F360325

General Info

Members Datasets Scaffolds Average Seq Length
248 177 496 147

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857762|2774396644
Length 163
Sequence QAPTVVDDNGPISEDDGAMSVDVLVETTIRRSPAEVSAYAGDPSNAPTWYANIRSVEWRTEPPVRVGSRMDFVAQFLGRRLAYTYEVVEWVPGERLVMRTADGPFPMETTYTWEPAGEGGTRMTLRNRGNPSGFSRVAAPVMERAMRRATTKDLAELKQLLES

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
107 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
173 2643221711 Terrabacter sp. Root85 Isolate Unclassified
174 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
175 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
176 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
177 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 4.03
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 16.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10600941 3300005293 Unclassified 707
2 Ga0070676_10128266 3300005328 Bacteria 1601
3 Ga0070683_100311896 3300005329 Bacteria 1497
4 Ga0070682_100482146 3300005337 Unclassified 957
5 Ga0070660_101389259 3300005339 Unclassified 596
6 Ga0070668_100000248 3300005347 Bacteria 35756
7 Ga0070669_100891147 3300005353 Unclassified 759
8 Ga0070667_100196148 3300005367 Bacteria 1790
9 Ga0070709_10323323 3300005434 Bacteria 1133
10 Ga0070714_100294513 3300005435 Bacteria 1511
11 Ga0070706_100105046 3300005467 Bacteria 2628
12 Ga0070707_100011422 3300005468 Bacteria 8280
13 Ga0070707_100067747 3300005468 Bacteria 3434
14 Ga0070707_100173216 3300005468 Bacteria 2103
15 Ga0070707_100492365 3300005468 Bacteria 1188
16 Ga0070698_100166810 3300005471 Bacteria 2144
17 Ga0070684_100640207 3300005535 Bacteria 989
18 Ga0070684_101800266 3300005535 Bacteria 578
19 Ga0070704_100720711 3300005549 Unclassified 886
20 Ga0068855_101859523 3300005563 Unclassified 611
21 Ga0068857_100052467 3300005577 Bacteria 3618
22 Ga0068856_100629138 3300005614 Bacteria 1094
23 Ga0068856_101432346 3300005614 Bacteria 705
24 Ga0068864_100018751 3300005618 Bacteria 5782
25 Ga0068866_11278856 3300005718 Bacteria 532
26 Ga0068863_100020054 3300005841 Bacteria 6395
27 Ga0068863_100096822 3300005841 Bacteria 2802
28 Ga0068860_100783219 3300005843 Bacteria 966
29 Ga0068862_100266722 3300005844 Unclassified 1565
30 Ga0068862_100588876 3300005844 Unclassified 1066
31 Ga0081455_10063899 3300005937 Bacteria 3086
32 Ga0081455_10279700 3300005937 Bacteria 1206
33 Ga0081539_10002581 3300005985 Bacteria 24997
34 Ga0081539_10017242 3300005985 Bacteria 5084
35 Ga0081539_10154804 3300005985 Unclassified 1099
36 Ga0070717_10868526 3300006028 Unclassified 821
37 Ga0075365_10039667 3300006038 Bacteria 3067
38 Ga0075363_100010282 3300006048 Bacteria 4435
39 Ga0075364_10255917 3300006051 Bacteria 1190
40 Ga0075364_10474212 3300006051 Bacteria 855
41 Ga0075364_10498062 3300006051 Bacteria 833
42 Ga0070716_100948003 3300006173 Bacteria 677
43 Ga0070712_100432930 3300006175 Bacteria 1092
44 Ga0075428_100342283 3300006844 Bacteria 1606
45 Ga0075428_100457585 3300006844 Unclassified 1366
46 Ga0075428_100468442 3300006844 Bacteria 1349
47 Ga0075428_100951299 3300006844 Bacteria 910
48 Ga0075428_101572378 3300006844 Bacteria 688
49 Ga0075430_100000629 3300006846 Bacteria 26900
50 Ga0075430_100072988 3300006846 Bacteria 2878
51 Ga0075430_100211281 3300006846 Bacteria 1610
52 Ga0075430_100918318 3300006846 Bacteria 721
53 Ga0075431_100016750 3300006847 Bacteria 7443
54 Ga0075431_100045422 3300006847 Bacteria 4529
55 Ga0075431_100158105 3300006847 Bacteria 2331
56 Ga0075429_100061148 3300006880 Bacteria 3280
57 Ga0075429_100075561 3300006880 Bacteria 2935
58 Ga0111539_10021281 3300009094 Bacteria 7986
59 Ga0105245_10082937 3300009098 Bacteria 2933
60 Ga0105247_10002779 3300009101 Bacteria 11716
61 Ga0105247_10376830 3300009101 Bacteria 1005
62 Ga0114129_10873094 3300009147 Unclassified 1142
63 Ga0105248_10323473 3300009177 Bacteria 1737
64 Ga0105238_12049055 3300009551 Bacteria 606
65 Ga0105249_10870127 3300009553 Unclassified 967
66 Ga0157340_1003062 3300012473 Bacteria 895
67 Ga0157371_11156059 3300013102 Bacteria 595
68 Ga0157370_11196946 3300013104 Bacteria 685
69 Ga0163162_11159771 3300013306 Bacteria 876
70 Ga0157379_10154999 3300014968 Bacteria 2066
71 Ga0157376_10911693 3300014969 Bacteria 897
72 Ga0157376_11621031 3300014969 Bacteria 681
73 Ga0207710_10008590 3300025900 Bacteria 4307
74 Ga0207699_10041240 3300025906 Bacteria 2665
75 Ga0207645_10066310 3300025907 Bacteria 2307
76 Ga0207705_10723683 3300025909 Bacteria 773
77 Ga0207684_10074757 3300025910 Unclassified 2879
78 Ga0207693_10536447 3300025915 Bacteria 913
79 Ga0207663_10096698 3300025916 Bacteria 1973
80 Ga0207646_10136651 3300025922 Bacteria 2207
81 Ga0207646_10618339 3300025922 Bacteria 972
82 Ga0207687_10063080 3300025927 Bacteria 2622
83 Ga0207700_11586441 3300025928 Bacteria 579
84 Ga0207664_10481059 3300025929 Bacteria 1111
85 Ga0207706_10464419 3300025933 Bacteria 1094
86 Ga0207665_10536923 3300025939 Bacteria 907
87 Ga0207711_10026964 3300025941 Bacteria 4823
88 Ga0207712_10155934 3300025961 Unclassified 1769
89 Ga0207668_11093499 3300025972 Bacteria 714
90 Ga0207658_10792867 3300025986 Bacteria 860
91 Ga0207639_10828411 3300026041 Bacteria 863
92 Ga0207708_11299064 3300026075 Unclassified 637
93 Ga0207641_12530518 3300026088 Unclassified 511
94 Ga0207674_10060264 3300026116 Bacteria 3838
95 Ga0207675_100086300 3300026118 Bacteria 2947
96 Ga0207698_10696265 3300026142 Bacteria 1011
97 Ga0207428_10062804 3300027907 Bacteria 2936
98 Ga0268265_10438059 3300028380 Unclassified 1217
99 Ga0268265_10958213 3300028380 Bacteria 843
100 Ga0268264_10035273 3300028381 Bacteria 4117
101 Ga0307517_10362365 3300028786 Bacteria 782
102 Ga0307511_10141369 3300030521 Bacteria 1412
103 Ga0307408_100115446 3300031548 Bacteria 2071
104 Ga0307408_100505364 3300031548 Bacteria 1059
105 Ga0307408_101065243 3300031548 Bacteria 748
106 Ga0307508_10003355 3300031616 Bacteria 16243
107 Ga0307405_10016891 3300031731 Bacteria 3992
108 Ga0307405_10844415 3300031731 Unclassified 771
109 Ga0307413_10030463 3300031824 Bacteria 3031
110 Ga0307413_10632130 3300031824 Bacteria 880
111 Ga0307410_10104358 3300031852 Bacteria 2038
112 Ga0307410_10900467 3300031852 Bacteria 758
113 Ga0307407_10033701 3300031903 Bacteria 2797
114 Ga0307407_10122734 3300031903 Bacteria 1649
115 Ga0307412_10041417 3300031911 Bacteria 2985
116 Ga0307412_10382572 3300031911 Bacteria 1140
117 Ga0307409_100065323 3300031995 Bacteria 2863
118 Ga0307409_100232138 3300031995 Bacteria 1673
119 Ga0307409_100801558 3300031995 Bacteria 949
120 Ga0307409_100841286 3300031995 Bacteria 928
121 Ga0307416_100075496 3300032002 Bacteria 2821
122 Ga0307416_101823999 3300032002 Bacteria 712
123 Ga0307416_102002934 3300032002 Unclassified 682
124 Ga0307416_102765278 3300032002 Bacteria 587
125 Ga0307414_10233297 3300032004 Bacteria 1519
126 Ga0307414_10319527 3300032004 Bacteria 1321
127 Ga0307414_11042334 3300032004 Bacteria 754
128 Ga0307411_10056478 3300032005 Bacteria 2588
129 Ga0307411_10134847 3300032005 Bacteria 1811
130 Ga0307411_10337708 3300032005 Bacteria 1223
131 Ga0307411_11210782 3300032005 Bacteria 685
132 Ga0307415_100235362 3300032126 Bacteria 1478
133 Ga0307415_100395095 3300032126 Bacteria 1179
134 Ga0307415_101218301 3300032126 Bacteria 710
135 Ga0307415_101777161 3300032126 Bacteria 596
136 Ga0373936_0078413 3300035113 Bacteria 1371
137 Ga0373939_0023396 3300035114 Bacteria 1711
138 Ga0373941_0004933 3300035115 Unclassified 3110
139 Ga0373954_0076482 3300035118 Bacteria 1596
140 Ga0373956_0483805 3300035119 Bacteria 591
141 Ga0373957_0298101 3300035120 Unclassified 683
142 Ga0373960_0015030 3300035121 Bacteria 1970
143 Ga0373955_0017249 3300035172 Bacteria 3570
144 Ga0373942_0046296 3300035207 Bacteria 1205
145 Ga0316574_0098370 3300035398 Bacteria 1871
146 Ga0373933_0034249 3300035724 Bacteria 2958
147 Ga0373933_0629965 3300035724 Unclassified 705
148 Ga0373947_0084927 3300035725 Bacteria 1965
149 Ga0395900_0083363 3300037418 Bacteria 3285
150 Ga0395900_0427747 3300037418 Bacteria 1284
151 Ga0395900_0689383 3300037418 Bacteria 956
152 Ga0395898_0945103 3300037466 Unclassified 799
153 Ga0395901_0032143 3300038443 Bacteria 5415
154 Ga0439447_061565 3300041407 Bacteria 882
155 Ga0451791_0137958 3300041451 Bacteria 2184
156 Ga0439442_013667 3300042002 Bacteria 1666
157 Ga0450906_044125 3300042145 Bacteria 787
158 Ga0450906_088734 3300042145 Bacteria 560
159 Ga0439446_0053127 3300042156 Bacteria 1213
160 Ga0439434_0007217 3300042435 Bacteria 3256
161 Ga0439435_0021564 3300042436 Bacteria 1674
162 Ga0439444_0075873 3300042437 Unclassified 728
163 Ga0450916_065795 3300042530 Unclassified 597
164 Ga0466961_0135639 3300044693 Bacteria 1542
165 Ga0466963_0013067 3300044694 Bacteria 5092
166 Ga0466963_0139358 3300044694 Bacteria 1679
167 Ga0466964_0059749 3300044706 Unclassified 1584
168 Ga0466971_0016282 3300044719 Bacteria 3278
169 Ga0466970_0038230 3300044765 Bacteria 2545
170 Ga0466970_0499790 3300044765 Bacteria 700
171 Ga0466957_0231490 3300044842 Bacteria 1223
172 Ga0466960_0095552 3300044901 Bacteria 1522
173 Ga0466960_0121193 3300044901 Bacteria 1370
174 Ga0466960_0363986 3300044901 Bacteria 827
175 Ga0466960_0593666 3300044901 Unclassified 657
176 Ga0466967_0027510 3300045976 Bacteria 4732
177 Ga0466967_0050982 3300045976 Bacteria 3625
178 Ga0466967_0192501 3300045976 Bacteria 1928
179 Ga0495641_0286841 3300046461 Bacteria 741
180 Ga0495651_0060997 3300046462 Bacteria 2887
181 Ga0495651_0504370 3300046462 Unclassified 774
182 Ga0495653_0161422 3300046463 Bacteria 1555
183 Ga0495608_0014427 3300046511 Bacteria 5482
184 Ga0495608_0379980 3300046511 Unclassified 866
185 Ga0495628_0041096 3300046516 Bacteria 3692
186 Ga0495630_0453949 3300046517 Bacteria 982
187 Ga0495652_0611254 3300046529 Unclassified 742
188 Ga0495587_0216817 3300046536 Bacteria 1080
189 Ga0495667_0025377 3300046559 Bacteria 3994
190 Ga0495635_0029030 3300046663 Bacteria 3845
191 Ga0495657_0255131 3300046675 Bacteria 1055
192 Ga0495657_0397871 3300046675 Bacteria 811
193 Ga0495599_0084066 3300046678 Bacteria 1988
194 Ga0495646_0543131 3300046680 Bacteria 594
195 Ga0495581_0199458 3300047315 Bacteria 1171
196 Ga0495674_0570356 3300047319 Unclassified 899
197 Ga0495674_1172762 3300047319 Unclassified 582
198 Ga0495680_0011123 3300047322 Bacteria 7990
199 Ga0495684_0590159 3300047471 Unclassified 751
200 Ga0495593_0247481 3300047673 Unclassified 893
201 Ga0495602_0691381 3300048088 Bacteria 693
202 Ga0496104_1031221 3300048907 Bacteria 726
203 Ga0496105_0220868 3300048908 Bacteria 1542
204 Ga0496108_0044795 3300048911 Bacteria 3694
205 Ga0496108_0675667 3300048911 Unclassified 897
206 Ga0496109_0025465 3300048912 Bacteria 5273
207 Ga0496109_1774076 3300048912 Unclassified 550
208 Ga0496110_0129815 3300048913 Bacteria 2275
209 Ga0496111_0318815 3300048914 Bacteria 1151
210 Ga0496113_0035406 3300048916 Bacteria 3650
211 Ga0496126_0000040 3300048929 Bacteria 345144
212 Ga0501031_0008344 3300049568 Bacteria 6739
213 Ga0501038_0225466 3300049574 Bacteria 1494
214 Ga0501039_0062990 3300049575 Bacteria 2874
215 Ga0501039_0960011 3300049575 Bacteria 665
216 Ga0501067_0199077 3300049583 Unclassified 1116
217 Ga0501068_0103343 3300049584 Bacteria 1767
218 Ga0501069_0164658 3300049585 Unclassified 1278
219 Ga0501071_0817510 3300049587 Bacteria 719
220 Ga0501076_0260060 3300049592 Bacteria 1421
221 Ga0501198_141194 3300049649 Bacteria 524
222 Ga0501080_0677178 3300049742 Bacteria 911
223 Ga0501081_0251473 3300049743 Bacteria 1290
224 Ga0501045_0031245 3300049824 Bacteria 3857
225 nmdc:mga03n38_126034_c1 3300050490 Bacteria 1264
226 nmdc:mga00v17_224535_c1 3300050491 Bacteria 1216
227 nmdc:mga00v17_262637_c1 3300050491 Bacteria 1120
228 nmdc:mga00v17_626966_c1 3300050491 Bacteria 692
229 nmdc:mga0yw44_199029_c1 3300050492 Bacteria 1323
230 nmdc:mga09592_174095_c1 3300050508 Bacteria 1861
231 nmdc:mga09592_74754_c1 3300050508 Bacteria 2879
232 nmdc:mga0qj67_193540_c1 3300050509 Bacteria 1652
233 nmdc:mga0qj67_327_c1 3300050509 Bacteria 32750
234 nmdc:mga0qj67_66222_c1 3300050509 Bacteria 2877
235 nmdc:mga06r32_19237_c1 3300050510 Bacteria 6266
236 nmdc:mga06r32_201707_c1 3300050510 Bacteria 1977
237 nmdc:mga08y16_32276_c1 3300050511 Bacteria 5507
238 nmdc:mga0n895_174821_c1 3300050512 Bacteria 2178
239 Ga0495655_0174395 3300053083 Bacteria 690
240 Ga0495595_0082361 3300053084 Viruses 1535
241 Ga0495619_0809874 3300053085 Unclassified 633
242 Ga0466962_0026823 3300061719 Bacteria 2766
243 2774396644 2773857762 Bacteria 5971770
244 2644611772 2643221711 Bacteria 4865335
245 2753267086 2751185782 Bacteria 11227053
246 2809198314 2808606439 Bacteria 5952208
247 2812349489 2811994878 Bacteria 5992952
248 2891969363 2891968417 Bacteria 5821697
249 Ga0065715_10600941
250 Ga0070676_10128266
251 Ga0070683_100311896
252 Ga0070682_100482146
253 Ga0070660_101389259
254 Ga0070668_100000248
255 Ga0070669_100891147
256 Ga0070667_100196148
257 Ga0070709_10323323
258 Ga0070714_100294513
259 Ga0070706_100105046
260 Ga0070707_100011422
261 Ga0070707_100067747
262 Ga0070707_100173216
263 Ga0070707_100492365
264 Ga0070698_100166810
265 Ga0070684_100640207
266 Ga0070684_101800266
267 Ga0070704_100720711
268 Ga0068855_101859523
269 Ga0068857_100052467
270 Ga0068856_100629138
271 Ga0068856_101432346
272 Ga0068864_100018751
273 Ga0068866_11278856
274 Ga0068863_100020054
275 Ga0068863_100096822
276 Ga0068860_100783219
277 Ga0068862_100266722
278 Ga0068862_100588876
279 Ga0081455_10063899
280 Ga0081455_10279700
281 Ga0081539_10002581
282 Ga0081539_10017242
283 Ga0081539_10154804
284 Ga0070717_10868526
285 Ga0075365_10039667
286 Ga0075363_100010282
287 Ga0075364_10255917
288 Ga0075364_10474212
289 Ga0075364_10498062
290 Ga0070716_100948003
291 Ga0070712_100432930
292 Ga0075428_100342283
293 Ga0075428_100457585
294 Ga0075428_100468442
295 Ga0075428_100951299
296 Ga0075428_101572378
297 Ga0075430_100000629
298 Ga0075430_100072988
299 Ga0075430_100211281
300 Ga0075430_100918318
301 Ga0075431_100016750
302 Ga0075431_100045422
303 Ga0075431_100158105
304 Ga0075429_100061148
305 Ga0075429_100075561
306 Ga0111539_10021281
307 Ga0105245_10082937
308 Ga0105247_10002779
309 Ga0105247_10376830
310 Ga0114129_10873094
311 Ga0105248_10323473
312 Ga0105238_12049055
313 Ga0105249_10870127
314 Ga0157340_1003062
315 Ga0157371_11156059
316 Ga0157370_11196946
317 Ga0163162_11159771
318 Ga0157379_10154999
319 Ga0157376_10911693
320 Ga0157376_11621031
321 Ga0207710_10008590
322 Ga0207699_10041240
323 Ga0207645_10066310
324 Ga0207705_10723683
325 Ga0207684_10074757
326 Ga0207693_10536447
327 Ga0207663_10096698
328 Ga0207646_10136651
329 Ga0207646_10618339
330 Ga0207687_10063080
331 Ga0207700_11586441
332 Ga0207664_10481059
333 Ga0207706_10464419
334 Ga0207665_10536923
335 Ga0207711_10026964
336 Ga0207712_10155934
337 Ga0207668_11093499
338 Ga0207658_10792867
339 Ga0207639_10828411
340 Ga0207708_11299064
341 Ga0207641_12530518
342 Ga0207674_10060264
343 Ga0207675_100086300
344 Ga0207698_10696265
345 Ga0207428_10062804
346 Ga0268265_10438059
347 Ga0268265_10958213
348 Ga0268264_10035273
349 Ga0307517_10362365
350 Ga0307511_10141369
351 Ga0307408_100115446
352 Ga0307408_100505364
353 Ga0307408_101065243
354 Ga0307508_10003355
355 Ga0307405_10016891
356 Ga0307405_10844415
357 Ga0307413_10030463
358 Ga0307413_10632130
359 Ga0307410_10104358
360 Ga0307410_10900467
361 Ga0307407_10033701
362 Ga0307407_10122734
363 Ga0307412_10041417
364 Ga0307412_10382572
365 Ga0307409_100065323
366 Ga0307409_100232138
367 Ga0307409_100801558
368 Ga0307409_100841286
369 Ga0307416_100075496
370 Ga0307416_101823999
371 Ga0307416_102002934
372 Ga0307416_102765278
373 Ga0307414_10233297
374 Ga0307414_10319527
375 Ga0307414_11042334
376 Ga0307411_10056478
377 Ga0307411_10134847
378 Ga0307411_10337708
379 Ga0307411_11210782
380 Ga0307415_100235362
381 Ga0307415_100395095
382 Ga0307415_101218301
383 Ga0307415_101777161
384 Ga0373936_0078413
385 Ga0373939_0023396
386 Ga0373941_0004933
387 Ga0373954_0076482
388 Ga0373956_0483805
389 Ga0373957_0298101
390 Ga0373960_0015030
391 Ga0373955_0017249
392 Ga0373942_0046296
393 Ga0316574_0098370
394 Ga0373933_0034249
395 Ga0373933_0629965
396 Ga0373947_0084927
397 Ga0395900_0083363
398 Ga0395900_0427747
399 Ga0395900_0689383
400 Ga0395898_0945103
401 Ga0395901_0032143
402 Ga0439447_061565
403 Ga0451791_0137958
404 Ga0439442_013667
405 Ga0450906_044125
406 Ga0450906_088734
407 Ga0439446_0053127
408 Ga0439434_0007217
409 Ga0439435_0021564
410 Ga0439444_0075873
411 Ga0450916_065795
412 Ga0466961_0135639
413 Ga0466963_0013067
414 Ga0466963_0139358
415 Ga0466964_0059749
416 Ga0466971_0016282
417 Ga0466970_0038230
418 Ga0466970_0499790
419 Ga0466957_0231490
420 Ga0466960_0095552
421 Ga0466960_0121193
422 Ga0466960_0363986
423 Ga0466960_0593666
424 Ga0466967_0027510
425 Ga0466967_0050982
426 Ga0466967_0192501
427 Ga0495641_0286841
428 Ga0495651_0060997
429 Ga0495651_0504370
430 Ga0495653_0161422
431 Ga0495608_0014427
432 Ga0495608_0379980
433 Ga0495628_0041096
434 Ga0495630_0453949
435 Ga0495652_0611254
436 Ga0495587_0216817
437 Ga0495667_0025377
438 Ga0495635_0029030
439 Ga0495657_0255131
440 Ga0495657_0397871
441 Ga0495599_0084066
442 Ga0495646_0543131
443 Ga0495581_0199458
444 Ga0495674_0570356
445 Ga0495674_1172762
446 Ga0495680_0011123
447 Ga0495684_0590159
448 Ga0495593_0247481
449 Ga0495602_0691381
450 Ga0496104_1031221
451 Ga0496105_0220868
452 Ga0496108_0044795
453 Ga0496108_0675667
454 Ga0496109_0025465
455 Ga0496109_1774076
456 Ga0496110_0129815
457 Ga0496111_0318815
458 Ga0496113_0035406
459 Ga0496126_0000040
460 Ga0501031_0008344
461 Ga0501038_0225466
462 Ga0501039_0062990
463 Ga0501039_0960011
464 Ga0501067_0199077
465 Ga0501068_0103343
466 Ga0501069_0164658
467 Ga0501071_0817510
468 Ga0501076_0260060
469 Ga0501198_141194
470 Ga0501080_0677178
471 Ga0501081_0251473
472 Ga0501045_0031245
473 nmdc:mga03n38_126034_c1
474 nmdc:mga00v17_224535_c1
475 nmdc:mga00v17_262637_c1
476 nmdc:mga00v17_626966_c1
477 nmdc:mga0yw44_199029_c1
478 nmdc:mga09592_174095_c1
479 nmdc:mga09592_74754_c1
480 nmdc:mga0qj67_193540_c1
481 nmdc:mga0qj67_327_c1
482 nmdc:mga0qj67_66222_c1
483 nmdc:mga06r32_19237_c1
484 nmdc:mga06r32_201707_c1
485 nmdc:mga08y16_32276_c1
486 nmdc:mga0n895_174821_c1
487 Ga0495655_0174395
488 Ga0495595_0082361
489 Ga0495619_0809874
490 Ga0466962_0026823
491 2774396644
492 2644611772
493 2753267086
494 2809198314
495 2812349489
496 2891969363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

20

162

0.86

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

31

162

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8883 1 143
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.8868 1 143
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8656 1 143
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.864 1 143
3nmn-assembly1.cif.gz_A crystal structure of pyrabactin-bound abscisic acid receptor pyl1 in complex with type 2c protein phosphatase abi1 0.8595 2 139
ID Description Score Start End Superfamily
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8883 1 143 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8845 2 137 3.30.530.20
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8783 1 143 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8707 5 140 3.30.530.20
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8656 1 143 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A538EZ71-F1-model_v4 ATPase 0.9695 2 142
AF-A0A4R0HE58-F1-model_v4 ATPase 0.9692 1 134
AF-A0A2A3FVB7-F1-model_v4 ATPase 0.9615 2 144
AF-A0A4P5W861-F1-model_v4 ATPase 0.9523 2 142
AF-A0A7Y2HIP1-F1-model_v4 SRPBCC family protein 0.9475 4 144

Map