F360104

General Info

Members Datasets Scaffolds Average Seq Length
248 182 242 152

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0080597|Ga0451577_0080597_2250_2705
Length 151
Sequence MSISLLRTDSSHPDFIALVRQLDADLAIRDGDEHAFYAQFNKIDMIKHALVAYNETNEPVGCGAIKPFAADTMEVKRMWVEPAFRGKGIASEILKELENWARELGYQRCVLETGKKQVEAMHLYPKNGYRVIPNYGQYIGIENSVCFEKRL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
4 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
5 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
6 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
7 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
8 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
9 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
119 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
120 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
166 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
167 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
175 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
176 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0
Isolates 2.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0
Rhizoplane 0.4
Rhizosphere 77.82
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2919040 2162886007 Bacteria 4201
2 LJQas_1000530 3300000549 Bacteria 6291
3 JGI24034J26672_10109126 3300002239 Bacteria 527
4 rootH1_10000149 3300003316 Bacteria 16615
5 rootH1_10000149 3300003323 Bacteria 69780
6 rootH1_10161339 3300003316 Bacteria 1160
7 rootH2_10015293 3300003320 Bacteria 9155
8 rootH2_10025042 3300003320 Bacteria 20718
9 rootH2_10277354 3300003320 Unclassified 1078
10 rootH2_10279830 3300003320 Bacteria 2271
11 rootL2_10023219 3300003322 Bacteria 4489
12 rootL2_10032777 3300003322 Bacteria 20449
13 rootL2_10213571 3300003322 Bacteria 1190
14 rootH1_10009065 3300003323 Bacteria 30996
15 rootH1_10079930 3300003323 Bacteria 3146
16 rootH1_10134135 3300003323 Bacteria 3495
17 Ga0055530_10016519 3300003791 Bacteria 2354
18 Ga0055530_10027533 3300003791 Bacteria 1550
19 Ga0065165_1023695 3300005262 Bacteria 2076
20 Ga0065714_10065201 3300005288 Bacteria 12006
21 Ga0065704_10129747 3300005289 Bacteria 1644
22 Ga0065715_10271299 3300005293 Bacteria 1110
23 Ga0065707_10317845 3300005295 Bacteria 972
24 Ga0070676_10496381 3300005328 Unclassified 866
25 Ga0070690_100017124 3300005330 Bacteria 4351
26 Ga0070677_10076757 3300005333 Bacteria 1419
27 Ga0070666_10058470 3300005335 Unclassified 2607
28 Ga0070689_100197280 3300005340 Unclassified 1642
29 Ga0070692_10137738 3300005345 Unclassified 1378
30 Ga0070668_100047285 3300005347 Bacteria 3308
31 Ga0070669_101238634 3300005353 Unclassified 645
32 Ga0070675_100949554 3300005354 Unclassified 789
33 Ga0070671_100162700 3300005355 Unclassified 1886
34 Ga0070674_100372589 3300005356 Bacteria 1159
35 Ga0070673_100077316 3300005364 Unclassified 2689
36 Ga0070659_100253744 3300005366 Unclassified 1458
37 Ga0070700_100234811 3300005441 Unclassified 1307
38 Ga0070694_101138915 3300005444 Bacteria 652
39 Ga0070678_100270372 3300005456 Bacteria 1433
40 Ga0068867_100014069 3300005459 Bacteria 5668
41 Ga0070685_10088702 3300005466 Unclassified 1868
42 Ga0070686_100150637 3300005544 Bacteria 1629
43 Ga0070664_100074087 3300005564 Unclassified 2922
44 Ga0068857_100444329 3300005577 Bacteria 1212
45 Ga0068854_100862790 3300005578 Bacteria 793
46 Ga0070702_100012618 3300005615 Bacteria 4240
47 Ga0068852_101029647 3300005616 Unclassified 842
48 Ga0068859_100433098 3300005617 Unclassified 1411
49 Ga0068864_100044069 3300005618 Bacteria 3822
50 Ga0068864_100262567 3300005618 Bacteria 1607
51 Ga0068851_10070387 3300005834 Unclassified 1809
52 Ga0068863_101609547 3300005841 Unclassified 659
53 Ga0068858_100267745 3300005842 Unclassified 1625
54 Ga0068860_100691531 3300005843 Unclassified 1029
55 Ga0068871_102227283 3300006358 Unclassified 522
56 Ga0097620_100433106 3300006931 Unclassified 1411
57 Ga0097620_100603717 3300006931 Bacteria 1190
58 Ga0105240_10000119 3300009093 Bacteria 163675
59 Ga0105243_10000089 3300009148 Bacteria 103761
60 Ga0105237_10007261 3300009545 Bacteria 12155
61 Ga0105237_10104130 3300009545 Bacteria 2829
62 Ga0105238_10773235 3300009551 Unclassified 975
63 Ga0105249_10016971 3300009553 Bacteria 6459
64 Ga0105246_10318997 3300011119 Bacteria 1262
65 Ga0157373_10000067 3300013100 Bacteria 92618
66 Ga0157373_10575853 3300013100 Bacteria 818
67 Ga0157371_10017802 3300013102 Bacteria 5269
68 Ga0157371_10536021 3300013102 Unclassified 867
69 Ga0157370_10017461 3300013104 Bacteria 7239
70 Ga0157370_10045571 3300013104 Bacteria 4206
71 Ga0157370_10298781 3300013104 Bacteria 1487
72 Ga0157370_10844886 3300013104 Bacteria 832
73 Ga0157378_10010008 3300013297 Bacteria 8271
74 Ga0163162_10011624 3300013306 Bacteria 8584
75 Ga0163162_10119935 3300013306 Unclassified 2733
76 Ga0163162_10196664 3300013306 Unclassified 2145
77 Ga0157372_10014011 3300013307 Bacteria 8566
78 Ga0157372_11195310 3300013307 Unclassified 879
79 Ga0157375_10326817 3300013308 Bacteria 1698
80 Ga0157375_11285379 3300013308 Bacteria 860
81 Ga0157380_11639669 3300014326 Unclassified 699
82 Ga0157377_10202188 3300014745 Unclassified 1262
83 Ga0157379_10139616 3300014968 Bacteria 2184
84 Ga0157376_10797507 3300014969 Bacteria 957
85 Ga0157376_11060421 3300014969 Bacteria 835
86 Ga0182006_1011149 3300015261 Bacteria 3968
87 Ga0163161_10002668 3300017792 Bacteria 12677
88 Ga0163161_10027347 3300017792 Bacteria 4045
89 Ga0163161_10147988 3300017792 Bacteria 1783
90 Ga0163161_10632480 3300017792 Unclassified 885
91 Ga0213876_10070471 3300021384 Bacteria 1847
92 Ga0209676_1000022 3300025292 Bacteria 605659
93 Ga0209050_1000020 3300025298 Bacteria 605671
94 Ga0209050_1009809 3300025298 Bacteria 4824
95 Ga0209050_1011020 3300025298 Bacteria 4357
96 Ga0207680_10695854 3300025903 Unclassified 728
97 Ga0207645_10088004 3300025907 Unclassified 1996
98 Ga0207695_10000139 3300025913 Bacteria 216873
99 Ga0207671_10000325 3300025914 Bacteria 70129
100 Ga0207671_10074728 3300025914 Bacteria 2533
101 Ga0207649_10443871 3300025920 Unclassified 978
102 Ga0207681_10467234 3300025923 Unclassified 1029
103 Ga0207694_10554285 3300025924 Unclassified 965
104 Ga0207650_10226160 3300025925 Bacteria 1507
105 Ga0207644_10069678 3300025931 Unclassified 2568
106 Ga0207709_10000136 3300025935 Bacteria 106728
107 Ga0207670_10044981 3300025936 Bacteria 2924
108 Ga0207669_10333134 3300025937 Bacteria 1166
109 Ga0207691_10030032 3300025940 Bacteria 5082
110 Ga0207691_10188149 3300025940 Unclassified 1802
111 Ga0207679_10022448 3300025945 Unclassified 4298
112 Ga0207667_10120946 3300025949 Unclassified 2698
113 Ga0207651_10023476 3300025960 Bacteria 3795
114 Ga0207668_10183000 3300025972 Bacteria 1654
115 Ga0207668_10725457 3300025972 Bacteria 875
116 Ga0207658_10589656 3300025986 Unclassified 998
117 Ga0207677_10067249 3300026023 Unclassified 2509
118 Ga0207678_11075357 3300026067 Unclassified 712
119 Ga0207708_10336568 3300026075 Unclassified 1235
120 Ga0207648_10119346 3300026089 Bacteria 2318
121 Ga0207676_10142697 3300026095 Bacteria 2052
122 Ga0207683_10302324 3300026121 Bacteria 1464
123 Ga0209974_10387874 3300027876 Unclassified 547
124 Ga0307515_10072262 3300028794 Unclassified 4660
125 Ga0307515_10075861 3300028794 Bacteria 4470
126 Ga0307515_10212497 3300028794 Bacteria 1775
127 Ga0316179_1008839 3300030734 Bacteria 2124
128 Ga0265327_10234655 3300031251 Bacteria 821
129 Ga0307513_10097607 3300031456 Bacteria 2973
130 Ga0307513_10423917 3300031456 Bacteria 1060
131 Ga0307408_100002263 3300031548 Bacteria 13707
132 Ga0307408_100187740 3300031548 Bacteria 1663
133 Ga0265313_10073285 3300031595 Bacteria 1572
134 Ga0307405_10107813 3300031731 Unclassified 1881
135 Ga0307413_10175150 3300031824 Unclassified 1523
136 Ga0307413_10214633 3300031824 Bacteria 1400
137 Ga0307410_10033757 3300031852 Bacteria 3306
138 Ga0307406_10000007 3300031901 Bacteria 139236
139 Ga0307406_10004658 3300031901 Bacteria 7474
140 Ga0307406_10252852 3300031901 Unclassified 1329
141 Ga0307406_10279914 3300031901 Bacteria 1272
142 Ga0307406_10397720 3300031901 Bacteria 1091
143 Ga0307407_10652374 3300031903 Bacteria 788
144 Ga0307416_100249882 3300032002 Unclassified 1725
145 Ga0307414_10000001 3300032004 Bacteria 1352954
146 Ga0307414_10000049 3300032004 Bacteria 130090
147 Ga0307414_10446390 3300032004 Unclassified 1133
148 Ga0307414_10973664 3300032004 Unclassified 780
149 Ga0307411_10000007 3300032005 Bacteria 332057
150 Ga0307411_10030315 3300032005 Bacteria 3314
151 Ga0307411_10213172 3300032005 Bacteria 1493
152 Ga0307415_100005366 3300032126 Bacteria 6797
153 Ga0307415_101746409 3300032126 Bacteria 601
154 Ga0400483_243344 3300039062 Unclassified 1402
155 Ga0436365_0826711 3300039437 Bacteria 2697
156 Ga0439447_000151 3300041407 Bacteria 23963
157 Ga0439453_0038552 3300041408 Bacteria 930
158 Ga0451849_0828152 3300041505 Unclassified 687
159 Ga0439433_0017237 3300041999 Unclassified 1603
160 Ga0451577_0080597 3300042876 Bacteria 2903
161 Ga0451577_0418943 3300042876 Bacteria 1216
162 Ga0466969_0000089 3300044656 Bacteria 47433
163 Ga0466966_0000202 3300044684 Bacteria 39843
164 Ga0466961_0177843 3300044693 Bacteria 1322
165 Ga0453684_0367851 3300044712 Bacteria 1617
166 Ga0453684_0467352 3300044712 Bacteria 1401
167 Ga0453684_0647313 3300044712 Viruses 1154
168 Ga0453684_2084355 3300044712 Bacteria 569
169 Ga0466959_0000002 3300045049 Bacteria 362671
170 Ga0451576_0243876 3300045051 Bacteria 1877
171 Ga0451576_0827523 3300045051 Bacteria 972
172 Ga0451576_1571933 3300045051 Bacteria 682
173 Ga0466967_2557785 3300045976 Bacteria 505
174 Ga0495638_0000013 3300046460 Bacteria 430133
175 Ga0495580_0021816 3300046472 Bacteria 4723
176 Ga0495606_0076048 3300046507 Bacteria 2100
177 Ga0495616_0004654 3300046513 Bacteria 8612
178 Ga0495643_0000554 3300046522 Bacteria 46264
179 Ga0495598_0114506 3300046537 Bacteria 907
180 Ga0495621_0176083 3300046539 Unclassified 852
181 Ga0495633_0237843 3300046558 Bacteria 832
182 Ga0495611_0000042 3300046648 Bacteria 94996
183 Ga0495625_0027261 3300046660 Bacteria 4304
184 Ga0495670_0335394 3300046691 Bacteria 813
185 Ga0495681_0173083 3300047470 Bacteria 892
186 Ga0495686_0533028 3300047472 Unclassified 615
187 Ga0496115_0020081 3300048918 Bacteria 5148
188 Ga0496122_0000389 3300048925 Bacteria 93538
189 Ga0496123_0013886 3300048926 Bacteria 6714
190 Ga0496125_0000031 3300048928 Bacteria 365156
191 Ga0496126_0011956 3300048929 Bacteria 8921
192 Ga0501033_0031552 3300049570 Bacteria 3981
193 Ga0501034_0008720 3300049571 Bacteria 10675
194 Ga0501034_0141687 3300049571 Bacteria 2383
195 Ga0501034_0606258 3300049571 Unclassified 1000
196 Ga0501036_0039245 3300049572 Bacteria 4007
197 Ga0501038_0042009 3300049574 Bacteria 3984
198 Ga0501039_0357026 3300049575 Bacteria 1148
199 Ga0501043_0013717 3300049579 Bacteria 6339
200 Ga0501043_0914285 3300049579 Unclassified 629
201 Ga0501046_0004460 3300049580 Bacteria 12696
202 Ga0501047_0027226 3300049581 Bacteria 5506
203 Ga0501047_0396016 3300049581 Bacteria 1214
204 Ga0501047_0436782 3300049581 Bacteria 1139
205 Ga0501048_0020793 3300049582 Bacteria 4809
206 Ga0501067_0068415 3300049583 Bacteria 1966
207 Ga0501070_0016632 3300049586 Bacteria 6179
208 Ga0501073_0021509 3300049589 Bacteria 4650
209 Ga0501074_0011049 3300049590 Bacteria 6554
210 Ga0501238_002374 3300049671 Bacteria 2244
211 Ga0501249_031511 3300049679 Bacteria 1183
212 Ga0501079_0169264 3300049741 Bacteria 1704
213 Ga0501080_0097933 3300049742 Bacteria 2723
214 Ga0501080_0108595 3300049742 Bacteria 2571
215 Ga0501083_0019298 3300049744 Bacteria 4749
216 Ga0501241_106511 3300049758 Bacteria 609
217 Ga0501266_000012 3300049763 Bacteria 196766
218 Ga0501280_000365 3300049776 Bacteria 11137
219 Ga0501035_0035219 3300049822 Bacteria 4544
220 Ga0501035_0222094 3300049822 Bacteria 1613
221 Ga0501044_0014176 3300049823 Bacteria 8608
222 Ga0501044_0067031 3300049823 Bacteria 3658
223 Ga0501044_0076297 3300049823 Bacteria 3402
224 Ga0500644_0012131 3300053088 Bacteria 2375
225 Ga0500646_0004003 3300053090 Bacteria 3749
226 Ga0500646_0010116 3300053090 Bacteria 2418
227 Ga0500646_0064503 3300053090 Bacteria 1085
228 Ga0500583_0004894 3300053092 Unclassified 4427
229 Ga0500651_0036015 3300053093 Bacteria 3119
230 Ga0500557_011455 3300053105 Bacteria 2261
231 Ga0500569_002481 3300053109 Bacteria 3641
232 Ga0500658_0012789 3300053134 Bacteria 3099
233 Ga0500559_0075276 3300053136 Bacteria 1527
234 Ga0500568_0315403 3300053139 Unclassified 567
235 Ga0500577_0003563 3300053142 Bacteria 4048
236 Ga0500616_0000013 3300053153 Bacteria 674172
237 Ga0500616_0001881 3300053153 Bacteria 18900
238 Ga0500616_0012648 3300053153 Bacteria 4935
239 Ga0500622_0000804 3300053156 Bacteria 26977
240 Ga0500622_0044910 3300053156 Bacteria 2289
241 Ga0500622_0354550 3300053156 Unclassified 608
242 Ga0501082_0042021 3300060353 Bacteria 3942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1571933 Ga0451576_1571933_42_443 133
2 3300013102 Ga0157371_10536021 Ga0157371_105360212 136
3 3300026075 Ga0207708_10336568 Ga0207708_103365682 141
4 3300025940 Ga0207691_10188149 Ga0207691_101881492 143
5 iso_pu_bacteria 2585428045 2587680719 144
6 iso_pu_bacteria 2588254255 2590603683 144
7 iso_pu_bacteria 2857618242 2857621821 145
8 iso_pu_bacteria 2739367857 2740003948 146
9 iso_pu_bacteria 2739367858 2740008765 146
10 iso_pu_bacteria 2857613821 2857613965 146
11 iso_pu_bacteria 2522125168 2522551187 147
12 3300000549 LJQas_1000530 LJQas_10005307 148
13 3300003316 rootH1_10000149 rootH1_100001493 148
14 3300003320 rootH2_10015293 rootH2_100152934 148
15 3300003320 rootH2_10025042 rootH2_100250427 148
16 3300003320 rootH2_10279830 rootH2_102798302 148
17 3300003322 rootL2_10023219 rootL2_100232193 148
18 3300003322 rootL2_10032777 rootL2_1003277710 148
19 3300003322 rootL2_10213571 rootL2_102135712 148
20 3300003323 rootH1_10009065 rootH1_100090656 148
21 3300003791 Ga0055530_10027533 Ga0055530_100275331 148
22 3300005262 Ga0065165_1023695 Ga0065165_10236953 148
23 3300005289 Ga0065704_10129747 Ga0065704_101297471 148
24 3300005293 Ga0065715_10271299 Ga0065715_102712992 148
25 3300005347 Ga0070668_100047285 Ga0070668_1000472852 148
26 3300005616 Ga0068852_101029647 Ga0068852_1010296472 148
27 3300009093 Ga0105240_10000119 Ga0105240_10000119141 148
28 3300009148 Ga0105243_10000089 Ga0105243_1000008985 148
29 3300009545 Ga0105237_10104130 Ga0105237_101041302 148
30 3300009551 Ga0105238_10773235 Ga0105238_107732352 148
31 3300009553 Ga0105249_10016971 Ga0105249_100169718 148
32 3300013100 Ga0157373_10000067 Ga0157373_1000006778 148
33 3300013100 Ga0157373_10575853 Ga0157373_105758532 148
34 3300013104 Ga0157370_10017461 Ga0157370_100174615 148
35 3300013306 Ga0163162_10011624 Ga0163162_1001162412 148
36 3300013308 Ga0157375_11285379 Ga0157375_112853792 148
37 3300014968 Ga0157379_10139616 Ga0157379_101396163 148
38 3300014969 Ga0157376_11060421 Ga0157376_110604212 148
39 3300017792 Ga0163161_10027347 Ga0163161_100273475 148
40 3300017792 Ga0163161_10147988 Ga0163161_101479882 148
41 3300025298 Ga0209050_1009809 Ga0209050_10098096 148
42 3300025298 Ga0209050_1011020 Ga0209050_10110203 148
43 3300025913 Ga0207695_10000139 Ga0207695_1000013963 148
44 3300025914 Ga0207671_10074728 Ga0207671_100747284 148
45 3300025924 Ga0207694_10554285 Ga0207694_105542852 148
46 3300025935 Ga0207709_10000136 Ga0207709_1000013689 148
47 3300025972 Ga0207668_10183000 Ga0207668_101830002 148
48 3300027876 Ga0209974_10387874 Ga0209974_103878742 148
49 3300030734 Ga0316179_1008839 Ga0316179_10088393 148
50 3300031456 Ga0307513_10097607 Ga0307513_100976074 148
51 3300031456 Ga0307513_10423917 Ga0307513_104239171 148
52 3300031548 Ga0307408_100002263 Ga0307408_10000226311 148
53 3300031824 Ga0307413_10214633 Ga0307413_102146332 148
54 3300031852 Ga0307410_10033757 Ga0307410_100337572 148
55 3300031901 Ga0307406_10000007 Ga0307406_1000000727 148
56 3300031901 Ga0307406_10279914 Ga0307406_102799142 148
57 3300031903 Ga0307407_10652374 Ga0307407_106523741 148
58 3300032004 Ga0307414_10000001 Ga0307414_10000001104 148
59 3300032004 Ga0307414_10973664 Ga0307414_109736641 148
60 3300032005 Ga0307411_10000007 Ga0307411_10000007180 148
61 3300032005 Ga0307411_10030315 Ga0307411_100303152 148
62 3300032005 Ga0307411_10213172 Ga0307411_102131722 148
63 3300041407 Ga0439447_000151 Ga0439447_000151_2124_2573 148
64 3300041505 Ga0451849_0828152 Ga0451849_0828152_222_671 148
65 3300042876 Ga0451577_0080597 Ga0451577_0080597_2250_2705 148
66 3300042876 Ga0451577_0418943 Ga0451577_0418943_534_989 148
67 3300044712 Ga0453684_0467352 Ga0453684_0467352_600_1055 148
68 3300045051 Ga0451576_0827523 Ga0451576_0827523_16_471 148
69 3300045976 Ga0466967_2557785 Ga0466967_2557785_22_471 148
70 3300046460 Ga0495638_0000013 Ga0495638_0000013_420475_420921 148
71 3300046507 Ga0495606_0076048 Ga0495606_0076048_1126_1575 148
72 3300046513 Ga0495616_0004654 Ga0495616_0004654_7260_7709 148
73 3300046522 Ga0495643_0000554 Ga0495643_0000554_27252_27701 148
74 3300046539 Ga0495621_0176083 Ga0495621_0176083_377_835 148
75 3300046558 Ga0495633_0237843 Ga0495633_0237843_315_764 148
76 3300046648 Ga0495611_0000042 Ga0495611_0000042_28275_28724 148
77 3300046660 Ga0495625_0027261 Ga0495625_0027261_1947_2396 148
78 3300047470 Ga0495681_0173083 Ga0495681_0173083_364_813 148
79 3300048925 Ga0496122_0000389 Ga0496122_0000389_79244_79690 148
80 3300048926 Ga0496123_0013886 Ga0496123_0013886_1008_1454 148
81 3300049570 Ga0501033_0031552 Ga0501033_0031552_1586_2035 148
82 3300049571 Ga0501034_0141687 Ga0501034_0141687_1434_1883 148
83 3300049571 Ga0501034_0606258 Ga0501034_0606258_466_915 148
84 3300049579 Ga0501043_0914285 Ga0501043_0914285_77_523 148
85 3300049581 Ga0501047_0396016 Ga0501047_0396016_150_596 148
86 3300049671 Ga0501238_002374 Ga0501238_002374_1513_1965 148
87 3300049679 Ga0501249_031511 Ga0501249_031511_587_1039 148
88 3300049742 Ga0501080_0097933 Ga0501080_0097933_858_1307 148
89 3300049758 Ga0501241_106511 Ga0501241_106511_43_546 148
90 3300049763 Ga0501266_000012 Ga0501266_000012_172064_172516 148
91 3300049822 Ga0501035_0222094 Ga0501035_0222094_303_752 148
92 3300049823 Ga0501044_0067031 Ga0501044_0067031_2520_2969 148
93 3300049823 Ga0501044_0076297 Ga0501044_0076297_2536_2985 148
94 3300053090 Ga0500646_0010116 Ga0500646_0010116_367_816 148
95 3300053105 Ga0500557_011455 Ga0500557_011455_842_1288 148
96 3300053136 Ga0500559_0075276 Ga0500559_0075276_859_1308 148
97 3300053153 Ga0500616_0000013 Ga0500616_0000013_368586_369032 148
98 3300053156 Ga0500622_0044910 Ga0500622_0044910_367_816 148
99 3300003316 rootH1_10161339 rootH1_101613392 149
100 3300003323 rootH1_10079930 rootH1_100799303 149
101 3300005288 Ga0065714_10065201 Ga0065714_100652015 149
102 3300005444 Ga0070694_101138915 Ga0070694_1011389151 149
103 3300005459 Ga0068867_100014069 Ga0068867_1000140696 149
104 3300005577 Ga0068857_100444329 Ga0068857_1004443291 149
105 3300005834 Ga0068851_10070387 Ga0068851_100703872 149
106 3300005843 Ga0068860_100691531 Ga0068860_1006915312 149
107 3300011119 Ga0105246_10318997 Ga0105246_103189971 149
108 3300013102 Ga0157371_10017802 Ga0157371_100178025 149
109 3300013104 Ga0157370_10844886 Ga0157370_108448862 149
110 3300013306 Ga0163162_10119935 Ga0163162_101199355 149
111 3300013307 Ga0157372_10014011 Ga0157372_100140114 149
112 3300014969 Ga0157376_10797507 Ga0157376_107975071 149
113 3300017792 Ga0163161_10002668 Ga0163161_100026686 149
114 3300017792 Ga0163161_10632480 Ga0163161_106324802 149
115 3300025949 Ga0207667_10120946 Ga0207667_101209464 149
116 3300026067 Ga0207678_11075357 Ga0207678_110753571 149
117 3300026089 Ga0207648_10119346 Ga0207648_101193462 149
118 3300028794 Ga0307515_10072262 Ga0307515_100722623 149
119 3300028794 Ga0307515_10212497 Ga0307515_102124973 149
120 3300031548 Ga0307408_100187740 Ga0307408_1001877403 149
121 3300031595 Ga0265313_10073285 Ga0265313_100732852 149
122 3300031901 Ga0307406_10397720 Ga0307406_103977201 149
123 3300032004 Ga0307414_10446390 Ga0307414_104463901 149
124 3300032126 Ga0307415_101746409 Ga0307415_1017464091 149
125 3300041408 Ga0439453_0038552 Ga0439453_0038552_85_537 149
126 3300044656 Ga0466969_0000089 Ga0466969_0000089_12258_12707 149
127 3300044684 Ga0466966_0000202 Ga0466966_0000202_36478_36927 149
128 3300044693 Ga0466961_0177843 Ga0466961_0177843_484_933 149
129 3300044712 Ga0453684_0367851 Ga0453684_0367851_830_1282 149
130 3300045049 Ga0466959_0000002 Ga0466959_0000002_23709_24158 149
131 3300045051 Ga0451576_0243876 Ga0451576_0243876_656_1108 149
132 3300046472 Ga0495580_0021816 Ga0495580_0021816_3136_3588 149
133 3300047472 Ga0495686_0533028 Ga0495686_0533028_80_532 149
134 3300048918 Ga0496115_0020081 Ga0496115_0020081_1907_2359 149
135 3300048928 Ga0496125_0000031 Ga0496125_0000031_115724_116176 149
136 3300048929 Ga0496126_0011956 Ga0496126_0011956_1933_2385 149
137 3300049776 Ga0501280_000365 Ga0501280_000365_10636_11091 149
138 3300053090 Ga0500646_0004003 Ga0500646_0004003_1858_2310 149
139 3300053090 Ga0500646_0064503 Ga0500646_0064503_94_546 149
140 3300053093 Ga0500651_0036015 Ga0500651_0036015_1942_2394 149
141 3300053109 Ga0500569_002481 Ga0500569_002481_796_1248 149
142 3300053134 Ga0500658_0012789 Ga0500658_0012789_1124_1576 149
143 3300053139 Ga0500568_0315403 Ga0500568_0315403_34_486 149
144 3300053142 Ga0500577_0003563 Ga0500577_0003563_1511_1963 149
145 3300053153 Ga0500616_0001881 Ga0500616_0001881_1204_1656 149
146 3300053153 Ga0500616_0012648 Ga0500616_0012648_406_858 149
147 3300053156 Ga0500622_0354550 Ga0500622_0354550_39_491 149
148 3300006931 Ga0097620_100603717 Ga0097620_1006037171 150
149 3300025925 Ga0207650_10226160 Ga0207650_102261602 150
150 3300031731 Ga0307405_10107813 Ga0307405_101078132 150
151 3300031824 Ga0307413_10175150 Ga0307413_101751502 150
152 3300031901 Ga0307406_10252852 Ga0307406_102528522 150
153 3300032002 Ga0307416_100249882 Ga0307416_1002498822 150
154 3300032126 Ga0307415_100005366 Ga0307415_1000053664 150
155 3300039062 Ga0400483_243344 Ga0400483_243344_155_616 150
156 3300041999 Ga0439433_0017237 Ga0439433_0017237_231_686 150
157 3300044712 Ga0453684_2084355 Ga0453684_2084355_38_493 150
158 3300049571 Ga0501034_0008720 Ga0501034_0008720_5009_5464 150
159 3300049572 Ga0501036_0039245 Ga0501036_0039245_557_1012 150
160 3300049574 Ga0501038_0042009 Ga0501038_0042009_3003_3458 150
161 3300049575 Ga0501039_0357026 Ga0501039_0357026_384_839 150
162 3300049579 Ga0501043_0013717 Ga0501043_0013717_4852_5307 150
163 3300049580 Ga0501046_0004460 Ga0501046_0004460_4347_4802 150
164 3300049581 Ga0501047_0027226 Ga0501047_0027226_3113_3568 150
165 3300049581 Ga0501047_0436782 Ga0501047_0436782_205_660 150
166 3300049582 Ga0501048_0020793 Ga0501048_0020793_757_1212 150
167 3300049583 Ga0501067_0068415 Ga0501067_0068415_672_1127 150
168 3300049586 Ga0501070_0016632 Ga0501070_0016632_1011_1466 150
169 3300049589 Ga0501073_0021509 Ga0501073_0021509_1642_2097 150
170 3300049590 Ga0501074_0011049 Ga0501074_0011049_3546_4001 150
171 3300049741 Ga0501079_0169264 Ga0501079_0169264_1125_1580 150
172 3300049742 Ga0501080_0108595 Ga0501080_0108595_475_930 150
173 3300049744 Ga0501083_0019298 Ga0501083_0019298_3322_3777 150
174 3300049822 Ga0501035_0035219 Ga0501035_0035219_2504_2959 150
175 3300049823 Ga0501044_0014176 Ga0501044_0014176_4056_4511 150
176 3300053092 Ga0500583_0004894 Ga0500583_0004894_3359_3814 150
177 3300060353 Ga0501082_0042021 Ga0501082_0042021_1031_1486 150
178 3300013308 Ga0157375_10326817 Ga0157375_103268172 151
179 3300031251 Ga0265327_10234655 Ga0265327_102346552 151
180 3300053088 Ga0500644_0012131 Ga0500644_0012131_1777_2235 151
181 3300053156 Ga0500622_0000804 Ga0500622_0000804_24286_24744 151
182 2162886007 SwRhRL2b_contig_2919040 SwRhRL2b_0706.00007890 152
183 3300002239 JGI24034J26672_10109126 JGI24034J26672_101091261 152
184 3300003320 rootH2_10277354 rootH2_102773542 152
185 3300003323 rootH1_10134135 rootH1_101341352 152
186 3300003791 Ga0055530_10016519 Ga0055530_100165192 152
187 3300005295 Ga0065707_10317845 Ga0065707_103178452 152
188 3300005328 Ga0070676_10496381 Ga0070676_104963812 152
189 3300005330 Ga0070690_100017124 Ga0070690_1000171242 152
190 3300005333 Ga0070677_10076757 Ga0070677_100767572 152
191 3300005335 Ga0070666_10058470 Ga0070666_100584702 152
192 3300005340 Ga0070689_100197280 Ga0070689_1001972803 152
193 3300005345 Ga0070692_10137738 Ga0070692_101377382 152
194 3300005353 Ga0070669_101238634 Ga0070669_1012386341 152
195 3300005354 Ga0070675_100949554 Ga0070675_1009495541 152
196 3300005355 Ga0070671_100162700 Ga0070671_1001627003 152
197 3300005356 Ga0070674_100372589 Ga0070674_1003725892 152
198 3300005364 Ga0070673_100077316 Ga0070673_1000773163 152
199 3300005366 Ga0070659_100253744 Ga0070659_1002537443 152
200 3300005441 Ga0070700_100234811 Ga0070700_1002348112 152
201 3300005456 Ga0070678_100270372 Ga0070678_1002703723 152
202 3300005466 Ga0070685_10088702 Ga0070685_100887022 152
203 3300005544 Ga0070686_100150637 Ga0070686_1001506372 152
204 3300005564 Ga0070664_100074087 Ga0070664_1000740873 152
205 3300005578 Ga0068854_100862790 Ga0068854_1008627901 152
206 3300005615 Ga0070702_100012618 Ga0070702_1000126181 152
207 3300005617 Ga0068859_100433098 Ga0068859_1004330982 152
208 3300005618 Ga0068864_100044069 Ga0068864_1000440695 152
209 3300005618 Ga0068864_100262567 Ga0068864_1002625672 152
210 3300005841 Ga0068863_101609547 Ga0068863_1016095472 152
211 3300005842 Ga0068858_100267745 Ga0068858_1002677451 152
212 3300006358 Ga0068871_102227283 Ga0068871_1022272831 152
213 3300006931 Ga0097620_100433106 Ga0097620_1004331062 152
214 3300009545 Ga0105237_10007261 Ga0105237_100072619 152
215 3300013104 Ga0157370_10045571 Ga0157370_100455712 152
216 3300013104 Ga0157370_10298781 Ga0157370_102987812 152
217 3300013297 Ga0157378_10010008 Ga0157378_100100085 152
218 3300013306 Ga0163162_10196664 Ga0163162_101966643 152
219 3300013307 Ga0157372_11195310 Ga0157372_111953101 152
220 3300014326 Ga0157380_11639669 Ga0157380_116396692 152
221 3300014745 Ga0157377_10202188 Ga0157377_102021882 152
222 3300015261 Ga0182006_1011149 Ga0182006_10111493 152
223 3300021384 Ga0213876_10070471 Ga0213876_100704712 152
224 3300025292 Ga0209676_1000022 Ga0209676_1000022410 152
225 3300025298 Ga0209050_1000020 Ga0209050_1000020129 152
226 3300025903 Ga0207680_10695854 Ga0207680_106958542 152
227 3300025907 Ga0207645_10088004 Ga0207645_100880042 152
228 3300025914 Ga0207671_10000325 Ga0207671_1000032510 152
229 3300025920 Ga0207649_10443871 Ga0207649_104438712 152
230 3300025923 Ga0207681_10467234 Ga0207681_104672342 152
231 3300025931 Ga0207644_10069678 Ga0207644_100696781 152
232 3300025936 Ga0207670_10044981 Ga0207670_100449813 152
233 3300025937 Ga0207669_10333134 Ga0207669_103331343 152
234 3300025940 Ga0207691_10030032 Ga0207691_100300323 152
235 3300025945 Ga0207679_10022448 Ga0207679_100224483 152
236 3300025960 Ga0207651_10023476 Ga0207651_100234764 152
237 3300025972 Ga0207668_10725457 Ga0207668_107254572 152
238 3300025986 Ga0207658_10589656 Ga0207658_105896562 152
239 3300026023 Ga0207677_10067249 Ga0207677_100672493 152
240 3300026095 Ga0207676_10142697 Ga0207676_101426973 152
241 3300026121 Ga0207683_10302324 Ga0207683_103023242 152
242 3300028794 Ga0307515_10075861 Ga0307515_100758616 152
243 3300031901 Ga0307406_10004658 Ga0307406_100046584 152
244 3300032004 Ga0307414_10000049 Ga0307414_1000004949 152
245 3300039437 Ga0436365_0826711 Ga0436365_0826711_736_1197 152
246 3300044712 Ga0453684_0647313 Ga0453684_0647313_335_808 152
247 3300046537 Ga0495598_0114506 Ga0495598_0114506_237_704 152
248 3300046691 Ga0495670_0335394 Ga0495670_0335394_38_499 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

46

131

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

129

0.82

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

11

130

0.82

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

30

142

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8779 46 149
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8765 46 148
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8741 2 147
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8733 46 148
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.873 46 149
ID Description Score Start End Superfamily
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8905 46 108 3.40.630.30
af_Q54IL8_181_295_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.882 47 125 3.40.630.30
af_Q7EYF5_51_166_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8785 47 132 3.40.630.30
af_O64737_28_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.878 47 132 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8741 2 147 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0E9N1P0-F1-model_v4 Putative acetyltransferase 0.9965 2 147 GO:0016747
AF-A0A7T4QWT5-F1-model_v4 GNAT family N-acetyltransferase 0.9951 2 148 GO:0008080
AF-A0A1I0R7I0-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9945 2 148 GO:0016747
AF-A0A4R0MN77-F1-model_v4 N-acetyltransferase 0.9945 2 147 GO:0016747
AF-A0A4Q3F0G3-F1-model_v4 GNAT family N-acetyltransferase 0.9943 2 147 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.22 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map