Bacteria 799
66 Ga0157372_13128586 3300013307 Bacteria 528
67 Ga0163163_10218193 3300014325 Bacteria 1956
68 Ga0163163_11449365 3300014325 Bacteria 748
69 Ga0157380_10812066 3300014326 Bacteria 953
70 Ga0157379_10009461 3300014968 Bacteria 8492
71 Ga0157376_10635652 3300014969 Bacteria 1066
72 Ga0157376_10784105 3300014969 Bacteria 965
73 Ga0157376_12314130 3300014969 Bacteria 577
74 Ga0197907_10064221 3300020069 Bacteria 3965
75 Ga0197907_10381301 3300020069 Bacteria 1103
76 Ga0197907_10544001 3300020069 Bacteria 1364
77 Ga0197907_10665365 3300020069 Bacteria 1656
78 Ga0197907_10788872 3300020069 Bacteria 1442
79 Ga0206356_10055854 3300020070 Bacteria 4191
80 Ga0206356_10436325 3300020070 Bacteria 1244
81 Ga0206356_10711707 3300020070 Bacteria 2770
82 Ga0206356_11742728 3300020070 Bacteria 1775
83 Ga0206352_10653387 3300020078 Bacteria 5763
84 Ga0206352_11096998 3300020078 Bacteria 1516
85 Ga0206350_10194576 3300020080 Bacteria 2907
86 Ga0206350_11648271 3300020080 Bacteria 1865
87 Ga0206354_10539415 3300020081 Bacteria 674
88 Ga0206354_10905345 3300020081 Bacteria 507
89 Ga0206354_11016645 3300020081 Bacteria 2550
90 Ga0206354_11694990 3300020081 Bacteria 712
91 Ga0206353_10860423 3300020082 Bacteria 1640
92 Ga0206353_11448016 3300020082 Bacteria 509
93 Ga0224712_10040600 3300022467 Bacteria 1752
94 Ga0224712_10050374 3300022467 Bacteria 1617
95 Ga0224712_10067043 3300022467 Bacteria 1447
96 Ga0224712_10069079 3300022467 Bacteria 1429
97 Ga0224712_10132543 3300022467 Bacteria 1089
98 Ga0224712_10144111 3300022467 Bacteria 1051
99 Ga0207692_10448236 3300025898 Bacteria 812
100 Ga0207710_10000048 3300025900 Bacteria 189597
101 Ga0207647_10026877 3300025904 Bacteria 3759
102 Ga0207705_10001318 3300025909 Bacteria 19884
103 Ga0207705_10157782 3300025909 Bacteria 1703
104 Ga0207705_10983980 3300025909 Bacteria 652
105 Ga0207684_10049264 3300025910 Bacteria 3574
106 Ga0207684_10069797 3300025910 Bacteria 2986
107 Ga0207684_10075576 3300025910 Bacteria 2863
108 Ga0207654_10248518 3300025911 Bacteria 1191
109 Ga0207707_10633696 3300025912 Bacteria 902
110 Ga0207695_10067881 3300025913 Bacteria 3656
111 Ga0207660_10884333 3300025917 Bacteria 729
112 Ga0207657_10097078 3300025919 Bacteria 2450
113 Ga0207657_10125840 3300025919 Bacteria 2105
114 Ga0207649_10058052 3300025920 Bacteria 2422
115 Ga0207652_10034738 3300025921 Bacteria 4251
116 Ga0207652_11094782 3300025921 Bacteria 697
117 Ga0207646_10005100 3300025922 Bacteria 13929
118 Ga0207646_10025217 3300025922 Bacteria 5441
119 Ga0207646_10049032 3300025922 Bacteria 3783
120 Ga0207646_10085897 3300025922 Bacteria 2814
121 Ga0207646_11100634 3300025922 Bacteria 699
122 Ga0207664_10269908 3300025929 Bacteria 1490
123 Ga0207664_10439227 3300025929 Bacteria 1164
124 Ga0207669_11010152 3300025937 Bacteria 699
125 Ga0207661_10053311 3300025944 Bacteria 3236
126 Ga0207661_10400752 3300025944 Bacteria 1244
127 Ga0207661_10803820 3300025944 Bacteria 866
128 Ga0207667_10017929 3300025949 Bacteria 7956
129 Ga0207703_10000002 3300026035 Bacteria 600711
130 Ga0207678_11822304 3300026067 Bacteria 532
131 Ga0207702_10539873 3300026078 Bacteria 1140
132 Ga0207702_11159124 3300026078 Bacteria 767
133 Ga0207683_10260383 3300026121 Bacteria 1584
134 Ga0207698_10047610 3300026142 Bacteria 3250
135 Ga0207698_10116479 3300026142 Bacteria 2252
136 Ga0268266_10762169 3300028379 Bacteria 934
137 Ga0268264_10348594 3300028381 Bacteria 1409
138 Ga0316181_1115940 3300030744 Bacteria 1364
139 Ga0316182_1160810 3300030745 Bacteria 4679
140 Ga0265762_1028034 3300030760 Bacteria 1059
141 Ga0265767_105877 3300030836 Bacteria 753
142 Ga0265777_112286 3300030877 Bacteria 644
143 Ga0265776_102973 3300030880 Bacteria 806
144 Ga0265764_106359 3300030882 Bacteria 678
145 Ga0265761_100952 3300030889 Bacteria 1204
146 Ga0265320_10297523 3300031240 Bacteria 714
147 Ga0265325_10056723 3300031241 Bacteria 1999
148 Ga0265340_10011241 3300031247 Bacteria 4766
149 Ga0265340_10041866 3300031247 Bacteria 2250
150 Ga0265340_10291848 3300031247 Bacteria 724
151 Ga0265339_10155583 3300031249 Bacteria 1153
152 Ga0265316_10107171 3300031344 Bacteria 2119
153 Ga0265313_10092342 3300031595 Bacteria 1356
154 Ga0310103_108965 3300031614 Bacteria 1351
155 Ga0265314_10100950 3300031711 Bacteria 1855
156 Ga0373947_0277441 3300035725 Bacteria 1114
157 Ga0395900_0084638 3300037418 Bacteria 3259
158 Ga0395900_0399311 3300037418 Bacteria 1339
159 Ga0395898_0089110 3300037466 Bacteria 2969
160 Ga0395898_1242431 3300037466 Bacteria 675
161 Ga0395905_0463893 3300037471 Bacteria 1165
162 Ga0395901_0742407 3300038443 Bacteria 975
163 Ga0400485_08169 3300038735 Bacteria 55719
164 Ga0400488_51295 3300038741 Bacteria 9736
165 Ga0400486_03564 3300038742 Bacteria 38786
166 Ga0439461_0039288 3300041410 Bacteria 1017
167 Ga0439445_0083218 3300042004 Bacteria 896
168 Ga0439434_0005739 3300042435 Bacteria 3623
169 Ga0451577_0460192 3300042876 Bacteria 1155
170 Ga0466972_0000467 3300044658 Bacteria 20502
171 Ga0466963_0162677 3300044694 Bacteria 1554
172 Ga0466970_0199369 3300044765 Bacteria 1113
173 Ga0466957_0431671 3300044842 Bacteria 905
174 Ga0466958_0274383 3300045836 Bacteria 1080
175 Ga0466967_0043782 3300045976 Bacteria 3878
176 Ga0466967_0054980 3300045976 Bacteria 3506
177 Ga0466967_0207358 3300045976 Bacteria 1858
178 Ga0466967_1321875 3300045976 Bacteria 718
179 Ga0495629_0132089 3300046459 Bacteria 1739
180 Ga0495629_0634713 3300046459 Bacteria 713
181 Ga0495653_0079028 3300046463 Bacteria 2438
182 Ga0495607_0021701 3300046501 Bacteria 4038
183 Ga0495665_0223483 3300046531 Bacteria 973
184 Ga0495667_0285290 3300046559 Bacteria 1048
185 Ga0495635_0179284 3300046663 Bacteria 1440
186 Ga0495588_0078629 3300046674 Bacteria 1721
187 Ga0495599_0418203 3300046678 Bacteria 797
188 Ga0495647_0248788 3300046681 Bacteria 791
189 Ga0495658_0294850 3300046683 Bacteria 1025
190 Ga0495581_0524488 3300047315 Bacteria 688
191 Ga0495674_0361276 3300047319 Bacteria 1177
192 Ga0495684_0978219 3300047471 Bacteria 539
193 Ga0495593_0097880 3300047673 Bacteria 1507
194 Ga0495614_0528290 3300048089 Bacteria 563
195 Ga0496102_0686222 3300048905 Bacteria 947
196 Ga0496102_1260706 3300048905 Bacteria 658
197 Ga0496104_0004123 3300048907 Bacteria 12619
198 Ga0496105_0457108 3300048908 Bacteria 1007
199 Ga0496108_0002443 3300048911 Bacteria 14848
200 Ga0496109_0087981 3300048912 Bacteria 2870
201 Ga0496109_0717416 3300048912 Bacteria 937
202 Ga0496110_0004143 3300048913 Bacteria 11207
203 Ga0496111_0000712 3300048914 Bacteria 17656
204 Ga0496114_0097964 3300048917 Bacteria 2499
205 Ga0496114_0171645 3300048917 Bacteria 1890
206 Ga0496115_0269262 3300048918 Bacteria 1400
207 Ga0496115_0402402 3300048918 Bacteria 1111
208 Ga0496119_0013889 3300048922 Bacteria 6356
209 Ga0496121_0017835 3300048924 Bacteria 7209
210 Ga0496124_0528561 3300048927 Bacteria 784
211 Ga0496126_0041790 3300048929 Bacteria 4240
212 Ga0501318_036332 3300049534 Bacteria 689
213 Ga0501032_0205482 3300049569 Bacteria 1285
214 Ga0501042_0007737 3300049578 Bacteria 7059
215 Ga0501043_0419364 3300049579 Bacteria 1009
216 Ga0501070_0006424 3300049586 Bacteria 10005
217 Ga0501070_0013575 3300049586 Bacteria 6866
218 Ga0501070_0018699 3300049586 Bacteria 5813
219 Ga0501073_0249815 3300049589 Bacteria 1224
220 Ga0501074_0003938 3300049590 Bacteria 10580
221 Ga0501074_0308078 3300049590 Bacteria 1125
222 Ga0501079_0001234 3300049741 Bacteria 17906
223 Ga0501080_0040761 3300049742 Bacteria 4330
224 Ga0501080_0072771 3300049742 Bacteria 3198
225 Ga0501080_0102198 3300049742 Bacteria 2659
226 Ga0501044_0476818 3300049823 Bacteria 1151
227 Ga0501084_0144319 3300054114 Bacteria 2005
228 Ga0590075_032288 3300059424 Bacteria 1328
229 Ga0587080_082575 3300059503 Bacteria 662
230 Ga0587128_089023 3300059630 Bacteria 630
231 Ga0587076_168208 3300059645 Bacteria 544
232 Ga0466962_0412726 3300061719 Bacteria 677

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049534 Ga0501318_036332 Ga0501318_036332_74_577 128
2 iso_pu_bacteria 2744054611 2744956974 131
3 iso_pu_bacteria 8047710418 8047717762 131
4 3300005333 Ga0070677_10467306 Ga0070677_104673061 133
5 3300049586 Ga0501070_0018699 Ga0501070_0018699_478_915 133
6 3300049742 Ga0501080_0072771 Ga0501080_0072771_1985_2422 133
7 iso_pu_bacteria 2675903060 2676494473 133
8 iso_pu_bacteria 2856741275 2856746616 133
9 iso_pu_bacteria 2873314349 2873322128 133
10 iso_pu_bacteria 2884693830 2884694832 133
11 iso_pu_bacteria 2891395885 2891401903 133
12 iso_pu_bacteria 2891554331 2891560644 133
13 iso_pu_bacteria 2891562705 2891566108 133
14 iso_pu_bacteria 2895427314 2895432689 133
15 iso_pu_bacteria 2895442618 2895446472 133
16 3300005544 Ga0070686_100167961 Ga0070686_1001679613 134
17 3300005842 Ga0068858_100000010 Ga0068858_100000010147 134
18 3300009101 Ga0105247_10000616 Ga0105247_100006167 134
19 3300014968 Ga0157379_10009461 Ga0157379_1000946110 134
20 3300022467 Ga0224712_10144111 Ga0224712_101441111 134
21 3300025900 Ga0207710_10000048 Ga0207710_1000004816 134
22 3300026035 Ga0207703_10000002 Ga0207703_10000002124 134
23 3300030760 Ga0265762_1028034 Ga0265762_10280342 134
24 3300030836 Ga0265767_105877 Ga0265767_1058771 134
25 3300030877 Ga0265777_112286 Ga0265777_1122861 134
26 3300030880 Ga0265776_102973 Ga0265776_1029733 134
27 3300030882 Ga0265764_106359 Ga0265764_1063592 134
28 3300030889 Ga0265761_100952 Ga0265761_1009522 134
29 3300031614 Ga0310103_108965 Ga0310103_1089652 134
30 3300041410 Ga0439461_0039288 Ga0439461_0039288_510_956 134
31 3300042004 Ga0439445_0083218 Ga0439445_0083218_92_535 134
32 3300042435 Ga0439434_0005739 Ga0439434_0005739_170_613 134
33 3300048905 Ga0496102_1260706 Ga0496102_1260706_50_544 134
34 3300048922 Ga0496119_0013889 Ga0496119_0013889_1305_1799 134
35 3300048924 Ga0496121_0017835 Ga0496121_0017835_1775_2269 134
36 3300059503 Ga0587080_082575 Ga0587080_082575_44_544 134
37 3300000305 bgg_mtDRAFT_1030866 bgg_mtDRAFT_10308664 135
38 3300002067 JGI24735J21928_10013080 JGI24735J21928_100130803 135
39 3300005327 Ga0070658_10877974 Ga0070658_108779741 135
40 3300005327 Ga0070658_10879887 Ga0070658_108798872 135
41 3300005329 Ga0070683_100107256 Ga0070683_1001072562 135
42 3300005336 Ga0070680_100141101 Ga0070680_1001411011 135
43 3300005337 Ga0070682_100757059 Ga0070682_1007570593 135
44 3300005339 Ga0070660_100108402 Ga0070660_1001084024 135
45 3300005339 Ga0070660_100175526 Ga0070660_1001755261 135
46 3300005339 Ga0070660_100603824 Ga0070660_1006038242 135
47 3300005344 Ga0070661_101014252 Ga0070661_1010142521 135
48 3300005434 Ga0070709_10087554 Ga0070709_100875543 135
49 3300005435 Ga0070714_100260417 Ga0070714_1002604172 135
50 3300005435 Ga0070714_101054392 Ga0070714_1010543921 135
51 3300005435 Ga0070714_101159287 Ga0070714_1011592872 135
52 3300005437 Ga0070710_10000376 Ga0070710_100003761 135
53 3300005445 Ga0070708_100341306 Ga0070708_1003413063 135
54 3300005456 Ga0070678_100626317 Ga0070678_1006263173 135
55 3300005456 Ga0070678_100736456 Ga0070678_1007364561 135
56 3300005458 Ga0070681_10236229 Ga0070681_102362291 135
57 3300005458 Ga0070681_10459072 Ga0070681_104590722 135
58 3300005467 Ga0070706_100015860 Ga0070706_1000158602 135
59 3300005467 Ga0070706_100353481 Ga0070706_1003534812 135
60 3300005467 Ga0070706_101052626 Ga0070706_1010526261 135
61 3300005468 Ga0070707_100046095 Ga0070707_1000460952 135
62 3300005468 Ga0070707_100070399 Ga0070707_1000703993 135
63 3300005468 Ga0070707_100136467 Ga0070707_1001364675 135
64 3300005468 Ga0070707_100276465 Ga0070707_1002764653 135
65 3300005471 Ga0070698_100112103 Ga0070698_1001121031 135
66 3300005530 Ga0070679_100283199 Ga0070679_1002831993 135
67 3300005530 Ga0070679_100739466 Ga0070679_1007394662 135
68 3300005530 Ga0070679_101036258 Ga0070679_1010362582 135
69 3300005535 Ga0070684_100182097 Ga0070684_1001820973 135
70 3300005535 Ga0070684_101559924 Ga0070684_1015599241 135
71 3300005563 Ga0068855_100009577 Ga0068855_1000095776 135
72 3300005563 Ga0068855_101170462 Ga0068855_1011704621 135
73 3300005614 Ga0068856_100855256 Ga0068856_1008552562 135
74 3300005616 Ga0068852_100033979 Ga0068852_1000339792 135
75 3300005616 Ga0068852_100211064 Ga0068852_1002110643 135
76 3300005616 Ga0068852_100703126 Ga0068852_1007031262 135
77 3300005842 Ga0068858_101104430 Ga0068858_1011044301 135
78 3300006173 Ga0070716_100201247 Ga0070716_1002012473 135
79 3300006237 Ga0097621_100520515 Ga0097621_1005205151 135
80 3300006353 Ga0075370_10810541 Ga0075370_108105411 135
81 3300006881 Ga0068865_100734255 Ga0068865_1007342551 135
82 3300009093 Ga0105240_10002670 Ga0105240_1000267017 135
83 3300009093 Ga0105240_10217324 Ga0105240_102173242 135
84 3300009148 Ga0105243_10757720 Ga0105243_107577201 135
85 3300009174 Ga0105241_10251515 Ga0105241_102515153 135
86 3300009176 Ga0105242_11764941 Ga0105242_117649412 135
87 3300011119 Ga0105246_10467242 Ga0105246_104672421 135
88 3300013104 Ga0157370_10007858 Ga0157370_100078587 135
89 3300013104 Ga0157370_10913407 Ga0157370_109134072 135
90 3300013105 Ga0157369_10001467 Ga0157369_1000146717 135
91 3300013105 Ga0157369_10469428 Ga0157369_104694281 135
92 3300013105 Ga0157369_10503819 Ga0157369_105038192 135
93 3300013297 Ga0157378_11077150 Ga0157378_110771503 135
94 3300013307 Ga0157372_10784506 Ga0157372_107845063 135
95 3300013307 Ga0157372_11121154 Ga0157372_111211542 135
96 3300013307 Ga0157372_11349914 Ga0157372_113499142 135
97 3300013307 Ga0157372_11422601 Ga0157372_114226011 135
98 3300013307 Ga0157372_13128586 Ga0157372_131285861 135
99 3300014325 Ga0163163_10218193 Ga0163163_102181933 135
100 3300014325 Ga0163163_11449365 Ga0163163_114493651 135
101 3300014326 Ga0157380_10812066 Ga0157380_108120662 135
102 3300014969 Ga0157376_10635652 Ga0157376_106356522 135
103 3300014969 Ga0157376_10784105 Ga0157376_107841052 135
104 3300014969 Ga0157376_12314130 Ga0157376_123141301 135
105 3300020069 Ga0197907_10064221 Ga0197907_100642214 135
106 3300020069 Ga0197907_10381301 Ga0197907_103813012 135
107 3300020069 Ga0197907_10544001 Ga0197907_105440012 135
108 3300020069 Ga0197907_10665365 Ga0197907_106653653 135
109 3300020069 Ga0197907_10788872 Ga0197907_107888722 135
110 3300020070 Ga0206356_10055854 Ga0206356_100558548 135
111 3300020070 Ga0206356_10436325 Ga0206356_104363252 135
112 3300020070 Ga0206356_10711707 Ga0206356_107117075 135
113 3300020070 Ga0206356_11742728 Ga0206356_117427282 135
114 3300020078 Ga0206352_10653387 Ga0206352_106533874 135
115 3300020078 Ga0206352_11096998 Ga0206352_110969982 135
116 3300020080 Ga0206350_10194576 Ga0206350_101945763 135
117 3300020080 Ga0206350_11648271 Ga0206350_116482713 135
118 3300020081 Ga0206354_10539415 Ga0206354_105394151 135
119 3300020081 Ga0206354_10905345 Ga0206354_109053451 135
120 3300020081 Ga0206354_11016645 Ga0206354_110166452 135
121 3300020081 Ga0206354_11694990 Ga0206354_116949902 135
122 3300020082 Ga0206353_10860423 Ga0206353_108604233 135
123 3300020082 Ga0206353_11448016 Ga0206353_114480161 135
124 3300022467 Ga0224712_10040600 Ga0224712_100406002 135
125 3300022467 Ga0224712_10050374 Ga0224712_100503742 135
126 3300022467 Ga0224712_10067043 Ga0224712_100670431 135
127 3300022467 Ga0224712_10069079 Ga0224712_100690792 135
128 3300022467 Ga0224712_10132543 Ga0224712_101325432 135
129 3300025898 Ga0207692_10448236 Ga0207692_104482361 135
130 3300025904 Ga0207647_10026877 Ga0207647_100268773 135
131 3300025909 Ga0207705_10001318 Ga0207705_100013189 135
132 3300025909 Ga0207705_10157782 Ga0207705_101577822 135
133 3300025909 Ga0207705_10983980 Ga0207705_109839801 135
134 3300025910 Ga0207684_10049264 Ga0207684_100492642 135
135 3300025910 Ga0207684_10069797 Ga0207684_100697974 135
136 3300025910 Ga0207684_10075576 Ga0207684_100755762 135
137 3300025911 Ga0207654_10248518 Ga0207654_102485182 135
138 3300025912 Ga0207707_10633696 Ga0207707_106336962 135
139 3300025913 Ga0207695_10067881 Ga0207695_100678813 135
140 3300025917 Ga0207660_10884333 Ga0207660_108843332 135
141 3300025919 Ga0207657_10097078 Ga0207657_100970782 135
142 3300025919 Ga0207657_10125840 Ga0207657_101258402 135
143 3300025920 Ga0207649_10058052 Ga0207649_100580523 135
144 3300025921 Ga0207652_10034738 Ga0207652_100347384 135
145 3300025921 Ga0207652_11094782 Ga0207652_110947821 135
146 3300025922 Ga0207646_10005100 Ga0207646_100051002 135
147 3300025922 Ga0207646_10025217 Ga0207646_100252176 135
148 3300025922 Ga0207646_10049032 Ga0207646_100490321 135
149 3300025922 Ga0207646_10085897 Ga0207646_100858974 135
150 3300025922 Ga0207646_11100634 Ga0207646_111006341 135
151 3300025929 Ga0207664_10269908 Ga0207664_102699083 135
152 3300025929 Ga0207664_10439227 Ga0207664_104392272 135
153 3300025937 Ga0207669_11010152 Ga0207669_110101522 135
154 3300025944 Ga0207661_10053311 Ga0207661_100533112 135
155 3300025944 Ga0207661_10400752 Ga0207661_104007522 135
156 3300025944 Ga0207661_10803820 Ga0207661_108038201 135
157 3300025949 Ga0207667_10017929 Ga0207667_1001792914 135
158 3300026067 Ga0207678_11822304 Ga0207678_118223041 135
159 3300026078 Ga0207702_10539873 Ga0207702_105398732 135
160 3300026078 Ga0207702_11159124 Ga0207702_111591242 135
161 3300026121 Ga0207683_10260383 Ga0207683_102603832 135
162 3300026142 Ga0207698_10047610 Ga0207698_100476106 135
163 3300026142 Ga0207698_10116479 Ga0207698_101164792 135
164 3300028379 Ga0268266_10762169 Ga0268266_107621691 135
165 3300028381 Ga0268264_10348594 Ga0268264_103485942 135
166 3300030744 Ga0316181_1115940 Ga0316181_11159403 135
167 3300030745 Ga0316182_1160810 Ga0316182_11608108 135
168 3300031240 Ga0265320_10297523 Ga0265320_102975231 135
169 3300031241 Ga0265325_10056723 Ga0265325_100567231 135
170 3300031247 Ga0265340_10011241 Ga0265340_100112416 135
171 3300031247 Ga0265340_10041866 Ga0265340_100418662 135
172 3300031247 Ga0265340_10291848 Ga0265340_102918482 135
173 3300031249 Ga0265339_10155583 Ga0265339_101555832 135
174 3300031344 Ga0265316_10107171 Ga0265316_101071715 135
175 3300031595 Ga0265313_10092342 Ga0265313_100923422 135
176 3300031711 Ga0265314_10100950 Ga0265314_101009502 135
177 3300035725 Ga0373947_0277441 Ga0373947_0277441_206_694 135
178 3300037418 Ga0395900_0084638 Ga0395900_0084638_1596_2036 135
179 3300037418 Ga0395900_0399311 Ga0395900_0399311_177_659 135
180 3300037466 Ga0395898_0089110 Ga0395898_0089110_468_950 135
181 3300037466 Ga0395898_1242431 Ga0395898_1242431_19_459 135
182 3300037471 Ga0395905_0463893 Ga0395905_0463893_506_946 135
183 3300038443 Ga0395901_0742407 Ga0395901_0742407_279_719 135
184 3300038735 Ga0400485_08169 Ga0400485_08169_25316_25792 135
185 3300038741 Ga0400488_51295 Ga0400488_51295_6310_6807 135
186 3300038742 Ga0400486_03564 Ga0400486_03564_25306_25782 135
187 3300042876 Ga0451577_0460192 Ga0451577_0460192_404_844 135
188 3300044658 Ga0466972_0000467 Ga0466972_0000467_16991_17437 135
189 3300044694 Ga0466963_0162677 Ga0466963_0162677_466_906 135
190 3300044765 Ga0466970_0199369 Ga0466970_0199369_385_831 135
191 3300044842 Ga0466957_0431671 Ga0466957_0431671_95_535 135
192 3300045836 Ga0466958_0274383 Ga0466958_0274383_397_837 135
193 3300045976 Ga0466967_0043782 Ga0466967_0043782_3252_3692 135
194 3300045976 Ga0466967_0054980 Ga0466967_0054980_1262_1714 135
195 3300045976 Ga0466967_0207358 Ga0466967_0207358_738_1178 135
196 3300045976 Ga0466967_1321875 Ga0466967_1321875_181_621 135
197 3300046459 Ga0495629_0132089 Ga0495629_0132089_1113_1556 135
198 3300046459 Ga0495629_0634713 Ga0495629_0634713_231_683 135
199 3300046463 Ga0495653_0079028 Ga0495653_0079028_723_1166 135
200 3300046501 Ga0495607_0021701 Ga0495607_0021701_714_1160 135
201 3300046531 Ga0495665_0223483 Ga0495665_0223483_257_700 135
202 3300046559 Ga0495667_0285290 Ga0495667_0285290_397_840 135
203 3300046663 Ga0495635_0179284 Ga0495635_0179284_688_1131 135
204 3300046674 Ga0495588_0078629 Ga0495588_0078629_1112_1555 135
205 3300046678 Ga0495599_0418203 Ga0495599_0418203_97_540 135
206 3300046681 Ga0495647_0248788 Ga0495647_0248788_184_627 135
207 3300046683 Ga0495658_0294850 Ga0495658_0294850_219_662 135
208 3300047315 Ga0495581_0524488 Ga0495581_0524488_121_564 135
209 3300047319 Ga0495674_0361276 Ga0495674_0361276_587_1030 135
210 3300047471 Ga0495684_0978219 Ga0495684_0978219_46_489 135
211 3300047673 Ga0495593_0097880 Ga0495593_0097880_884_1327 135
212 3300048089 Ga0495614_0528290 Ga0495614_0528290_59_502 135
213 3300048905 Ga0496102_0686222 Ga0496102_0686222_210_653 135
214 3300048907 Ga0496104_0004123 Ga0496104_0004123_3889_4332 135
215 3300048908 Ga0496105_0457108 Ga0496105_0457108_375_818 135
216 3300048911 Ga0496108_0002443 Ga0496108_0002443_13674_14117 135
217 3300048912 Ga0496109_0087981 Ga0496109_0087981_2178_2618 135
218 3300048912 Ga0496109_0717416 Ga0496109_0717416_376_819 135
219 3300048913 Ga0496110_0004143 Ga0496110_0004143_1937_2380 135
220 3300048914 Ga0496111_0000712 Ga0496111_0000712_11934_12377 135
221 3300048917 Ga0496114_0097964 Ga0496114_0097964_1350_1793 135
222 3300048917 Ga0496114_0171645 Ga0496114_0171645_169_612 135
223 3300048918 Ga0496115_0269262 Ga0496115_0269262_291_731 135
224 3300048918 Ga0496115_0402402 Ga0496115_0402402_229_672 135
225 3300048927 Ga0496124_0528561 Ga0496124_0528561_319_762 135
226 3300048929 Ga0496126_0041790 Ga0496126_0041790_707_1177 135
227 3300049569 Ga0501032_0205482 Ga0501032_0205482_242_682 135
228 3300049578 Ga0501042_0007737 Ga0501042_0007737_5502_5996 135
229 3300049579 Ga0501043_0419364 Ga0501043_0419364_120_560 135
230 3300049586 Ga0501070_0006424 Ga0501070_0006424_7834_8274 135
231 3300049586 Ga0501070_0013575 Ga0501070_0013575_1857_2297 135
232 3300049589 Ga0501073_0249815 Ga0501073_0249815_715_1155 135
233 3300049590 Ga0501074_0003938 Ga0501074_0003938_6999_7439 135
234 3300049590 Ga0501074_0308078 Ga0501074_0308078_424_924 135
235 3300049741 Ga0501079_0001234 Ga0501079_0001234_10988_11428 135
236 3300049742 Ga0501080_0040761 Ga0501080_0040761_131_571 135
237 3300049742 Ga0501080_0102198 Ga0501080_0102198_1378_1818 135
238 3300049823 Ga0501044_0476818 Ga0501044_0476818_518_958 135
239 3300054114 Ga0501084_0144319 Ga0501084_0144319_592_1032 135
240 3300059424 Ga0590075_032288 Ga0590075_032288_500_955 135
241 3300059630 Ga0587128_089023 Ga0587128_089023_150_590 135
242 3300059645 Ga0587076_168208 Ga0587076_168208_61_501 135
243 3300061719 Ga0466962_0412726 Ga0466962_0412726_224_664 135
244 iso_pu_bacteria 2506783011 2506868507 135
245 iso_pu_bacteria 2671180195 2671835725 135
246 iso_pu_bacteria 2684623035 2686539262 135
247 iso_pu_bacteria 2773857922 2774853881 135
248 iso_pu_bacteria 2773857933 2774902888 135
249 iso_pu_bacteria 2895880812 2895884593 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

55

171

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.8715 112 134
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.8306 57 135
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8027 63 133
8hl5-assembly1.cif.gz_L18E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.7692 66 135
6zu5-assembly1.cif.gz_LQ0 structure of the paranosema locustae ribosome in complex with lso2 0.7604 65 135
ID Description Score Start End Superfamily
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9624 63 133 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9371 63 133 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9175 55 135 3.100.10.10
af_P54022_5_121_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9142 63 135 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9085 63 135 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A6B3F858-F1-model_v4 50S ribosomal protein L15 1.001 57 135 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.9892 56 135 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0NA90-F1-model_v4 50S ribosomal protein L15 0.9821 80 135 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.977 56 135 GO:0003735
GO:0006412
GO:0022625
AF-A0A6B3F858-F1-model_v4 50S ribosomal protein L15 0.976 57 135 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
78.39 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map