F360090

General Info

Members Datasets Scaffolds Average Seq Length
248 179 496 164

Family's Representative Sequence

Representative Sequence 3300041458|Ga0451798_0726978|Ga0451798_0726978_298_870
Length 190
Sequence VPAVLPQRGHTLASRFALVRVSEVGMLEMRVELLQRMPIFGAIRDDALEFLLQQTRSVKVRAGAYFFREKDPADCMYVLESGRVAVLKSWQGQELLMRHLGEGDCFGEMALMDLLPRSASVRAEEDCSAIELTPEQFNRLFERDPEQFTLIQMNIGREVCRRLRVMDDLLFRARMGEQPASPSKDVFRSA

Samples

Sample ID Description Type Environment
1 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
110 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
157 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.95
Nodule 0
Rhizoplane 2.42
Rhizosphere 72.58
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451798_0726978 3300041458 Bacteria 1737
2 Ga0070676_10154377 3300005328 Bacteria 1472
3 Ga0070676_10158630 3300005328 Bacteria 1454
4 Ga0068869_100137758 3300005334 Bacteria 1882
5 Ga0068868_100024371 3300005338 Bacteria 4591
6 Ga0070668_100039486 3300005347 Bacteria 3610
7 Ga0070669_100339964 3300005353 Bacteria 1216
8 Ga0070675_100959369 3300005354 Bacteria 785
9 Ga0070671_100586505 3300005355 Bacteria 963
10 Ga0070674_100018439 3300005356 Bacteria 4413
11 Ga0070674_100315024 3300005356 Bacteria 1252
12 Ga0070673_100213674 3300005364 Bacteria 1667
13 Ga0070673_100661795 3300005364 Bacteria 957
14 Ga0070667_100050054 3300005367 Bacteria 3520
15 Ga0070667_100490080 3300005367 Bacteria 1126
16 Ga0070708_100945852 3300005445 Bacteria 808
17 Ga0070678_100321240 3300005456 Bacteria 1322
18 Ga0070678_100889905 3300005456 Bacteria 813
19 Ga0070662_100043807 3300005457 Bacteria 3204
20 Ga0068867_100001037 3300005459 Bacteria 18958
21 Ga0070707_100617001 3300005468 Bacteria 1047
22 Ga0068853_100045031 3300005539 Bacteria 3778
23 Ga0070672_100435174 3300005543 Bacteria 1128
24 Ga0070672_100882152 3300005543 Bacteria 790
25 Ga0070693_100159899 3300005547 Bacteria 1434
26 Ga0070665_100082343 3300005548 Unclassified 3223
27 Ga0070665_100801654 3300005548 Bacteria 955
28 Ga0068857_100056836 3300005577 Bacteria 3473
29 Ga0068854_100427983 3300005578 Bacteria 1101
30 Ga0068856_100109178 3300005614 Bacteria 2763
31 Ga0068852_101564624 3300005616 Bacteria 682
32 Ga0068859_100134895 3300005617 Bacteria 2541
33 Ga0068859_100485348 3300005617 Bacteria 1331
34 Ga0068859_100877895 3300005617 Bacteria 982
35 Ga0068864_100001446 3300005618 Bacteria 19579
36 Ga0068866_10013839 3300005718 Bacteria 3548
37 Ga0068861_100641197 3300005719 Bacteria 980
38 Ga0068861_100959553 3300005719 Bacteria 814
39 Ga0068863_100033406 3300005841 Bacteria 4901
40 Ga0068858_101144659 3300005842 Bacteria 764
41 Ga0068860_100002709 3300005843 Bacteria 18428
42 Ga0068862_100090104 3300005844 Bacteria 2669
43 Ga0075368_10009830 3300006042 Bacteria 3448
44 Ga0075363_100030396 3300006048 Bacteria 2796
45 Ga0075364_10227502 3300006051 Bacteria 1267
46 Ga0075362_10003000 3300006177 Bacteria 5806
47 Ga0075362_10004948 3300006177 Bacteria 4829
48 Ga0075362_10171508 3300006177 Bacteria 1048
49 Ga0075367_10072278 3300006178 Bacteria 2076
50 Ga0075367_10079301 3300006178 Bacteria 1984
51 Ga0075369_10008925 3300006186 Bacteria 3878
52 Ga0075369_10063281 3300006186 Bacteria 1618
53 Ga0075366_10000352 3300006195 Bacteria 21061
54 Ga0075366_10003355 3300006195 Bacteria 8428
55 Ga0075366_10025204 3300006195 Bacteria 3472
56 Ga0075366_10034932 3300006195 Bacteria 2963
57 Ga0075366_10099564 3300006195 Bacteria 1744
58 Ga0075366_10250056 3300006195 Unclassified 1081
59 Ga0075366_10365814 3300006195 Bacteria 886
60 Ga0097621_100167156 3300006237 Bacteria 1894
61 Ga0097621_100871444 3300006237 Bacteria 837
62 Ga0075370_10004058 3300006353 Bacteria 7040
63 Ga0075370_10009326 3300006353 Bacteria 5093
64 Ga0075428_101272457 3300006844 Bacteria 774
65 Ga0075430_100086830 3300006846 Bacteria 2618
66 Ga0075429_100004000 3300006880 Bacteria 12622
67 Ga0068865_100011928 3300006881 Bacteria 5456
68 Ga0097620_100134906 3300006931 Bacteria 2541
69 Ga0097620_100485361 3300006931 Bacteria 1331
70 Ga0097620_100877921 3300006931 Bacteria 982
71 Ga0105240_10124443 3300009093 Bacteria 3101
72 Ga0105245_10002284 3300009098 Bacteria 17345
73 Ga0105245_10353799 3300009098 Bacteria 1456
74 Ga0105243_10091819 3300009148 Bacteria 2501
75 Ga0105243_10156507 3300009148 Bacteria 1960
76 Ga0105241_10108454 3300009174 Bacteria 2219
77 Ga0105237_10013848 3300009545 Bacteria 8441
78 Ga0105249_10024950 3300009553 Bacteria 5378
79 Ga0105239_10159310 3300010375 Bacteria 2521
80 Ga0105246_10100552 3300011119 Bacteria 2104
81 Ga0157374_10007543 3300013296 Bacteria 9283
82 Ga0157378_10003690 3300013297 Bacteria 13575
83 Ga0157378_10079370 3300013297 Bacteria 2963
84 Ga0157378_11460712 3300013297 Bacteria 728
85 Ga0163162_10012244 3300013306 Bacteria 8370
86 Ga0163162_11018127 3300013306 Unclassified 937
87 Ga0157372_10708407 3300013307 Bacteria 1171
88 Ga0157375_10004702 3300013308 Bacteria 11885
89 Ga0157375_10036243 3300013308 Bacteria 4717
90 Ga0157379_10107856 3300014968 Bacteria 2500
91 Ga0157379_10290252 3300014968 Bacteria 1489
92 Ga0163161_10214096 3300017792 Bacteria 1489
93 Ga0163161_10457205 3300017792 Bacteria 1033
94 Ga0213872_10000052 3300021361 Bacteria 106278
95 Ga0213872_10182335 3300021361 Bacteria 906
96 Ga0207642_10006137 3300025899 Bacteria 3976
97 Ga0207688_10706263 3300025901 Bacteria 638
98 Ga0207680_10560879 3300025903 Bacteria 816
99 Ga0207645_10128881 3300025907 Bacteria 1646
100 Ga0207645_10185169 3300025907 Bacteria 1367
101 Ga0207681_10067944 3300025923 Bacteria 2473
102 Ga0207659_10381508 3300025926 Bacteria 1175
103 Ga0207687_10357222 3300025927 Unclassified 1192
104 Ga0207644_10465900 3300025931 Bacteria 1039
105 Ga0207706_10061614 3300025933 Bacteria 3304
106 Ga0207709_10010821 3300025935 Bacteria 5024
107 Ga0207709_10069077 3300025935 Bacteria 2235
108 Ga0207669_10029281 3300025937 Bacteria 3043
109 Ga0207704_10001985 3300025938 Bacteria 9168
110 Ga0207691_10298048 3300025940 Bacteria 1385
111 Ga0207689_10137762 3300025942 Bacteria 2010
112 Ga0207689_10364638 3300025942 Bacteria 1201
113 Ga0207651_10429329 3300025960 Bacteria 1130
114 Ga0207712_10023552 3300025961 Bacteria 4065
115 Ga0207668_10056840 3300025972 Bacteria 2727
116 Ga0207640_10191727 3300025981 Bacteria 1541
117 Ga0207658_10047469 3300025986 Bacteria 3143
118 Ga0207658_10533064 3300025986 Bacteria 1049
119 Ga0207677_10097243 3300026023 Bacteria 2156
120 Ga0207639_10079144 3300026041 Bacteria 2597
121 Ga0207678_10075458 3300026067 Bacteria 2888
122 Ga0207708_10059618 3300026075 Bacteria 2913
123 Ga0207641_10096209 3300026088 Bacteria 2600
124 Ga0207648_10006873 3300026089 Bacteria 11280
125 Ga0207676_10451824 3300026095 Unclassified 1211
126 Ga0207674_10054138 3300026116 Bacteria 4087
127 Ga0207675_100001408 3300026118 Bacteria 24052
128 Ga0207675_100624318 3300026118 Bacteria 1082
129 Ga0207683_10174327 3300026121 Bacteria 1949
130 Ga0207683_10862670 3300026121 Bacteria 840
131 Ga0209813_10009687 3300027866 Bacteria 2473
132 Ga0268266_10010582 3300028379 Bacteria 8045
133 Ga0268266_10696132 3300028379 Bacteria 979
134 Ga0268265_10166033 3300028380 Bacteria 1881
135 Ga0307517_10126674 3300028786 Bacteria 1860
136 Ga0307515_10000066 3300028794 Bacteria 244076
137 Ga0307515_10000284 3300028794 Bacteria 124800
138 Ga0307515_10011369 3300028794 Bacteria 16897
139 Ga0307515_10063405 3300028794 Bacteria 5192
140 Ga0307515_10089497 3300028794 Bacteria 3875
141 Ga0307515_10395340 3300028794 Bacteria 1010
142 Ga0307513_10085733 3300031456 Bacteria 3231
143 Ga0307509_10022231 3300031507 Bacteria 7156
144 Ga0307509_10039317 3300031507 Bacteria 5155
145 Ga0307408_100848714 3300031548 Bacteria 832
146 Ga0307508_10006698 3300031616 Bacteria 10804
147 Ga0316575_10006992 3300031665 Bacteria 4083
148 Ga0307516_10001652 3300031730 Bacteria 30677
149 Ga0307516_10007118 3300031730 Bacteria 12924
150 Ga0307516_10027345 3300031730 Bacteria 5783
151 Ga0307410_10466987 3300031852 Bacteria 1032
152 Ga0307410_10612028 3300031852 Bacteria 910
153 Ga0307412_10048710 3300031911 Bacteria 2788
154 Ga0307409_100405527 3300031995 Bacteria 1303
155 Ga0307416_100106824 3300032002 Bacteria 2455
156 Ga0307414_10365857 3300032004 Bacteria 1242
157 Ga0307414_10398440 3300032004 Bacteria 1195
158 Ga0307415_101382256 3300032126 Bacteria 670
159 Ga0316583_10003180 3300032133 Bacteria 5771
160 Ga0316585_10145176 3300032137 Bacteria 783
161 Ga0307507_10087434 3300033179 Bacteria 2695
162 Ga0373932_0004117 3300035112 Bacteria 3456
163 Ga0373960_0056999 3300035121 Bacteria 1175
164 Ga0316574_0080540 3300035398 Unclassified 2067
165 Ga0373931_0279451 3300035691 Bacteria 1024
166 Ga0316584_0018584 3300036712 Bacteria 5017
167 Ga0436361_0027158 3300039447 Bacteria 4520
168 Ga0436361_0824626 3300039447 Bacteria 56099
169 Ga0439466_0215232 3300041411 Bacteria 583
170 Ga0451793_1579420 3300041452 Bacteria 547
171 Ga0451800_0881423 3300041459 Bacteria 812
172 Ga0451802_1839769 3300041460 Bacteria 1344
173 Ga0451807_0087143 3300041486 Bacteria 1433
174 Ga0439431_0032725 3300041997 Bacteria 1298
175 Ga0450898_013919 3300042134 Bacteria 1347
176 Ga0453684_0035983 3300044712 Bacteria 6831
177 Ga0495583_0041238 3300046506 Bacteria 2164
178 Ga0495610_0092295 3300046512 Bacteria 1370
179 Ga0495628_0422891 3300046516 Bacteria 971
180 Ga0495630_0056253 3300046517 Bacteria 2948
181 Ga0495632_0031000 3300046519 Bacteria 2769
182 Ga0495642_0078201 3300046528 Bacteria 1390
183 Ga0495586_0216235 3300046535 Bacteria 1088
184 Ga0495622_0043197 3300046557 Bacteria 2096
185 Ga0495625_0042795 3300046660 Bacteria 3288
186 Ga0495625_0377443 3300046660 Bacteria 890
187 Ga0495658_0085232 3300046683 Bacteria 1862
188 Ga0495613_0466058 3300046689 Bacteria 854
189 Ga0495624_0045429 3300046690 Bacteria 2796
190 Ga0495649_0033258 3300046694 Bacteria 2838
191 Ga0495660_0042622 3300046810 Bacteria 2507
192 Ga0495636_0042978 3300047318 Bacteria 1879
193 Ga0495687_023850 3300047443 Bacteria 2917
194 Ga0496110_0155614 3300048913 Bacteria 2071
195 Ga0501033_0593107 3300049570 Bacteria 760
196 Ga0501036_0042208 3300049572 Bacteria 3862
197 Ga0501038_0110112 3300049574 Bacteria 2282
198 Ga0501039_0010471 3300049575 Bacteria 7066
199 Ga0501041_0002717 3300049577 Bacteria 10092
200 Ga0501041_0643390 3300049577 Unclassified 678
201 Ga0501042_0006296 3300049578 Bacteria 7699
202 Ga0501043_0295887 3300049579 Bacteria 1238
203 Ga0501068_0506612 3300049584 Bacteria 783
204 Ga0501071_0018430 3300049587 Bacteria 4832
205 Ga0501072_0047461 3300049588 Bacteria 3381
206 Ga0501074_0081958 3300049590 Bacteria 2314
207 Ga0501075_0011570 3300049591 Bacteria 6247
208 Ga0501076_0013139 3300049592 Bacteria 6199
209 Ga0501198_000008 3300049649 Bacteria 129023
210 Ga0501222_000006 3300049662 Bacteria 129030
211 Ga0501079_0010158 3300049741 Bacteria 7146
212 Ga0501080_0016792 3300049742 Bacteria 6761
213 Ga0501083_0063748 3300049744 Bacteria 2458
214 Ga0501035_0299817 3300049822 Bacteria 1354
215 Ga0501045_0000802 3300049824 Bacteria 20271
216 nmdc:mga03683_243628_c1 3300050489 Bacteria 834
217 nmdc:mga03683_5784_c1 3300050489 Bacteria 4198
218 nmdc:mga03n38_358689_c1 3300050490 Bacteria 795
219 nmdc:mga00v17_45480_c1 3300050491 Bacteria 2652
220 nmdc:mga0yw44_371895_c1 3300050492 Bacteria 964
221 nmdc:mga0k408_15965_c1 3300050493 Bacteria 2450
222 nmdc:mga0k408_240370_c1 3300050493 Unclassified 1081
223 nmdc:mga0k408_27152_c1 3300050493 Bacteria 3250
224 nmdc:mga0k408_330364_c1 3300050493 Bacteria 909
225 nmdc:mga0k408_35935_c1 3300050493 Bacteria 2842
226 nmdc:mga0k408_504621_c1 3300050493 Bacteria 717
227 nmdc:mga0k408_539_c1 3300050493 Bacteria 20854
228 nmdc:mga0k408_552168_c1 3300050493 Bacteria 681
229 nmdc:mga0k408_7192_c1 3300050493 Bacteria 5951
230 nmdc:mga06z11_25203_c1 3300050494 Bacteria 2816
231 nmdc:mga06z11_53659_c1 3300050494 Bacteria 2074
232 nmdc:mga06z11_871325_c1 3300050494 Bacteria 549
233 nmdc:mga04h51_16719_c1 3300050495 Bacteria 2134
234 nmdc:mga07m45_151920_c1 3300050496 Bacteria 1343
235 nmdc:mga07m45_164979_c1 3300050496 Bacteria 1287
236 nmdc:mga07m45_18434_c1 3300050496 Bacteria 3768
237 nmdc:mga07m45_20909_c1 3300050496 Bacteria 3558
238 nmdc:mga07m45_91948_c1 3300050496 Bacteria 1739
239 nmdc:mga09592_23071_c1 3300050508 Bacteria 5137
240 nmdc:mga0qj67_80070_c1 3300050509 Bacteria 2617
241 nmdc:mga0sz30_12037_c1 3300050516 Bacteria 3358
242 nmdc:mga0sz30_57889_c1 3300050516 Bacteria 1652
243 Ga0495612_0489002 3300053078 Bacteria 564
244 Ga0500658_0025994 3300053134 Bacteria 2253
245 Ga0500568_0184908 3300053139 Bacteria 765
246 Ga0590071_001647 3300059421 Bacteria 5827
247 Ga0501082_0006899 3300060353 Bacteria 9826
248 Ga0530510_0000189 3300061734 Bacteria 37823
249 Ga0451798_0726978
250 Ga0070676_10154377
251 Ga0070676_10158630
252 Ga0068869_100137758
253 Ga0068868_100024371
254 Ga0070668_100039486
255 Ga0070669_100339964
256 Ga0070675_100959369
257 Ga0070671_100586505
258 Ga0070674_100018439
259 Ga0070674_100315024
260 Ga0070673_100213674
261 Ga0070673_100661795
262 Ga0070667_100050054
263 Ga0070667_100490080
264 Ga0070708_100945852
265 Ga0070678_100321240
266 Ga0070678_100889905
267 Ga0070662_100043807
268 Ga0068867_100001037
269 Ga0070707_100617001
270 Ga0068853_100045031
271 Ga0070672_100435174
272 Ga0070672_100882152
273 Ga0070693_100159899
274 Ga0070665_100082343
275 Ga0070665_100801654
276 Ga0068857_100056836
277 Ga0068854_100427983
278 Ga0068856_100109178
279 Ga0068852_101564624
280 Ga0068859_100134895
281 Ga0068859_100485348
282 Ga0068859_100877895
283 Ga0068864_100001446
284 Ga0068866_10013839
285 Ga0068861_100641197
286 Ga0068861_100959553
287 Ga0068863_100033406
288 Ga0068858_101144659
289 Ga0068860_100002709
290 Ga0068862_100090104
291 Ga0075368_10009830
292 Ga0075363_100030396
293 Ga0075364_10227502
294 Ga0075362_10003000
295 Ga0075362_10004948
296 Ga0075362_10171508
297 Ga0075367_10072278
298 Ga0075367_10079301
299 Ga0075369_10008925
300 Ga0075369_10063281
301 Ga0075366_10000352
302 Ga0075366_10003355
303 Ga0075366_10025204
304 Ga0075366_10034932
305 Ga0075366_10099564
306 Ga0075366_10250056
307 Ga0075366_10365814
308 Ga0097621_100167156
309 Ga0097621_100871444
310 Ga0075370_10004058
311 Ga0075370_10009326
312 Ga0075428_101272457
313 Ga0075430_100086830
314 Ga0075429_100004000
315 Ga0068865_100011928
316 Ga0097620_100134906
317 Ga0097620_100485361
318 Ga0097620_100877921
319 Ga0105240_10124443
320 Ga0105245_10002284
321 Ga0105245_10353799
322 Ga0105243_10091819
323 Ga0105243_10156507
324 Ga0105241_10108454
325 Ga0105237_10013848
326 Ga0105249_10024950
327 Ga0105239_10159310
328 Ga0105246_10100552
329 Ga0157374_10007543
330 Ga0157378_10003690
331 Ga0157378_10079370
332 Ga0157378_11460712
333 Ga0163162_10012244
334 Ga0163162_11018127
335 Ga0157372_10708407
336 Ga0157375_10004702
337 Ga0157375_10036243
338 Ga0157379_10107856
339 Ga0157379_10290252
340 Ga0163161_10214096
341 Ga0163161_10457205
342 Ga0213872_10000052
343 Ga0213872_10182335
344 Ga0207642_10006137
345 Ga0207688_10706263
346 Ga0207680_10560879
347 Ga0207645_10128881
348 Ga0207645_10185169
349 Ga0207681_10067944
350 Ga0207659_10381508
351 Ga0207687_10357222
352 Ga0207644_10465900
353 Ga0207706_10061614
354 Ga0207709_10010821
355 Ga0207709_10069077
356 Ga0207669_10029281
357 Ga0207704_10001985
358 Ga0207691_10298048
359 Ga0207689_10137762
360 Ga0207689_10364638
361 Ga0207651_10429329
362 Ga0207712_10023552
363 Ga0207668_10056840
364 Ga0207640_10191727
365 Ga0207658_10047469
366 Ga0207658_10533064
367 Ga0207677_10097243
368 Ga0207639_10079144
369 Ga0207678_10075458
370 Ga0207708_10059618
371 Ga0207641_10096209
372 Ga0207648_10006873
373 Ga0207676_10451824
374 Ga0207674_10054138
375 Ga0207675_100001408
376 Ga0207675_100624318
377 Ga0207683_10174327
378 Ga0207683_10862670
379 Ga0209813_10009687
380 Ga0268266_10010582
381 Ga0268266_10696132
382 Ga0268265_10166033
383 Ga0307517_10126674
384 Ga0307515_10000066
385 Ga0307515_10000284
386 Ga0307515_10011369
387 Ga0307515_10063405
388 Ga0307515_10089497
389 Ga0307515_10395340
390 Ga0307513_10085733
391 Ga0307509_10022231
392 Ga0307509_10039317
393 Ga0307408_100848714
394 Ga0307508_10006698
395 Ga0316575_10006992
396 Ga0307516_10001652
397 Ga0307516_10007118
398 Ga0307516_10027345
399 Ga0307410_10466987
400 Ga0307410_10612028
401 Ga0307412_10048710
402 Ga0307409_100405527
403 Ga0307416_100106824
404 Ga0307414_10365857
405 Ga0307414_10398440
406 Ga0307415_101382256
407 Ga0316583_10003180
408 Ga0316585_10145176
409 Ga0307507_10087434
410 Ga0373932_0004117
411 Ga0373960_0056999
412 Ga0316574_0080540
413 Ga0373931_0279451
414 Ga0316584_0018584
415 Ga0436361_0027158
416 Ga0436361_0824626
417 Ga0439466_0215232
418 Ga0451793_1579420
419 Ga0451800_0881423
420 Ga0451802_1839769
421 Ga0451807_0087143
422 Ga0439431_0032725
423 Ga0450898_013919
424 Ga0453684_0035983
425 Ga0495583_0041238
426 Ga0495610_0092295
427 Ga0495628_0422891
428 Ga0495630_0056253
429 Ga0495632_0031000
430 Ga0495642_0078201
431 Ga0495586_0216235
432 Ga0495622_0043197
433 Ga0495625_0042795
434 Ga0495625_0377443
435 Ga0495658_0085232
436 Ga0495613_0466058
437 Ga0495624_0045429
438 Ga0495649_0033258
439 Ga0495660_0042622
440 Ga0495636_0042978
441 Ga0495687_023850
442 Ga0496110_0155614
443 Ga0501033_0593107
444 Ga0501036_0042208
445 Ga0501038_0110112
446 Ga0501039_0010471
447 Ga0501041_0002717
448 Ga0501041_0643390
449 Ga0501042_0006296
450 Ga0501043_0295887
451 Ga0501068_0506612
452 Ga0501071_0018430
453 Ga0501072_0047461
454 Ga0501074_0081958
455 Ga0501075_0011570
456 Ga0501076_0013139
457 Ga0501198_000008
458 Ga0501222_000006
459 Ga0501079_0010158
460 Ga0501080_0016792
461 Ga0501083_0063748
462 Ga0501035_0299817
463 Ga0501045_0000802
464 nmdc:mga03683_243628_c1
465 nmdc:mga03683_5784_c1
466 nmdc:mga03n38_358689_c1
467 nmdc:mga00v17_45480_c1
468 nmdc:mga0yw44_371895_c1
469 nmdc:mga0k408_15965_c1
470 nmdc:mga0k408_240370_c1
471 nmdc:mga0k408_27152_c1
472 nmdc:mga0k408_330364_c1
473 nmdc:mga0k408_35935_c1
474 nmdc:mga0k408_504621_c1
475 nmdc:mga0k408_539_c1
476 nmdc:mga0k408_552168_c1
477 nmdc:mga0k408_7192_c1
478 nmdc:mga06z11_25203_c1
479 nmdc:mga06z11_53659_c1
480 nmdc:mga06z11_871325_c1
481 nmdc:mga04h51_16719_c1
482 nmdc:mga07m45_151920_c1
483 nmdc:mga07m45_164979_c1
484 nmdc:mga07m45_18434_c1
485 nmdc:mga07m45_20909_c1
486 nmdc:mga07m45_91948_c1
487 nmdc:mga09592_23071_c1
488 nmdc:mga0qj67_80070_c1
489 nmdc:mga0sz30_12037_c1
490 nmdc:mga0sz30_57889_c1
491 Ga0495612_0489002
492 Ga0500658_0025994
493 Ga0500568_0184908
494 Ga0590071_001647
495 Ga0501082_0006899
496 Ga0530510_0000189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

57

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j3u-assembly1.cif.gz_A co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp 0.9401 2 115
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9357 2 118
5l0n-assembly1.cif.gz_A pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp 0.9277 2 117
3d0s-assembly1.cif.gz_B camp receptor protein from m.tuberculosis, camp-free form 0.9207 6 146
4qx5-assembly1.cif.gz_A neutron diffraction reveals hydrogen bonds critical for cgmp-selective activation: insights for pkg agonist design 0.9167 2 115
ID Description Score Start End Superfamily
af_I1KW21_370_502_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9441 8 137 2.60.120.10
af_K7KIP4_365_503_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9405 6 135 2.60.120.10
5j3uA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9401 2 115 2.60.120.10
af_A0A1D6MG59_318_428_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9362 1 106 2.60.120.10
af_Q7T2E5_217_352_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.935 15 117 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q5XLZ7-F1-model_v4 deleted 0.9897 1 143
AF-A0A1L8CND9-F1-model_v4 cAMP-activated global transcriptional regulator CRP 0.9865 2 150 GO:0003254
GO:0005249
GO:0035725
GO:0098855
AF-A0A2A5CP62-F1-model_v4 Cyclic nucleotide-binding protein 0.9851 1 148 GO:0003700
GO:0005829
GO:0016020
GO:0034220
AF-A0A2N2RRB6-F1-model_v4 Cyclic nucleotide-binding protein 0.9827 1 152 GO:0003700
GO:0005829
AF-A0A2D6MM48-F1-model_v4 Cyclic nucleotide-binding protein 0.98 1 152 GO:0005249
GO:0005886
GO:0042391

Map