F359994

General Info

Members Datasets Scaffolds Average Seq Length
248 145 496 276

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10000358|Ga0316575_100003585
Length 303
Sequence VGRDVIVLFQGLATALSRPGGYAAVHPMSDKLKVGAVQMATGPNVSANLFEAERLVKEAAEGGADLVVLPENFAFMGKRAGDQLPLREEDGKGPLQGFLSRVAQQHNVWLVGGTIPLVSEDGGRVRASCLVFDGSGRQVARYDKMHLFDVCLPGVDECYQESATIEPGESVVVIDSPFGRLGVAVCYDLRFPELFRQMLDKGVEILAIPSAFTAITGKAHWETLVRARAIENLAYVVAAAQGGFHLNGRETHGHSMVVDPWGTVLAQVPRGAGFVCCALDREFQGAVRRNFPTIAHRRLKCGP

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
62 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
63 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
64 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
80 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
81 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
82 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
83 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
84 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
87 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
144 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
145 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 3.63
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 0.81
Rhizosphere 74.6
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10000358 3300031665 Bacteria 12972
2 Ga0070658_10002972 3300005327 Bacteria 14045
3 Ga0070658_10021299 3300005327 Bacteria 5194
4 Ga0070683_100191142 3300005329 Bacteria 1943
5 Ga0070670_100044960 3300005331 Bacteria 3795
6 Ga0070680_100035168 3300005336 Bacteria 4043
7 Ga0070680_100045601 3300005336 Bacteria 3565
8 Ga0070660_100077302 3300005339 Bacteria 2608
9 Ga0070660_100178459 3300005339 Bacteria 1718
10 Ga0070659_100019018 3300005366 Bacteria 5194
11 Ga0070713_100055442 3300005436 Bacteria 3293
12 Ga0070711_100013435 3300005439 Bacteria 5143
13 Ga0070678_100387843 3300005456 Bacteria 1210
14 Ga0070662_100021169 3300005457 Bacteria 4438
15 Ga0070679_100033302 3300005530 Bacteria 5102
16 Ga0070684_100096943 3300005535 Bacteria 2629
17 Ga0070665_100000668 3300005548 Bacteria 46152
18 Ga0068855_100020724 3300005563 Bacteria 7884
19 Ga0068857_100108863 3300005577 Bacteria 2490
20 Ga0068866_10074307 3300005718 Bacteria 1807
21 Ga0075368_10058711 3300006042 Bacteria 1538
22 Ga0075363_100034938 3300006048 Bacteria 2627
23 Ga0075362_10001125 3300006177 Bacteria 8319
24 Ga0075369_10019683 3300006186 Bacteria 2758
25 Ga0075429_100129923 3300006880 Bacteria 2203
26 Ga0105240_10020114 3300009093 Bacteria 8911
27 Ga0105240_10151521 3300009093 Bacteria 2761
28 Ga0105245_10084642 3300009098 Bacteria 2906
29 Ga0105237_10228569 3300009545 Bacteria 1861
30 Ga0105238_10560015 3300009551 Bacteria 1148
31 Ga0157370_10018149 3300013104 Bacteria 7081
32 Ga0157369_10107629 3300013105 Bacteria 2966
33 Ga0157380_10743590 3300014326 Bacteria 991
34 Ga0207705_10028538 3300025909 Bacteria 3979
35 Ga0207695_10059444 3300025913 Bacteria 3963
36 Ga0207671_10095346 3300025914 Bacteria 2247
37 Ga0207660_10045395 3300025917 Bacteria 3095
38 Ga0207652_10054975 3300025921 Bacteria 3423
39 Ga0207694_10208679 3300025924 Bacteria 1591
40 Ga0207687_10312237 3300025927 Bacteria 1270
41 Ga0207709_10062011 3300025935 Bacteria 2338
42 Ga0207670_10187706 3300025936 Bacteria 1562
43 Ga0207689_10196812 3300025942 Bacteria 1663
44 Ga0207661_10499953 3300025944 Bacteria 1111
45 Ga0207667_10213345 3300025949 Bacteria 1978
46 Ga0207667_10286181 3300025949 Bacteria 1684
47 Ga0207702_10137704 3300026078 Bacteria 2205
48 Ga0207676_10236502 3300026095 Bacteria 1636
49 Ga0207675_100132899 3300026118 Bacteria 2360
50 Ga0207683_10016642 3300026121 Bacteria 6257
51 Ga0268266_10000497 3300028379 Bacteria 56202
52 Ga0268266_10207061 3300028379 Bacteria 1798
53 Ga0307515_10048284 3300028794 Bacteria 6440
54 Ga0265332_10020552 3300031238 Bacteria 2915
55 Ga0265332_10040517 3300031238 Bacteria 2017
56 Ga0265325_10000567 3300031241 Bacteria 26847
57 Ga0265325_10008178 3300031241 Bacteria 6196
58 Ga0265329_10027811 3300031242 Bacteria 1857
59 Ga0265331_10035283 3300031250 Bacteria 2462
60 Ga0265331_10044748 3300031250 Bacteria 2139
61 Ga0265331_10100290 3300031250 Bacteria 1333
62 Ga0265327_10001988 3300031251 Bacteria 23227
63 Ga0265327_10002891 3300031251 Bacteria 17263
64 Ga0265327_10004430 3300031251 Bacteria 12435
65 Ga0265327_10027025 3300031251 Bacteria 3310
66 Ga0265316_10001029 3300031344 Bacteria 30211
67 Ga0265313_10011247 3300031595 Bacteria 5577
68 Ga0316579_10000737 3300031691 Bacteria 11223
69 Ga0265342_10050475 3300031712 Bacteria 2485
70 Ga0316576_10004522 3300031727 Bacteria 8358
71 Ga0316576_10005705 3300031727 Bacteria 7652
72 Ga0316576_10014774 3300031727 Bacteria 5221
73 Ga0316576_10015202 3300031727 Bacteria 5160
74 Ga0316576_10024280 3300031727 Bacteria 4231
75 Ga0316578_10000029 3300031728 Bacteria 29549
76 Ga0316578_10004235 3300031728 Bacteria 6737
77 Ga0316578_10005592 3300031728 Bacteria 6114
78 Ga0316578_10018856 3300031728 Bacteria 3789
79 Ga0316577_10003829 3300031733 Bacteria 7665
80 Ga0316577_10007465 3300031733 Bacteria 5834
81 Ga0316577_10007797 3300031733 Bacteria 5717
82 Ga0307409_100007367 3300031995 Bacteria 6574
83 Ga0316583_10020864 3300032133 Bacteria 2348
84 Ga0316585_10000035 3300032137 Bacteria 20542
85 Ga0316585_10005932 3300032137 Bacteria 3469
86 Ga0316580_10000414 3300032139 Bacteria 9693
87 Ga0316580_10001871 3300032139 Bacteria 5648
88 Ga0316580_10002660 3300032139 Bacteria 4965
89 Ga0316593_10000740 3300032168 Bacteria 6436
90 Ga0316592_1005412 3300033524 Bacteria 2422
91 Ga0316586_1001774 3300033527 Bacteria 2567
92 Ga0316587_1009971 3300033529 Bacteria 1514
93 Ga0316587_1017685 3300033529 Bacteria 1196
94 Ga0316596_1000386 3300033541 Bacteria 7286
95 Ga0316596_1000750 3300033541 Bacteria 5926
96 Ga0316596_1002007 3300033541 Bacteria 4274
97 Ga0316596_1009224 3300033541 Unclassified 2365
98 Ga0373934_0050361 3300035086 Bacteria 1650
99 Ga0373961_0027413 3300035241 Bacteria 1564
100 Ga0316574_0000212 3300035398 Bacteria 20505
101 Ga0316574_0000401 3300035398 Bacteria 17053
102 Ga0316574_0000650 3300035398 Bacteria 14580
103 Ga0316574_0076457 3300035398 Unclassified 2121
104 Ga0316574_0137515 3300035398 Bacteria 1573
105 Ga0373937_0074394 3300036401 Bacteria 3135
106 Ga0316582_0002028 3300036647 Bacteria 9309
107 Ga0316582_0006005 3300036647 Bacteria 6326
108 Ga0316582_0006925 3300036647 Bacteria 5997
109 Ga0316582_0062792 3300036647 Bacteria 2386
110 Ga0316582_0212725 3300036647 Bacteria 1321
111 Ga0316584_0001073 3300036712 Bacteria 15985
112 Ga0316584_0010658 3300036712 Bacteria 6435
113 Ga0316584_0022131 3300036712 Bacteria 4633
114 Ga0316584_0057481 3300036712 Bacteria 2912
115 Ga0316584_0264883 3300036712 Bacteria 1252
116 Ga0395899_0114051 3300037312 Bacteria 1941
117 Ga0395900_0141722 3300037418 Bacteria 2461
118 Ga0395898_0016117 3300037466 Bacteria 7655
119 Ga0436364_0089256 3300037853 Bacteria 2029
120 Ga0400484_17281 3300038725 Bacteria 3627
121 Ga0400484_19478 3300038725 Bacteria 1219
122 Ga0400484_34222 3300038725 Bacteria 5492
123 Ga0400484_34961 3300038725 Bacteria 12804
124 Ga0400484_38567 3300038725 Bacteria 35178
125 Ga0400490_16260 3300038726 Bacteria 13490
126 Ga0400490_32808 3300038726 Bacteria 38395
127 Ga0400490_35100 3300038726 Bacteria 2577
128 Ga0400490_36313 3300038726 Bacteria 24937
129 Ga0400490_40869 3300038726 Bacteria 29740
130 Ga0400490_43295 3300038726 Bacteria 12178
131 Ga0400490_46726 3300038726 Bacteria 3164
132 Ga0400491_06223 3300038727 Bacteria 6791
133 Ga0400491_14655 3300038727 Bacteria 6159
134 Ga0400485_13909 3300038735 Bacteria 37576
135 Ga0400485_20799 3300038735 Bacteria 49242
136 Ga0400488_04393 3300038741 Bacteria 47674
137 Ga0400488_10962 3300038741 Bacteria 1858
138 Ga0400488_12571 3300038741 Bacteria 6696
139 Ga0400488_16647 3300038741 Bacteria 2389
140 Ga0400488_29012 3300038741 Bacteria 2678
141 Ga0400488_45945 3300038741 Bacteria 1291
142 Ga0400488_50827 3300038741 Bacteria 4031
143 Ga0400486_06423 3300038742 Bacteria 5703
144 Ga0400486_07315 3300038742 Bacteria 13534
145 Ga0400486_20387 3300038742 Bacteria 23929
146 Ga0400486_28155 3300038742 Bacteria 181974
147 Ga0400486_32511 3300038742 Bacteria 2693
148 Ga0400483_019626 3300039062 Bacteria 5865
149 Ga0400483_065264 3300039062 Bacteria 20623
150 Ga0400483_079851 3300039062 Bacteria 2090
151 Ga0400483_136609 3300039062 Bacteria 8498
152 Ga0400483_140583 3300039062 Bacteria 6131
153 Ga0400483_182755 3300039062 Bacteria 4022
154 Ga0400483_193846 3300039062 Bacteria 9458
155 Ga0400483_195115 3300039062 Bacteria 14143
156 Ga0400483_198657 3300039062 Unclassified 3615
157 Ga0400483_249376 3300039062 Bacteria 3821
158 Ga0400483_251652 3300039062 Bacteria 19910
159 Ga0400483_267332 3300039062 Bacteria 16959
160 Ga0400483_268164 3300039062 Bacteria 11234
161 Ga0400489_25033 3300039093 Bacteria 1328
162 Ga0400487_04362 3300039110 Bacteria 21967
163 Ga0400487_07554 3300039110 Bacteria 1218
164 Ga0400487_24375 3300039110 Bacteria 1680
165 Ga0400487_37173 3300039110 Bacteria 37804
166 Ga0400487_47978 3300039110 Bacteria 63574
167 Ga0400487_66210 3300039110 Bacteria 2014
168 Ga0436362_0106078 3300039453 Bacteria 2997
169 Ga0451807_1711105 3300041486 Bacteria 939
170 Ga0451577_0000100 3300042876 Bacteria 191528
171 Ga0451577_0150730 3300042876 Unclassified 2092
172 Ga0451577_0154880 3300042876 Bacteria 2062
173 Ga0453683_0027108 3300044673 Bacteria 3638
174 Ga0453684_0001269 3300044712 Bacteria 75684
175 Ga0453684_0089199 3300044712 Bacteria 3815
176 Ga0453684_0463138 3300044712 Bacteria 1409
177 Ga0451576_0001543 3300045051 Bacteria 38777
178 Ga0451576_0102163 3300045051 Bacteria 2982
179 Ga0451576_0292771 3300045051 Bacteria 1702
180 Ga0495617_084046 3300046452 Bacteria 1042
181 Ga0495603_0065019 3300046455 Bacteria 2150
182 Ga0495591_017749 3300046458 Bacteria 2433
183 Ga0495639_0114735 3300046475 Bacteria 1281
184 Ga0495644_0006597 3300046523 Bacteria 4497
185 Ga0495652_0097368 3300046529 Bacteria 2393
186 Ga0495621_0003912 3300046539 Bacteria 4138
187 Ga0495633_0034774 3300046558 Bacteria 2422
188 Ga0495656_0064039 3300046615 Bacteria 1613
189 Ga0495657_0121038 3300046675 Bacteria 1648
190 Ga0495647_0000661 3300046681 Bacteria 10230
191 Ga0495658_0111693 3300046683 Bacteria 1644
192 Ga0495589_0210646 3300046794 Bacteria 915
193 Ga0495581_0132594 3300047315 Bacteria 1452
194 Ga0495680_0096628 3300047322 Bacteria 2206
195 Ga0495681_0011737 3300047470 Bacteria 5192
196 Ga0496100_0200222 3300048903 Bacteria 1455
197 Ga0501031_0000836 3300049568 Bacteria 18536
198 Ga0501032_0001961 3300049569 Bacteria 16186
199 Ga0501033_0004643 3300049570 Bacteria 10995
200 Ga0501033_0028432 3300049570 Bacteria 4200
201 Ga0501033_0047725 3300049570 Bacteria 3183
202 Ga0501033_0168722 3300049570 Bacteria 1572
203 Ga0501034_0003078 3300049571 Bacteria 19243
204 Ga0501034_0110623 3300049571 Bacteria 2738
205 Ga0501034_0592281 3300049571 Bacteria 1015
206 Ga0501036_0005721 3300049572 Bacteria 10082
207 Ga0501036_0258513 3300049572 Bacteria 1459
208 Ga0501037_0005516 3300049573 Bacteria 9226
209 Ga0501037_0072902 3300049573 Bacteria 2497
210 Ga0501038_0006975 3300049574 Bacteria 10432
211 Ga0501038_0042619 3300049574 Bacteria 3953
212 Ga0501039_0003041 3300049575 Bacteria 12547
213 Ga0501042_0031375 3300049578 Bacteria 3758
214 Ga0501043_0051444 3300049579 Bacteria 3236
215 Ga0501047_0005547 3300049581 Bacteria 11874
216 Ga0501048_0007122 3300049582 Bacteria 8498
217 Ga0501067_0064163 3300049583 Bacteria 2034
218 Ga0501068_0015175 3300049584 Bacteria 4420
219 Ga0501069_0004524 3300049585 Bacteria 7184
220 Ga0501070_0008822 3300049586 Bacteria 8523
221 Ga0501070_0031658 3300049586 Bacteria 4431
222 Ga0501073_0044348 3300049589 Bacteria 3134
223 Ga0501076_0145236 3300049592 Bacteria 1929
224 Ga0501079_0000561 3300049741 Bacteria 24401
225 Ga0501080_0034155 3300049742 Bacteria 4747
226 Ga0501080_0063903 3300049742 Bacteria 3424
227 Ga0501080_0123740 3300049742 Bacteria 2396
228 Ga0501083_0004935 3300049744 Bacteria 9443
229 Ga0501035_0000371 3300049822 Bacteria 51668
230 Ga0501035_0070236 3300049822 Bacteria 3103
231 Ga0501035_0252713 3300049822 Bacteria 1496
232 Ga0501044_0034868 3300049823 Bacteria 5274
233 Ga0501044_0101273 3300049823 Bacteria 2898
234 Ga0501044_0627848 3300049823 Bacteria 965
235 Ga0501044_0766241 3300049823 Bacteria 846
236 Ga0501045_0008637 3300049824 Bacteria 7102
237 nmdc:mga03n38_34083_c1 3300050490 Bacteria 2172
238 nmdc:mga09592_50107_c1 3300050508 Bacteria 3522
239 nmdc:mga0sz30_81605_c1 3300050516 Bacteria 1400
240 Ga0500647_0155098 3300053091 Bacteria 1066
241 Ga0500568_0043977 3300053139 Bacteria 1783
242 Ga0500616_0183154 3300053153 Bacteria 941
243 Ga0501084_0435390 3300054114 Bacteria 1108
244 Ga0501082_0011118 3300060353 Bacteria 7740
245 Ga0501082_0014737 3300060353 Bacteria 6732
246 2643758957 2643221547 Bacteria 4740017
247 2887632873 2887630918 Bacteria 3239855
248 2954744552 2954740390 Bacteria 10229294
249 Ga0316575_10000358
250 Ga0070658_10002972
251 Ga0070658_10021299
252 Ga0070683_100191142
253 Ga0070670_100044960
254 Ga0070680_100035168
255 Ga0070680_100045601
256 Ga0070660_100077302
257 Ga0070660_100178459
258 Ga0070659_100019018
259 Ga0070713_100055442
260 Ga0070711_100013435
261 Ga0070678_100387843
262 Ga0070662_100021169
263 Ga0070679_100033302
264 Ga0070684_100096943
265 Ga0070665_100000668
266 Ga0068855_100020724
267 Ga0068857_100108863
268 Ga0068866_10074307
269 Ga0075368_10058711
270 Ga0075363_100034938
271 Ga0075362_10001125
272 Ga0075369_10019683
273 Ga0075429_100129923
274 Ga0105240_10020114
275 Ga0105240_10151521
276 Ga0105245_10084642
277 Ga0105237_10228569
278 Ga0105238_10560015
279 Ga0157370_10018149
280 Ga0157369_10107629
281 Ga0157380_10743590
282 Ga0207705_10028538
283 Ga0207695_10059444
284 Ga0207671_10095346
285 Ga0207660_10045395
286 Ga0207652_10054975
287 Ga0207694_10208679
288 Ga0207687_10312237
289 Ga0207709_10062011
290 Ga0207670_10187706
291 Ga0207689_10196812
292 Ga0207661_10499953
293 Ga0207667_10213345
294 Ga0207667_10286181
295 Ga0207702_10137704
296 Ga0207676_10236502
297 Ga0207675_100132899
298 Ga0207683_10016642
299 Ga0268266_10000497
300 Ga0268266_10207061
301 Ga0307515_10048284
302 Ga0265332_10020552
303 Ga0265332_10040517
304 Ga0265325_10000567
305 Ga0265325_10008178
306 Ga0265329_10027811
307 Ga0265331_10035283
308 Ga0265331_10044748
309 Ga0265331_10100290
310 Ga0265327_10001988
311 Ga0265327_10002891
312 Ga0265327_10004430
313 Ga0265327_10027025
314 Ga0265316_10001029
315 Ga0265313_10011247
316 Ga0316579_10000737
317 Ga0265342_10050475
318 Ga0316576_10004522
319 Ga0316576_10005705
320 Ga0316576_10014774
321 Ga0316576_10015202
322 Ga0316576_10024280
323 Ga0316578_10000029
324 Ga0316578_10004235
325 Ga0316578_10005592
326 Ga0316578_10018856
327 Ga0316577_10003829
328 Ga0316577_10007465
329 Ga0316577_10007797
330 Ga0307409_100007367
331 Ga0316583_10020864
332 Ga0316585_10000035
333 Ga0316585_10005932
334 Ga0316580_10000414
335 Ga0316580_10001871
336 Ga0316580_10002660
337 Ga0316593_10000740
338 Ga0316592_1005412
339 Ga0316586_1001774
340 Ga0316587_1009971
341 Ga0316587_1017685
342 Ga0316596_1000386
343 Ga0316596_1000750
344 Ga0316596_1002007
345 Ga0316596_1009224
346 Ga0373934_0050361
347 Ga0373961_0027413
348 Ga0316574_0000212
349 Ga0316574_0000401
350 Ga0316574_0000650
351 Ga0316574_0076457
352 Ga0316574_0137515
353 Ga0373937_0074394
354 Ga0316582_0002028
355 Ga0316582_0006005
356 Ga0316582_0006925
357 Ga0316582_0062792
358 Ga0316582_0212725
359 Ga0316584_0001073
360 Ga0316584_0010658
361 Ga0316584_0022131
362 Ga0316584_0057481
363 Ga0316584_0264883
364 Ga0395899_0114051
365 Ga0395900_0141722
366 Ga0395898_0016117
367 Ga0436364_0089256
368 Ga0400484_17281
369 Ga0400484_19478
370 Ga0400484_34222
371 Ga0400484_34961
372 Ga0400484_38567
373 Ga0400490_16260
374 Ga0400490_32808
375 Ga0400490_35100
376 Ga0400490_36313
377 Ga0400490_40869
378 Ga0400490_43295
379 Ga0400490_46726
380 Ga0400491_06223
381 Ga0400491_14655
382 Ga0400485_13909
383 Ga0400485_20799
384 Ga0400488_04393
385 Ga0400488_10962
386 Ga0400488_12571
387 Ga0400488_16647
388 Ga0400488_29012
389 Ga0400488_45945
390 Ga0400488_50827
391 Ga0400486_06423
392 Ga0400486_07315
393 Ga0400486_20387
394 Ga0400486_28155
395 Ga0400486_32511
396 Ga0400483_019626
397 Ga0400483_065264
398 Ga0400483_079851
399 Ga0400483_136609
400 Ga0400483_140583
401 Ga0400483_182755
402 Ga0400483_193846
403 Ga0400483_195115
404 Ga0400483_198657
405 Ga0400483_249376
406 Ga0400483_251652
407 Ga0400483_267332
408 Ga0400483_268164
409 Ga0400489_25033
410 Ga0400487_04362
411 Ga0400487_07554
412 Ga0400487_24375
413 Ga0400487_37173
414 Ga0400487_47978
415 Ga0400487_66210
416 Ga0436362_0106078
417 Ga0451807_1711105
418 Ga0451577_0000100
419 Ga0451577_0150730
420 Ga0451577_0154880
421 Ga0453683_0027108
422 Ga0453684_0001269
423 Ga0453684_0089199
424 Ga0453684_0463138
425 Ga0451576_0001543
426 Ga0451576_0102163
427 Ga0451576_0292771
428 Ga0495617_084046
429 Ga0495603_0065019
430 Ga0495591_017749
431 Ga0495639_0114735
432 Ga0495644_0006597
433 Ga0495652_0097368
434 Ga0495621_0003912
435 Ga0495633_0034774
436 Ga0495656_0064039
437 Ga0495657_0121038
438 Ga0495647_0000661
439 Ga0495658_0111693
440 Ga0495589_0210646
441 Ga0495581_0132594
442 Ga0495680_0096628
443 Ga0495681_0011737
444 Ga0496100_0200222
445 Ga0501031_0000836
446 Ga0501032_0001961
447 Ga0501033_0004643
448 Ga0501033_0028432
449 Ga0501033_0047725
450 Ga0501033_0168722
451 Ga0501034_0003078
452 Ga0501034_0110623
453 Ga0501034_0592281
454 Ga0501036_0005721
455 Ga0501036_0258513
456 Ga0501037_0005516
457 Ga0501037_0072902
458 Ga0501038_0006975
459 Ga0501038_0042619
460 Ga0501039_0003041
461 Ga0501042_0031375
462 Ga0501043_0051444
463 Ga0501047_0005547
464 Ga0501048_0007122
465 Ga0501067_0064163
466 Ga0501068_0015175
467 Ga0501069_0004524
468 Ga0501070_0008822
469 Ga0501070_0031658
470 Ga0501073_0044348
471 Ga0501076_0145236
472 Ga0501079_0000561
473 Ga0501080_0034155
474 Ga0501080_0063903
475 Ga0501080_0123740
476 Ga0501083_0004935
477 Ga0501035_0000371
478 Ga0501035_0070236
479 Ga0501035_0252713
480 Ga0501044_0034868
481 Ga0501044_0101273
482 Ga0501044_0627848
483 Ga0501044_0766241
484 Ga0501045_0008637
485 nmdc:mga03n38_34083_c1
486 nmdc:mga09592_50107_c1
487 nmdc:mga0sz30_81605_c1
488 Ga0500647_0155098
489 Ga0500568_0043977
490 Ga0500616_0183154
491 Ga0501084_0435390
492 Ga0501082_0011118
493 Ga0501082_0014737
494 2643758957
495 2887632873
496 2954744552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

33

289

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.9406 6 271
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9246 2 271
4hg3-assembly2.cif.gz_D structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate 0.9221 5 272
4h5u-assembly2.cif.gz_D-3 structural insights into yeast nit2: wild-type yeast nit2 0.9184 7 272
4hgd-assembly1.cif.gz_D structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand 0.9174 7 272
ID Description Score Start End Superfamily
af_Q94JV5_26_305_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9521 6 273 3.60.110.10
af_O94660_4_273_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9498 10 265 3.60.110.10
af_Q557J5_4_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9472 6 271 3.60.110.10
af_Q8VDK1_45_315_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9422 10 271 3.60.110.10
af_Q9VHE4_6_282_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9385 5 271 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2N6BAK1-F1-model_v4 Amidohydrolase 0.9811 156 277 GO:0016787
AF-A0A1J4RIL7-F1-model_v4 CN hydrolase domain-containing protein 0.969 5 274 GO:0016811
AF-A0A1B9TDB6-F1-model_v4 deleted 0.9671 5 277
AF-A0A2E5HD69-F1-model_v4 Amidohydrolase 0.9669 6 274 GO:0016811
AF-A0A7Z8PGK8-F1-model_v4 deleted 0.9668 5 277

Map