F360199

General Info

Members Datasets Scaffolds Average Seq Length
248 156 496 346

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0033372|Ga0496102_0033372_1312_2490
Length 392
Sequence MGVSRTSRIADLPDRLDRSGRDAVVDPAAPGQAAEPVLGGTDAVAGPGPRRPGLAERASLLRAARGEPTDVAPVWFMRQAGRALPEYRALRAGVPMLESCQDAALVTEITLQPVRRFGTDAAIFFSDIVVPLVAIGVGVDIVAGVGPVVADPIRDSAGLEALRPVVPDDIPYIHDAVRLLLAELGDTPLIGFAGAPFTLASYLVEGGPSKTHAKTKRLMYTAPDLWHSLLDRLADVTIGFLKVQVEAGVDALQLFDSWAGALDESDYRRYVAPHSAKVLAAFEGAGVPRIHFGVNTGELLTAMGEAGADVVGVDWRLGLDEAARRVGPGRALQGNLDPTAVFAPPDVLAEKVRDVLLRGSKAEGHIFNLGHGVLPETDPGVLAHIVDLVHGA

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
76 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
77 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
121 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
122 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2508501039 Frankia saprophytica CN3 Isolate Nodule
128 2517572101 Frankia sp. DC12 Isolate Nodule
129 2527291627 Frankia casuarinae Thr Isolate Nodule
130 2527291629 Frankia sp. BMG5.23 Isolate Nodule
131 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
132 2576861822 Frankia sp. CeD Isolate Nodule
133 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
134 2619618881 Frankia sp. ACN1ag Isolate Unclassified
135 2619619003 Frankia sp. CpI1-P Isolate Nodule
136 2626541554 Frankia sp. AvcI.1 Isolate Nodule
137 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
138 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
139 2684623036 Frankia sp. CgIM4 Isolate Nodule
140 2687453737 Frankia sp. BMG5.36 Isolate Nodule
141 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
142 2710264753 Frankia sp. KB5 Isolate Nodule
143 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
144 2773857922 Frankia sp. CcI49 Isolate Nodule
145 2773857924 Frankia sp. CgIS1 Isolate Nodule
146 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
147 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
148 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
149 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
150 637000116 Frankia casuarinae CcI3 Isolate Nodule
151 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
152 8002775197 Frankia nepalensis CN7 Isolate Nodule
153 8002784119 Frankia sp. AgB1.9 Isolate Nodule
154 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
155 8054920844 Frankia tisae Agncl-8 Isolate Nodule
156 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 0
Isolates 12.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 8.47
Rhizoplane 3.63
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0033372 3300048905 Bacteria 4625
2 JGI24740J21852_10025439 3300001979 Bacteria 1995
3 Ga0070658_10000256 3300005327 Bacteria 46854
4 Ga0070658_10006658 3300005327 Bacteria 9363
5 Ga0070658_10022765 3300005327 Bacteria 5029
6 Ga0070676_10006391 3300005328 Bacteria 6293
7 Ga0070683_100155233 3300005329 Bacteria 2171
8 Ga0070690_100004339 3300005330 Bacteria 7863
9 Ga0070690_100111483 3300005330 Bacteria 1826
10 Ga0070666_10000205 3300005335 Bacteria 40586
11 Ga0070660_100070039 3300005339 Bacteria 2736
12 Ga0070661_100043591 3300005344 Bacteria 3277
13 Ga0070661_100095628 3300005344 Bacteria 2203
14 Ga0070673_100019115 3300005364 Bacteria 4915
15 Ga0070709_10060003 3300005434 Bacteria 2417
16 Ga0070684_100004407 3300005535 Bacteria 10714
17 Ga0068856_100014071 3300005614 Bacteria 7737
18 Ga0068856_100153841 3300005614 Bacteria 2310
19 Ga0068856_100188970 3300005614 Bacteria 2073
20 Ga0068859_100000042 3300005617 Bacteria 158982
21 Ga0068859_100003709 3300005617 Bacteria 15568
22 Ga0068863_100004750 3300005841 Bacteria 13391
23 Ga0068858_100023334 3300005842 Bacteria 5765
24 Ga0068858_100050635 3300005842 Bacteria 3844
25 Ga0068858_100433506 3300005842 Bacteria 1265
26 Ga0068862_100000647 3300005844 Bacteria 35988
27 Ga0070712_100326647 3300006175 Bacteria 1249
28 Ga0075430_100007719 3300006846 Bacteria 9089
29 Ga0075430_100042247 3300006846 Bacteria 3856
30 Ga0075430_100213862 3300006846 Bacteria 1599
31 Ga0075431_100012154 3300006847 Bacteria 8685
32 Ga0075431_100013587 3300006847 Bacteria 8228
33 Ga0075431_100055135 3300006847 Bacteria 4100
34 Ga0075431_100171051 3300006847 Bacteria 2232
35 Ga0075429_100162429 3300006880 Bacteria 1956
36 Ga0097620_100000042 3300006931 Bacteria 158982
37 Ga0097620_100003709 3300006931 Bacteria 15568
38 Ga0105240_10195978 3300009093 Bacteria 2372
39 Ga0111539_10000634 3300009094 Bacteria 45403
40 Ga0105247_10000188 3300009101 Bacteria 60322
41 Ga0114129_10000352 3300009147 Bacteria 53517
42 Ga0114129_10044501 3300009147 Bacteria 6245
43 Ga0105248_10000390 3300009177 Bacteria 50573
44 Ga0105248_10000405 3300009177 Bacteria 50013
45 Ga0105248_10010383 3300009177 Bacteria 10253
46 Ga0105248_10073584 3300009177 Bacteria 3840
47 Ga0105248_10672608 3300009177 Bacteria 1168
48 Ga0105249_10075996 3300009553 Bacteria 3112
49 Ga0105239_10321584 3300010375 Bacteria 1744
50 Ga0105246_10045778 3300011119 Bacteria 2981
51 Ga0157373_10071928 3300013100 Bacteria 2442
52 Ga0157373_10080834 3300013100 Bacteria 2292
53 Ga0157373_10112076 3300013100 Bacteria 1918
54 Ga0157370_10018639 3300013104 Bacteria 6977
55 Ga0157370_10072939 3300013104 Bacteria 3239
56 Ga0157369_10002744 3300013105 Bacteria 21025
57 Ga0157369_10050600 3300013105 Bacteria 4499
58 Ga0157369_10092157 3300013105 Bacteria 3234
59 Ga0157374_10027637 3300013296 Bacteria 5121
60 Ga0157374_10190207 3300013296 Bacteria 2008
61 Ga0157378_10027473 3300013297 Bacteria 5022
62 Ga0163162_10072676 3300013306 Bacteria 3494
63 Ga0157375_10003742 3300013308 Bacteria 13197
64 Ga0157375_10060043 3300013308 Bacteria 3769
65 Ga0157375_10209173 3300013308 Bacteria 2108
66 Ga0163163_10020245 3300014325 Bacteria 6263
67 Ga0163163_10090596 3300014325 Bacteria 3071
68 Ga0157377_10262139 3300014745 Bacteria 1125
69 Ga0207710_10000038 3300025900 Bacteria 241794
70 Ga0207699_10095190 3300025906 Bacteria 1877
71 Ga0207699_10215637 3300025906 Bacteria 1307
72 Ga0207705_10012005 3300025909 Bacteria 6259
73 Ga0207686_10281118 3300025934 Bacteria 1228
74 Ga0207711_10002680 3300025941 Bacteria 15748
75 Ga0207711_10018129 3300025941 Bacteria 5853
76 Ga0207661_10006140 3300025944 Bacteria 8491
77 Ga0207679_10023080 3300025945 Bacteria 4248
78 Ga0207641_10019168 3300026088 Bacteria 5612
79 Ga0207428_10000460 3300027907 Bacteria 49066
80 Ga0268265_10000066 3300028380 Bacteria 142517
81 Ga0265338_10025825 3300028800 Bacteria 5945
82 Ga0307513_10109928 3300031456 Bacteria 2753
83 Ga0265313_10013767 3300031595 Bacteria 4823
84 Ga0316576_10010845 3300031727 Bacteria 5942
85 Ga0316576_10172685 3300031727 Bacteria 1631
86 Ga0316578_10144062 3300031728 Bacteria 1435
87 Ga0307405_10255650 3300031731 Bacteria 1306
88 Ga0307518_10026790 3300031838 Bacteria 4157
89 Ga0307507_10031463 3300033179 Bacteria 5570
90 Ga0316574_0096358 3300035398 Bacteria 1891
91 Ga0373927_0003495 3300035695 Bacteria 11255
92 Ga0373947_0132546 3300035725 Bacteria 1592
93 Ga0373925_0001615 3300037068 Bacteria 19037
94 Ga0395899_0000157 3300037312 Bacteria 103574
95 Ga0395899_0009699 3300037312 Bacteria 7389
96 Ga0395899_0038669 3300037312 Bacteria 3573
97 Ga0395899_0084015 3300037312 Bacteria 2315
98 Ga0395900_0003120 3300037418 Bacteria 17993
99 Ga0395900_0025085 3300037418 Bacteria 6103
100 Ga0395900_0088081 3300037418 Bacteria 3191
101 Ga0395900_0117378 3300037418 Bacteria 2730
102 Ga0395900_0132662 3300037418 Bacteria 2552
103 Ga0395900_0380226 3300037418 Bacteria 1380
104 Ga0395900_0432843 3300037418 Bacteria 1274
105 Ga0395900_0443053 3300037418 Bacteria 1256
106 Ga0395898_0286203 3300037466 Bacteria 1572
107 Ga0395905_0000606 3300037471 Bacteria 48007
108 Ga0395905_0006982 3300037471 Bacteria 11292
109 Ga0395905_0051735 3300037471 Bacteria 3847
110 Ga0395905_0080178 3300037471 Bacteria 3059
111 Ga0395905_0094647 3300037471 Bacteria 2802
112 Ga0395901_0026965 3300038443 Bacteria 5899
113 Ga0395901_0062340 3300038443 Bacteria 3880
114 Ga0395901_0087440 3300038443 Bacteria 3258
115 Ga0395901_0131262 3300038443 Bacteria 2632
116 Ga0395901_0133743 3300038443 Bacteria 2606
117 Ga0395901_0144129 3300038443 Bacteria 2504
118 Ga0395901_0364641 3300038443 Bacteria 1489
119 Ga0436365_0143657 3300039437 Bacteria 2062
120 Ga0439432_026118 3300042006 Bacteria 1912
121 Ga0466966_0027972 3300044684 Bacteria 3674
122 Ga0466963_0009959 3300044694 Bacteria 5742
123 Ga0466960_0078858 3300044901 Bacteria 1654
124 Ga0451576_0340143 3300045051 Bacteria 1571
125 Ga0466967_0040980 3300045976 Bacteria 3989
126 Ga0495648_0105060 3300046524 Bacteria 1549
127 Ga0495598_0000621 3300046537 Bacteria 6728
128 Ga0495621_0000027 3300046539 Bacteria 28040
129 Ga0495669_0005133 3300046684 Bacteria 5447
130 Ga0495670_0000419 3300046691 Bacteria 20409
131 Ga0496102_0003712 3300048905 Bacteria 12907
132 Ga0496103_0015664 3300048906 Bacteria 4519
133 Ga0496103_0050796 3300048906 Bacteria 2565
134 Ga0496106_0108546 3300048909 Bacteria 2159
135 Ga0496107_0049936 3300048910 Bacteria 3015
136 Ga0496112_0168312 3300048915 Bacteria 2157
137 Ga0496114_0000016 3300048917 Bacteria 274656
138 Ga0496116_0000599 3300048919 Bacteria 47850
139 Ga0496118_0000929 3300048921 Bacteria 45770
140 Ga0496118_0025722 3300048921 Bacteria 5037
141 Ga0496119_0000686 3300048922 Bacteria 45256
142 Ga0496119_0003111 3300048922 Bacteria 17507
143 Ga0496120_0000643 3300048923 Bacteria 51596
144 Ga0501032_0236828 3300049569 Bacteria 1186
145 Ga0501034_0003300 3300049571 Bacteria 18429
146 Ga0501034_0363601 3300049571 Bacteria 1374
147 Ga0501036_0100977 3300049572 Bacteria 2440
148 Ga0501037_0016937 3300049573 Bacteria 5363
149 Ga0501037_0119357 3300049573 Bacteria 1897
150 Ga0501038_0035272 3300049574 Bacteria 4392
151 Ga0501039_0044425 3300049575 Bacteria 3431
152 Ga0501039_0086628 3300049575 Bacteria 2439
153 Ga0501039_0172124 3300049575 Bacteria 1702
154 Ga0501040_0040509 3300049576 Bacteria 3170
155 Ga0501040_0086953 3300049576 Bacteria 2170
156 Ga0501040_0112361 3300049576 Bacteria 1906
157 Ga0501042_0042723 3300049578 Bacteria 3227
158 Ga0501042_0063072 3300049578 Bacteria 2648
159 Ga0501043_0019520 3300049579 Bacteria 5321
160 Ga0501046_0004512 3300049580 Bacteria 12615
161 Ga0501046_0024712 3300049580 Bacteria 4923
162 Ga0501046_0105887 3300049580 Bacteria 2153
163 Ga0501047_0000015 3300049581 Bacteria 307932
164 Ga0501047_0011612 3300049581 Bacteria 8333
165 Ga0501047_0197637 3300049581 Bacteria 1873
166 Ga0501048_0009525 3300049582 Bacteria 7290
167 Ga0501068_0048050 3300049584 Bacteria 2575
168 Ga0501069_0010200 3300049585 Bacteria 4969
169 Ga0501069_0178049 3300049585 Bacteria 1229
170 Ga0501070_0001693 3300049586 Bacteria 19537
171 Ga0501070_0032144 3300049586 Bacteria 4393
172 Ga0501071_0027837 3300049587 Bacteria 3979
173 Ga0501072_0069731 3300049588 Unclassified 2776
174 Ga0501072_0082995 3300049588 Bacteria 2540
175 Ga0501074_0045411 3300049590 Bacteria 3179
176 Ga0501075_0040940 3300049591 Bacteria 3471
177 Ga0501075_0049465 3300049591 Bacteria 3159
178 Ga0501075_0129133 3300049591 Unclassified 1925
179 Ga0501076_0067283 3300049592 Bacteria 2860
180 Ga0501076_0136239 3300049592 Unclassified 1993
181 Ga0501077_0064852 3300049593 Bacteria 2316
182 Ga0501077_0171854 3300049593 Bacteria 1377
183 Ga0501079_0011926 3300049741 Bacteria 6632
184 Ga0501079_0056183 3300049741 Bacteria 3037
185 Ga0501080_0012747 3300049742 Bacteria 7712
186 Ga0501080_0060456 3300049742 Bacteria 3527
187 Ga0501083_0076284 3300049744 Bacteria 2225
188 Ga0501035_0337468 3300049822 Bacteria 1263
189 Ga0501044_0067594 3300049823 Bacteria 3641
190 Ga0501044_0211842 3300049823 Bacteria 1891
191 Ga0501044_0522569 3300049823 Bacteria 1086
192 Ga0501045_0065143 3300049824 Bacteria 2675
193 Ga0501045_0082116 3300049824 Bacteria 2376
194 nmdc:mga05p37_125539_c1 3300050507 Bacteria 3152
195 nmdc:mga05p37_24_c1 3300050507 Bacteria 118187
196 nmdc:mga09592_11110_c1 3300050508 Bacteria 7325
197 nmdc:mga09592_115098_c1 3300050508 Bacteria 2308
198 nmdc:mga09592_124163_c1 3300050508 Bacteria 2219
199 nmdc:mga09592_29958_c1 3300050508 Bacteria 4527
200 nmdc:mga09592_94678_c1 3300050508 Bacteria 2554
201 nmdc:mga0qj67_190408_c1 3300050509 Bacteria 1667
202 nmdc:mga0qj67_256_c1 3300050509 Bacteria 36383
203 nmdc:mga0qj67_57_c2 3300050509 Bacteria 38742
204 nmdc:mga06r32_21193_c1 3300050510 Bacteria 5998
205 nmdc:mga06r32_22_c1 3300050510 Bacteria 54748
206 nmdc:mga06r32_31807_c1 3300050510 Bacteria 4959
207 nmdc:mga08y16_96_c1 3300050511 Bacteria 74719
208 Ga0500635_0006970 3300053080 Bacteria 3043
209 Ga0500646_0000446 3300053090 Bacteria 12254
210 Ga0500583_0029533 3300053092 Bacteria 2391
211 Ga0500588_0001138 3300053146 Bacteria 4878
212 Ga0501084_0052994 3300054114 Bacteria 3393
213 Ga0501084_0063872 3300054114 Bacteria 3082
214 Ga0501082_0044851 3300060353 Bacteria 3813
215 Ga0530510_0014740 3300061734 Bacteria 5519
216 Ga0530510_0030095 3300061734 Unclassified 3898
217 Ga0530510_0042367 3300061734 Bacteria 3289
218 Ga0530510_0105073 3300061734 Bacteria 2066
219 2508675840 2508501039 Bacteria 9978592
220 2517763816 2517572101 Bacteria 6884336
221 2528203148 2527291627 Bacteria 5309833
222 2528215409 2527291629 Bacteria 5267418
223 2546950668 2546825537 Bacteria 5389291
224 2579748085 2576861822 Bacteria 5004595
225 2579852827 2579778521 Bacteria 7624758
226 2619854001 2619618881 Bacteria 7521104
227 2620349023 2619619003 Bacteria 7619552
228 2626638350 2626541554 Bacteria 7741902
229 2676200955 2675902999 Bacteria 9438463
230 2686535992 2684623035 Bacteria 8032739
231 2686543956 2684623036 Bacteria 5199090
232 2689962733 2687453737 Bacteria 11203906
233 2689991158 2687453743 Bacteria 8361025
234 2710604510 2710264753 Bacteria 5455564
235 2774845533 2773857921 Bacteria 9435764
236 2774851016 2773857922 Bacteria 9757215
237 2774866623 2773857924 Bacteria 5256821
238 2830076141 2830075706 Bacteria 3855215
239 2867325562 2867319477 Bacteria 7069771
240 2891403363 2891395885 Bacteria 9251614
241 2895887191 2895880812 Bacteria 11255272
242 637878667 637000116 Bacteria 5433628
243 8001788947 8001781756 Bacteria 9586736
244 8002783797 8002775197 Bacteria 10728764
245 8002790148 8002784119 Bacteria 9788632
246 8054914125 8054913762 Bacteria 7713009
247 8054921381 8054920844 Bacteria 7068637
248 8055160153 8055157932 Bacteria 6429399
249 Ga0496102_0033372
250 JGI24740J21852_10025439
251 Ga0070658_10000256
252 Ga0070658_10006658
253 Ga0070658_10022765
254 Ga0070676_10006391
255 Ga0070683_100155233
256 Ga0070690_100004339
257 Ga0070690_100111483
258 Ga0070666_10000205
259 Ga0070660_100070039
260 Ga0070661_100043591
261 Ga0070661_100095628
262 Ga0070673_100019115
263 Ga0070709_10060003
264 Ga0070684_100004407
265 Ga0068856_100014071
266 Ga0068856_100153841
267 Ga0068856_100188970
268 Ga0068859_100000042
269 Ga0068859_100003709
270 Ga0068863_100004750
271 Ga0068858_100023334
272 Ga0068858_100050635
273 Ga0068858_100433506
274 Ga0068862_100000647
275 Ga0070712_100326647
276 Ga0075430_100007719
277 Ga0075430_100042247
278 Ga0075430_100213862
279 Ga0075431_100012154
280 Ga0075431_100013587
281 Ga0075431_100055135
282 Ga0075431_100171051
283 Ga0075429_100162429
284 Ga0097620_100000042
285 Ga0097620_100003709
286 Ga0105240_10195978
287 Ga0111539_10000634
288 Ga0105247_10000188
289 Ga0114129_10000352
290 Ga0114129_10044501
291 Ga0105248_10000390
292 Ga0105248_10000405
293 Ga0105248_10010383
294 Ga0105248_10073584
295 Ga0105248_10672608
296 Ga0105249_10075996
297 Ga0105239_10321584
298 Ga0105246_10045778
299 Ga0157373_10071928
300 Ga0157373_10080834
301 Ga0157373_10112076
302 Ga0157370_10018639
303 Ga0157370_10072939
304 Ga0157369_10002744
305 Ga0157369_10050600
306 Ga0157369_10092157
307 Ga0157374_10027637
308 Ga0157374_10190207
309 Ga0157378_10027473
310 Ga0163162_10072676
311 Ga0157375_10003742
312 Ga0157375_10060043
313 Ga0157375_10209173
314 Ga0163163_10020245
315 Ga0163163_10090596
316 Ga0157377_10262139
317 Ga0207710_10000038
318 Ga0207699_10095190
319 Ga0207699_10215637
320 Ga0207705_10012005
321 Ga0207686_10281118
322 Ga0207711_10002680
323 Ga0207711_10018129
324 Ga0207661_10006140
325 Ga0207679_10023080
326 Ga0207641_10019168
327 Ga0207428_10000460
328 Ga0268265_10000066
329 Ga0265338_10025825
330 Ga0307513_10109928
331 Ga0265313_10013767
332 Ga0316576_10010845
333 Ga0316576_10172685
334 Ga0316578_10144062
335 Ga0307405_10255650
336 Ga0307518_10026790
337 Ga0307507_10031463
338 Ga0316574_0096358
339 Ga0373927_0003495
340 Ga0373947_0132546
341 Ga0373925_0001615
342 Ga0395899_0000157
343 Ga0395899_0009699
344 Ga0395899_0038669
345 Ga0395899_0084015
346 Ga0395900_0003120
347 Ga0395900_0025085
348 Ga0395900_0088081
349 Ga0395900_0117378
350 Ga0395900_0132662
351 Ga0395900_0380226
352 Ga0395900_0432843
353 Ga0395900_0443053
354 Ga0395898_0286203
355 Ga0395905_0000606
356 Ga0395905_0006982
357 Ga0395905_0051735
358 Ga0395905_0080178
359 Ga0395905_0094647
360 Ga0395901_0026965
361 Ga0395901_0062340
362 Ga0395901_0087440
363 Ga0395901_0131262
364 Ga0395901_0133743
365 Ga0395901_0144129
366 Ga0395901_0364641
367 Ga0436365_0143657
368 Ga0439432_026118
369 Ga0466966_0027972
370 Ga0466963_0009959
371 Ga0466960_0078858
372 Ga0451576_0340143
373 Ga0466967_0040980
374 Ga0495648_0105060
375 Ga0495598_0000621
376 Ga0495621_0000027
377 Ga0495669_0005133
378 Ga0495670_0000419
379 Ga0496102_0003712
380 Ga0496103_0015664
381 Ga0496103_0050796
382 Ga0496106_0108546
383 Ga0496107_0049936
384 Ga0496112_0168312
385 Ga0496114_0000016
386 Ga0496116_0000599
387 Ga0496118_0000929
388 Ga0496118_0025722
389 Ga0496119_0000686
390 Ga0496119_0003111
391 Ga0496120_0000643
392 Ga0501032_0236828
393 Ga0501034_0003300
394 Ga0501034_0363601
395 Ga0501036_0100977
396 Ga0501037_0016937
397 Ga0501037_0119357
398 Ga0501038_0035272
399 Ga0501039_0044425
400 Ga0501039_0086628
401 Ga0501039_0172124
402 Ga0501040_0040509
403 Ga0501040_0086953
404 Ga0501040_0112361
405 Ga0501042_0042723
406 Ga0501042_0063072
407 Ga0501043_0019520
408 Ga0501046_0004512
409 Ga0501046_0024712
410 Ga0501046_0105887
411 Ga0501047_0000015
412 Ga0501047_0011612
413 Ga0501047_0197637
414 Ga0501048_0009525
415 Ga0501068_0048050
416 Ga0501069_0010200
417 Ga0501069_0178049
418 Ga0501070_0001693
419 Ga0501070_0032144
420 Ga0501071_0027837
421 Ga0501072_0069731
422 Ga0501072_0082995
423 Ga0501074_0045411
424 Ga0501075_0040940
425 Ga0501075_0049465
426 Ga0501075_0129133
427 Ga0501076_0067283
428 Ga0501076_0136239
429 Ga0501077_0064852
430 Ga0501077_0171854
431 Ga0501079_0011926
432 Ga0501079_0056183
433 Ga0501080_0012747
434 Ga0501080_0060456
435 Ga0501083_0076284
436 Ga0501035_0337468
437 Ga0501044_0067594
438 Ga0501044_0211842
439 Ga0501044_0522569
440 Ga0501045_0065143
441 Ga0501045_0082116
442 nmdc:mga05p37_125539_c1
443 nmdc:mga05p37_24_c1
444 nmdc:mga09592_11110_c1
445 nmdc:mga09592_115098_c1
446 nmdc:mga09592_124163_c1
447 nmdc:mga09592_29958_c1
448 nmdc:mga09592_94678_c1
449 nmdc:mga0qj67_190408_c1
450 nmdc:mga0qj67_256_c1
451 nmdc:mga0qj67_57_c2
452 nmdc:mga06r32_21193_c1
453 nmdc:mga06r32_22_c1
454 nmdc:mga06r32_31807_c1
455 nmdc:mga08y16_96_c1
456 Ga0500635_0006970
457 Ga0500646_0000446
458 Ga0500583_0029533
459 Ga0500588_0001138
460 Ga0501084_0052994
461 Ga0501084_0063872
462 Ga0501082_0044851
463 Ga0530510_0014740
464 Ga0530510_0030095
465 Ga0530510_0042367
466 Ga0530510_0105073
467 2508675840
468 2517763816
469 2528203148
470 2528215409
471 2546950668
472 2579748085
473 2579852827
474 2619854001
475 2620349023
476 2626638350
477 2676200955
478 2686535992
479 2686543956
480 2689962733
481 2689991158
482 2710604510
483 2774845533
484 2774851016
485 2774866623
486 2830076141
487 2867325562
488 2891403363
489 2895887191
490 637878667
491 8001788947
492 8002783797
493 8002790148
494 8054914125
495 8054921381
496 8055160153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

55

392

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jph-assembly1.cif.gz_A-2 ile260thr mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9477 14 350
3gvv-assembly1.cif.gz_A single-chain urod y164g (gy) mutation 0.9474 14 350
1r3r-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase with mutation d86n 0.9472 14 350
1jpi-assembly1.cif.gz_A-2 phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9448 14 350
1r3w-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii 0.9447 14 350
ID Description Score Start End Superfamily
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9452 14 349 3.20.20.210
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9392 14 352 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9358 14 350 3.20.20.210
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9258 14 352 3.20.20.210
4wshB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9213 14 350 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A6L4A2C3-F1-model_v4 deleted 0.99 184 352
AF-A0A6N0WZN4-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9867 16 351 GO:0004853
GO:0005829
GO:0019353
AF-A0A519EBC1-F1-model_v4 deleted 0.9862 251 351
AF-A0A4Q2KJY7-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.984 15 353 GO:0004853
GO:0005829
GO:0019353
AF-A0A844Z894-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9835 15 353 GO:0004853
GO:0005829
GO:0019353

Map