F359831

General Info

Members Datasets Scaffolds Average Seq Length
248 181 242 180

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10202207|Ga0105240_102022072
Length 218
Sequence MFPVGENVERNYGIVPQEAPGTRCAASVYDRLRSLTTSEPMSEPIHTAPAWQDAIFEALKSARVRQVAYVPDAGHAHLIRRAIADPEIDDVVLTTEEEGVALACGAWLGGERAVLLMQSSGVGNCVNMFSLLQAGDFPFFALVTMRGEFAEFNPWQGPMGKRTQAALELMGIHVLRVSHAEEAEEVVSAGLDAAFEAGDRVAVLLGQRLIGRKKWKRR

Samples

Sample ID Description Type Environment
1 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
2 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
3 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
4 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
5 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
6 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
102 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
103 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
166 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
167 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
168 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
169 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
170 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
175 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
176 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
179 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.4
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.82
Nodule 0.81
Rhizoplane 3.63
Rhizosphere 56.45
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000577 3300003187 Bacteria 32678
2 Ga0070670_100000018 3300005331 Bacteria 221691
3 Ga0070670_100194416 3300005331 Bacteria 1762
4 Ga0070666_10021080 3300005335 Bacteria 4220
5 Ga0070669_100036683 3300005353 Bacteria 3554
6 Ga0070671_100000755 3300005355 Bacteria 23162
7 Ga0070673_100077132 3300005364 Bacteria 2693
8 Ga0070659_100176610 3300005366 Bacteria 1751
9 Ga0070667_100000002 3300005367 Bacteria 504831
10 Ga0070708_100339816 3300005445 Bacteria 1415
11 Ga0070685_10000003 3300005466 Bacteria 283138
12 Ga0070706_100001696 3300005467 Bacteria 22935
13 Ga0070707_100080526 3300005468 Bacteria 3143
14 Ga0070698_100026347 3300005471 Bacteria 6051
15 Ga0070699_100025996 3300005518 Bacteria 5048
16 Ga0070704_100433531 3300005549 Bacteria 1128
17 Ga0068855_100014536 3300005563 Bacteria 9481
18 Ga0068855_100028669 3300005563 Bacteria 6661
19 Ga0068855_100517296 3300005563 Bacteria 1295
20 Ga0068854_100472633 3300005578 Bacteria 1051
21 Ga0070702_100176539 3300005615 Bacteria 1394
22 Ga0068859_100225443 3300005617 Bacteria 1962
23 Ga0068864_100000002 3300005618 Bacteria 658857
24 Ga0068864_100127751 3300005618 Bacteria 2280
25 Ga0068863_100162888 3300005841 Bacteria 2138
26 Ga0068858_100549496 3300005842 Bacteria 1118
27 Ga0068862_100027005 3300005844 Bacteria 4828
28 Ga0068862_100137902 3300005844 Bacteria 2163
29 Ga0075363_100005959 3300006048 Bacteria 5495
30 Ga0075363_100039008 3300006048 Bacteria 2499
31 Ga0075364_10001007 3300006051 Bacteria 14921
32 Ga0075364_10210897 3300006051 Bacteria 1317
33 Ga0075364_10238035 3300006051 Bacteria 1236
34 Ga0075362_10004185 3300006177 Bacteria 5149
35 Ga0075362_10026615 3300006177 Bacteria 2472
36 Ga0075362_10105647 3300006177 Bacteria 1321
37 Ga0075367_10408095 3300006178 Bacteria 859
38 Ga0075369_10140910 3300006186 Bacteria 1099
39 Ga0075366_10008335 3300006195 Bacteria 5757
40 Ga0075366_10024268 3300006195 Bacteria 3537
41 Ga0075366_10050926 3300006195 Bacteria 2460
42 Ga0075366_10083694 3300006195 Bacteria 1907
43 Ga0075366_10101778 3300006195 Bacteria 1724
44 Ga0097621_100644339 3300006237 Bacteria 972
45 Ga0075370_10008840 3300006353 Bacteria 5201
46 Ga0075370_10169621 3300006353 Bacteria 1283
47 Ga0068871_101285172 3300006358 Bacteria 688
48 Ga0075430_100004962 3300006846 Bacteria 11199
49 Ga0075429_100005817 3300006880 Bacteria 10639
50 Ga0075436_100288480 3300006914 Bacteria 1174
51 Ga0097620_100225442 3300006931 Bacteria 1962
52 Ga0099795_10113452 3300007788 Bacteria 1077
53 Ga0105240_10202207 3300009093 Bacteria 2327
54 Ga0105248_10352620 3300009177 Bacteria 1657
55 Ga0105248_10690237 3300009177 Bacteria 1152
56 Ga0105249_10183806 3300009553 Bacteria 2036
57 Ga0105239_11163392 3300010375 Bacteria 889
58 Ga0157370_10000335 3300013104 Bacteria 59202
59 Ga0157370_10010674 3300013104 Bacteria 9662
60 Ga0157378_10450774 3300013297 Bacteria 1277
61 Ga0163162_10103461 3300013306 Bacteria 2942
62 Ga0163162_10361467 3300013306 Bacteria 1585
63 Ga0163162_10484000 3300013306 Bacteria 1369
64 Ga0157372_10217911 3300013307 Bacteria 2212
65 Ga0157372_12101891 3300013307 Bacteria 649
66 Ga0157375_10443723 3300013308 Bacteria 1463
67 Ga0163163_10000128 3300014325 Bacteria 78848
68 Ga0182008_10000377 3300014497 Bacteria 34436
69 Ga0182006_1021268 3300015261 Bacteria 2707
70 Ga0163161_10548976 3300017792 Bacteria 947
71 Ga0206353_10735147 3300020082 Bacteria 1626
72 Ga0207425_1055374 3300025245 Bacteria 712
73 Ga0209129_1001072 3300025258 Bacteria 16142
74 Ga0209129_1040249 3300025258 Bacteria 743
75 Ga0209673_1001085 3300025273 Bacteria 30631
76 Ga0209676_1001213 3300025292 Bacteria 27426
77 Ga0209025_1000049 3300025294 Bacteria 333459
78 Ga0209025_1000432 3300025294 Bacteria 82875
79 Ga0209050_1001546 3300025298 Bacteria 24090
80 Ga0207426_1095747 3300025302 Bacteria 776
81 Ga0209051_1001880 3300025303 Bacteria 16459
82 Ga0209051_1083265 3300025303 Bacteria 915
83 Ga0207680_10034199 3300025903 Bacteria 2906
84 Ga0207647_10002140 3300025904 Bacteria 15091
85 Ga0207684_10001749 3300025910 Bacteria 22938
86 Ga0207707_10461114 3300025912 Bacteria 1087
87 Ga0207681_10071399 3300025923 Bacteria 2422
88 Ga0207694_10102695 3300025924 Bacteria 2267
89 Ga0207650_10000002 3300025925 Bacteria 1439222
90 Ga0207650_10136240 3300025925 Bacteria 1926
91 Ga0207644_10000673 3300025931 Bacteria 21534
92 Ga0207644_10582296 3300025931 Bacteria 928
93 Ga0207711_10000765 3300025941 Bacteria 31593
94 Ga0207711_10002844 3300025941 Bacteria 15187
95 Ga0207667_10007048 3300025949 Bacteria 13582
96 Ga0207667_10116028 3300025949 Bacteria 2759
97 Ga0207651_10033973 3300025960 Bacteria 3297
98 Ga0207658_10000001 3300025986 Bacteria 1439333
99 Ga0207703_10243761 3300026035 Bacteria 1617
100 Ga0207703_10794183 3300026035 Bacteria 903
101 Ga0207639_10073041 3300026041 Bacteria 2688
102 Ga0207641_10008813 3300026088 Bacteria 8332
103 Ga0207641_10209580 3300026088 Bacteria 1802
104 Ga0207641_10212062 3300026088 Bacteria 1791
105 Ga0207641_10759450 3300026088 Bacteria 957
106 Ga0207676_10000001 3300026095 Bacteria 1439222
107 Ga0207676_10105634 3300026095 Bacteria 2345
108 Ga0207675_100395783 3300026118 Bacteria 1360
109 Ga0207698_10118111 3300026142 Bacteria 2239
110 Ga0207428_10149883 3300027907 Bacteria 1776
111 Ga0268266_10002792 3300028379 Bacteria 18206
112 Ga0268266_10061575 3300028379 Bacteria 3237
113 Ga0268265_10001905 3300028380 Bacteria 16581
114 Ga0268265_10287924 3300028380 Bacteria 1473
115 Ga0268265_11186474 3300028380 Bacteria 760
116 Ga0268264_10000004 3300028381 Bacteria 1116842
117 Ga0307515_10583967 3300028794 Bacteria 727
118 Ga0307511_10320179 3300030521 Unclassified 686
119 Ga0265332_10012977 3300031238 Bacteria 3694
120 Ga0265329_10035273 3300031242 Bacteria 1614
121 Ga0265340_10022956 3300031247 Bacteria 3185
122 Ga0265331_10032069 3300031250 Bacteria 2606
123 Ga0265327_10063471 3300031251 Bacteria 1876
124 Ga0307513_10076357 3300031456 Bacteria 3475
125 Ga0307412_10128022 3300031911 Bacteria 1840
126 Ga0307412_11012346 3300031911 Bacteria 735
127 Ga0307414_10018264 3300032004 Bacteria 4312
128 Ga0307414_10841199 3300032004 Bacteria 839
129 Ga0436364_0952628 3300037853 Bacteria 2978
130 Ga0451797_0372352 3300041453 Bacteria 817
131 Ga0451853_1495030 3300041512 Bacteria 13527
132 Ga0439452_106296 3300042010 Bacteria 601
133 Ga0450911_000117 3300042115 Bacteria 31836
134 Ga0450893_0010334 3300042532 Bacteria 1533
135 Ga0451577_0224728 3300042876 Bacteria 1697
136 Ga0451577_0651978 3300042876 Bacteria 955
137 Ga0451577_0985882 3300042876 Bacteria 757
138 Ga0466965_0220187 3300044683 Bacteria 1011
139 Ga0466963_0287775 3300044694 Bacteria 1155
140 Ga0453684_0015372 3300044712 Bacteria 12117
141 Ga0466971_0082416 3300044719 Bacteria 1468
142 Ga0466970_0343955 3300044765 Bacteria 846
143 Ga0466957_0045017 3300044842 Bacteria 2675
144 Ga0466960_0032713 3300044901 Bacteria 2411
145 Ga0451576_0191433 3300045051 Bacteria 2136
146 Ga0451576_0302602 3300045051 Bacteria 1673
147 Ga0466958_0048891 3300045836 Bacteria 2557
148 Ga0466967_0094767 3300045976 Bacteria 2719
149 Ga0495590_0044585 3300046457 Bacteria 1546
150 Ga0495580_0367962 3300046472 Bacteria 972
151 Ga0495584_0091510 3300046491 Bacteria 1534
152 Ga0495620_0339739 3300046515 Bacteria 570
153 Ga0495654_0131187 3300046530 Bacteria 1125
154 Ga0495665_0011202 3300046531 Bacteria 4856
155 Ga0495656_0076937 3300046615 Bacteria 1496
156 Ga0495656_0237236 3300046615 Bacteria 917
157 Ga0495625_0000673 3300046660 Bacteria 48716
158 Ga0495635_0112732 3300046663 Bacteria 1857
159 Ga0495588_0002335 3300046674 Bacteria 8133
160 Ga0495624_0150196 3300046690 Bacteria 1425
161 Ga0495581_0017316 3300047315 Bacteria 4185
162 Ga0495636_0002142 3300047318 Bacteria 7584
163 Ga0495636_0071234 3300047318 Bacteria 1484
164 Ga0495676_0000456 3300047321 Bacteria 33576
165 Ga0495687_014451 3300047443 Bacteria 4064
166 Ga0495593_0003207 3300047673 Bacteria 9813
167 Ga0495593_0054980 3300047673 Bacteria 2097
168 Ga0495602_0077339 3300048088 Bacteria 2816
169 Ga0495614_0000445 3300048089 Bacteria 16992
170 Ga0495626_0002671 3300048091 Bacteria 12079
171 Ga0496100_0245101 3300048903 Bacteria 1324
172 Ga0496102_0193702 3300048905 Bacteria 1916
173 Ga0496104_0089491 3300048907 Bacteria 2941
174 Ga0496104_0764541 3300048907 Bacteria 873
175 Ga0496105_0086965 3300048908 Bacteria 2583
176 Ga0496108_1068488 3300048911 Bacteria 687
177 Ga0496112_0266884 3300048915 Bacteria 1660
178 Ga0496112_0368077 3300048915 Bacteria 1379
179 Ga0496116_0001738 3300048919 Bacteria 23730
180 Ga0496116_0160626 3300048919 Bacteria 1233
181 Ga0496117_0000428 3300048920 Bacteria 70517
182 Ga0496117_0023538 3300048920 Bacteria 4902
183 Ga0496117_0200888 3300048920 Bacteria 1126
184 Ga0496118_0001373 3300048921 Bacteria 36687
185 Ga0496118_0020724 3300048921 Bacteria 5820
186 Ga0496121_0004190 3300048924 Bacteria 19686
187 Ga0496121_0038513 3300048924 Bacteria 4231
188 Ga0496121_0038615 3300048924 Bacteria 4222
189 Ga0496121_0040873 3300048924 Bacteria 4062
190 Ga0496122_0000582 3300048925 Bacteria 74845
191 Ga0496123_0000479 3300048926 Bacteria 69250
192 Ga0496123_0153989 3300048926 Bacteria 1236
193 Ga0496124_0000036 3300048927 Bacteria 318032
194 Ga0496124_0041675 3300048927 Bacteria 3959
195 Ga0496124_0252062 3300048927 Bacteria 1305
196 Ga0496124_0622200 3300048927 Bacteria 698
197 Ga0496125_0060589 3300048928 Bacteria 3040
198 Ga0501047_0172843 3300049581 Bacteria 2029
199 Ga0501280_027905 3300049776 Bacteria 870
200 Ga0501044_0101349 3300049823 Bacteria 2897
201 nmdc:mga03683_277891_c1 3300050489 Bacteria 782
202 nmdc:mga03683_64866_c1 3300050489 Bacteria 1551
203 nmdc:mga00v17_202761_c1 3300050491 Bacteria 1282
204 nmdc:mga00v17_97197_c1 3300050491 Bacteria 1856
205 nmdc:mga0yw44_408303_c1 3300050492 Bacteria 919
206 nmdc:mga0yw44_4500_c1 3300050492 Bacteria 6406
207 nmdc:mga0k408_165025_c1 3300050493 Bacteria 1320
208 nmdc:mga0k408_192283_c1 3300050493 Bacteria 1218
209 nmdc:mga0k408_2618_c1 3300050493 Bacteria 9561
210 nmdc:mga0k408_74590_c1 3300050493 Bacteria 1982
211 nmdc:mga0k408_74764_c1 3300050493 Bacteria 1979
212 nmdc:mga0k408_80734_c1 3300050493 Bacteria 1904
213 nmdc:mga06z11_174979_c1 3300050494 Bacteria 1234
214 nmdc:mga07m45_167573_c1 3300050496 Bacteria 1276
215 nmdc:mga07m45_9626_c1 3300050496 Bacteria 5022
216 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
217 nmdc:mga0qj67_27874_c1 3300050509 Bacteria 4380
218 nmdc:mga0sz30_132519_c1 3300050516 Bacteria 1098
219 Ga0500610_0000141 3300053079 Bacteria 21515
220 Ga0500610_0016329 3300053079 Bacteria 3536
221 Ga0500643_101275 3300053087 Bacteria 781
222 Ga0500643_140542 3300053087 Bacteria 648
223 Ga0500644_0003496 3300053088 Bacteria 3891
224 Ga0500651_0000099 3300053093 Bacteria 53568
225 Ga0500566_0008235 3300053094 Bacteria 6170
226 Ga0500560_003344 3300053107 Bacteria 3231
227 Ga0500562_001385 3300053108 Bacteria 5981
228 Ga0500569_036810 3300053109 Bacteria 1411
229 Ga0500571_000006 3300053110 Bacteria 105538
230 Ga0500597_004806 3300053120 Bacteria 4256
231 Ga0500608_177938 3300053122 Bacteria 904
232 Ga0500618_003284 3300053125 Bacteria 5613
233 Ga0500655_000056 3300053133 Bacteria 30742
234 Ga0500658_0000091 3300053134 Bacteria 41865
235 Ga0500564_051397 3300053138 Bacteria 1885
236 Ga0500574_000057 3300053141 Bacteria 12891
237 Ga0500586_002926 3300053145 Bacteria 3957
238 Ga0500627_0004504 3300053158 Bacteria 4489
239 Ga0500634_0012052 3300053161 Bacteria 4490
240 Ga0500638_014520 3300053162 Bacteria 3594
241 Ga0500636_0049435 3300053177 Bacteria 2474
242 Ga0500565_002343 3300053734 Bacteria 1407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2884811622 2884812129 172
2 iso_pu_bacteria 2884836552 2884841217 172
3 iso_pu_bacteria 2884852848 2884856091 172
4 iso_pu_bacteria 2896154374 2896156983 172
5 iso_pu_bacteria 2765235838 2765570612 173
6 iso_pu_bacteria 2839094727 2839098111 173
7 3300005578 Ga0068854_100472633 Ga0068854_1004726331 174
8 3300006358 Ga0068871_101285172 Ga0068871_1012851721 175
9 3300006914 Ga0075436_100288480 Ga0075436_1002884802 175
10 3300007788 Ga0099795_10113452 Ga0099795_101134522 175
11 3300013307 Ga0157372_12101891 Ga0157372_121018911 175
12 3300045051 Ga0451576_0191433 Ga0451576_0191433_92_634 175
13 3300047318 Ga0495636_0002142 Ga0495636_0002142_3595_4125 175
14 3300049776 Ga0501280_027905 Ga0501280_027905_286_816 175
15 3300005331 Ga0070670_100000018 Ga0070670_100000018144 176
16 3300005335 Ga0070666_10021080 Ga0070666_100210804 176
17 3300005353 Ga0070669_100036683 Ga0070669_1000366833 176
18 3300005355 Ga0070671_100000755 Ga0070671_10000075521 176
19 3300005366 Ga0070659_100176610 Ga0070659_1001766101 176
20 3300005367 Ga0070667_100000002 Ga0070667_10000000283 176
21 3300005466 Ga0070685_10000003 Ga0070685_1000000336 176
22 3300005563 Ga0068855_100028669 Ga0068855_1000286694 176
23 3300005617 Ga0068859_100225443 Ga0068859_1002254431 176
24 3300005618 Ga0068864_100000002 Ga0068864_100000002397 176
25 3300005844 Ga0068862_100137902 Ga0068862_1001379022 176
26 3300006195 Ga0075366_10101778 Ga0075366_101017782 176
27 3300006353 Ga0075370_10169621 Ga0075370_101696211 176
28 3300006931 Ga0097620_100225442 Ga0097620_1002254423 176
29 3300009177 Ga0105248_10352620 Ga0105248_103526202 176
30 3300013297 Ga0157378_10450774 Ga0157378_104507742 176
31 3300013306 Ga0163162_10361467 Ga0163162_103614672 176
32 3300013307 Ga0157372_10217911 Ga0157372_102179113 176
33 3300014325 Ga0163163_10000128 Ga0163163_100001283 176
34 3300015261 Ga0182006_1021268 Ga0182006_10212683 176
35 3300020082 Ga0206353_10735147 Ga0206353_107351471 176
36 3300025303 Ga0209051_1001880 Ga0209051_100188011 176
37 3300025903 Ga0207680_10034199 Ga0207680_100341993 176
38 3300025904 Ga0207647_10002140 Ga0207647_100021407 176
39 3300025912 Ga0207707_10461114 Ga0207707_104611141 176
40 3300025925 Ga0207650_10000002 Ga0207650_10000002393 176
41 3300025931 Ga0207644_10000673 Ga0207644_1000067321 176
42 3300025941 Ga0207711_10000765 Ga0207711_1000076534 176
43 3300025941 Ga0207711_10002844 Ga0207711_100028443 176
44 3300025949 Ga0207667_10007048 Ga0207667_100070488 176
45 3300025986 Ga0207658_10000001 Ga0207658_10000001959 176
46 3300026035 Ga0207703_10243761 Ga0207703_102437612 176
47 3300026088 Ga0207641_10008813 Ga0207641_100088135 176
48 3300026088 Ga0207641_10212062 Ga0207641_102120622 176
49 3300026088 Ga0207641_10759450 Ga0207641_107594501 176
50 3300026095 Ga0207676_10000001 Ga0207676_10000001393 176
51 3300026142 Ga0207698_10118111 Ga0207698_101181112 176
52 3300028379 Ga0268266_10002792 Ga0268266_1000279217 176
53 3300028380 Ga0268265_10001905 Ga0268265_100019059 176
54 3300028380 Ga0268265_10287924 Ga0268265_102879242 176
55 3300028381 Ga0268264_10000004 Ga0268264_10000004411 176
56 3300030521 Ga0307511_10320179 Ga0307511_103201791 176
57 3300031238 Ga0265332_10012977 Ga0265332_100129777 176
58 3300031242 Ga0265329_10035273 Ga0265329_100352733 176
59 3300031247 Ga0265340_10022956 Ga0265340_100229564 176
60 3300031250 Ga0265331_10032069 Ga0265331_100320695 176
61 3300031911 Ga0307412_10128022 Ga0307412_101280222 176
62 3300032004 Ga0307414_10018264 Ga0307414_100182643 176
63 3300032004 Ga0307414_10841199 Ga0307414_108411991 176
64 3300037853 Ga0436364_0952628 Ga0436364_0952628_1533_2066 176
65 3300044683 Ga0466965_0220187 Ga0466965_0220187_43_576 176
66 3300044694 Ga0466963_0287775 Ga0466963_0287775_275_808 176
67 3300044719 Ga0466971_0082416 Ga0466971_0082416_444_977 176
68 3300044765 Ga0466970_0343955 Ga0466970_0343955_135_668 176
69 3300044842 Ga0466957_0045017 Ga0466957_0045017_1341_1874 176
70 3300044901 Ga0466960_0032713 Ga0466960_0032713_953_1486 176
71 3300045836 Ga0466958_0048891 Ga0466958_0048891_755_1288 176
72 3300046457 Ga0495590_0044585 Ga0495590_0044585_639_1172 176
73 3300046472 Ga0495580_0367962 Ga0495580_0367962_119_652 176
74 3300046530 Ga0495654_0131187 Ga0495654_0131187_50_595 176
75 3300046531 Ga0495665_0011202 Ga0495665_0011202_3231_3764 176
76 3300046615 Ga0495656_0237236 Ga0495656_0237236_218_751 176
77 3300046660 Ga0495625_0000673 Ga0495625_0000673_13066_13611 176
78 3300047315 Ga0495581_0017316 Ga0495581_0017316_3197_3730 176
79 3300047673 Ga0495593_0054980 Ga0495593_0054980_580_1113 176
80 3300048903 Ga0496100_0245101 Ga0496100_0245101_702_1238 176
81 3300048905 Ga0496102_0193702 Ga0496102_0193702_1349_1885 176
82 3300048907 Ga0496104_0089491 Ga0496104_0089491_1651_2187 176
83 3300048907 Ga0496104_0764541 Ga0496104_0764541_312_845 176
84 3300048908 Ga0496105_0086965 Ga0496105_0086965_1342_1878 176
85 3300048911 Ga0496108_1068488 Ga0496108_1068488_99_653 176
86 3300048915 Ga0496112_0266884 Ga0496112_0266884_470_1006 176
87 3300048915 Ga0496112_0368077 Ga0496112_0368077_721_1254 176
88 3300048919 Ga0496116_0160626 Ga0496116_0160626_505_1041 176
89 3300048920 Ga0496117_0023538 Ga0496117_0023538_194_730 176
90 3300048920 Ga0496117_0200888 Ga0496117_0200888_539_1075 176
91 3300048921 Ga0496118_0020724 Ga0496118_0020724_2384_2920 176
92 3300048924 Ga0496121_0004190 Ga0496121_0004190_6644_7180 176
93 3300048926 Ga0496123_0153989 Ga0496123_0153989_407_943 176
94 3300048927 Ga0496124_0622200 Ga0496124_0622200_119_673 176
95 3300050492 nmdc:mga0yw44_408303_c1 nmdc:mga0yw44_408303_c1_56_589 176
96 3300050493 nmdc:mga0k408_165025_c1 nmdc:mga0k408_165025_c1_260_796 176
97 3300050496 nmdc:mga07m45_167573_c1 nmdc:mga07m45_167573_c1_166_699 176
98 3300003187 JGI25151J46595_10000577 JGI25151J46595_1000057719 177
99 3300005331 Ga0070670_100194416 Ga0070670_1001944162 177
100 3300005364 Ga0070673_100077132 Ga0070673_1000771321 177
101 3300005445 Ga0070708_100339816 Ga0070708_1003398163 177
102 3300005467 Ga0070706_100001696 Ga0070706_10000169615 177
103 3300005468 Ga0070707_100080526 Ga0070707_1000805262 177
104 3300005471 Ga0070698_100026347 Ga0070698_1000263475 177
105 3300005518 Ga0070699_100025996 Ga0070699_1000259962 177
106 3300005549 Ga0070704_100433531 Ga0070704_1004335312 177
107 3300005563 Ga0068855_100014536 Ga0068855_1000145363 177
108 3300005563 Ga0068855_100517296 Ga0068855_1005172961 177
109 3300005615 Ga0070702_100176539 Ga0070702_1001765392 177
110 3300005618 Ga0068864_100127751 Ga0068864_1001277513 177
111 3300005841 Ga0068863_100162888 Ga0068863_1001628882 177
112 3300005842 Ga0068858_100549496 Ga0068858_1005494962 177
113 3300005844 Ga0068862_100027005 Ga0068862_1000270053 177
114 3300006048 Ga0075363_100005959 Ga0075363_1000059593 177
115 3300006048 Ga0075363_100039008 Ga0075363_1000390082 177
116 3300006051 Ga0075364_10001007 Ga0075364_100010072 177
117 3300006051 Ga0075364_10210897 Ga0075364_102108972 177
118 3300006051 Ga0075364_10238035 Ga0075364_102380352 177
119 3300006177 Ga0075362_10004185 Ga0075362_100041855 177
120 3300006177 Ga0075362_10026615 Ga0075362_100266153 177
121 3300006177 Ga0075362_10105647 Ga0075362_101056472 177
122 3300006178 Ga0075367_10408095 Ga0075367_104080952 177
123 3300006186 Ga0075369_10140910 Ga0075369_101409102 177
124 3300006195 Ga0075366_10008335 Ga0075366_100083355 177
125 3300006195 Ga0075366_10024268 Ga0075366_100242683 177
126 3300006195 Ga0075366_10050926 Ga0075366_100509262 177
127 3300006195 Ga0075366_10083694 Ga0075366_100836941 177
128 3300006237 Ga0097621_100644339 Ga0097621_1006443392 177
129 3300006353 Ga0075370_10008840 Ga0075370_100088405 177
130 3300006846 Ga0075430_100004962 Ga0075430_1000049627 177
131 3300006880 Ga0075429_100005817 Ga0075429_1000058172 177
132 3300009093 Ga0105240_10202207 Ga0105240_102022072 177
133 3300009177 Ga0105248_10690237 Ga0105248_106902372 177
134 3300009553 Ga0105249_10183806 Ga0105249_101838063 177
135 3300010375 Ga0105239_11163392 Ga0105239_111633922 177
136 3300013104 Ga0157370_10000335 Ga0157370_1000033522 177
137 3300013104 Ga0157370_10010674 Ga0157370_100106742 177
138 3300013306 Ga0163162_10103461 Ga0163162_101034613 177
139 3300013306 Ga0163162_10484000 Ga0163162_104840002 177
140 3300013308 Ga0157375_10443723 Ga0157375_104437232 177
141 3300014497 Ga0182008_10000377 Ga0182008_1000037716 177
142 3300017792 Ga0163161_10548976 Ga0163161_105489762 177
143 3300025245 Ga0207425_1055374 Ga0207425_10553741 177
144 3300025258 Ga0209129_1001072 Ga0209129_10010728 177
145 3300025258 Ga0209129_1040249 Ga0209129_10402491 177
146 3300025273 Ga0209673_1001085 Ga0209673_100108511 177
147 3300025292 Ga0209676_1001213 Ga0209676_100121323 177
148 3300025294 Ga0209025_1000049 Ga0209025_1000049149 177
149 3300025294 Ga0209025_1000432 Ga0209025_100043251 177
150 3300025298 Ga0209050_1001546 Ga0209050_100154617 177
151 3300025302 Ga0207426_1095747 Ga0207426_10957472 177
152 3300025303 Ga0209051_1083265 Ga0209051_10832652 177
153 3300025910 Ga0207684_10001749 Ga0207684_1000174915 177
154 3300025923 Ga0207681_10071399 Ga0207681_100713992 177
155 3300025924 Ga0207694_10102695 Ga0207694_101026954 177
156 3300025925 Ga0207650_10136240 Ga0207650_101362404 177
157 3300025931 Ga0207644_10582296 Ga0207644_105822962 177
158 3300025949 Ga0207667_10116028 Ga0207667_101160282 177
159 3300025960 Ga0207651_10033973 Ga0207651_100339733 177
160 3300026035 Ga0207703_10794183 Ga0207703_107941832 177
161 3300026041 Ga0207639_10073041 Ga0207639_100730413 177
162 3300026088 Ga0207641_10209580 Ga0207641_102095802 177
163 3300026095 Ga0207676_10105634 Ga0207676_101056343 177
164 3300026118 Ga0207675_100395783 Ga0207675_1003957832 177
165 3300027907 Ga0207428_10149883 Ga0207428_101498832 177
166 3300028379 Ga0268266_10061575 Ga0268266_100615753 177
167 3300028380 Ga0268265_11186474 Ga0268265_111864741 177
168 3300028794 Ga0307515_10583967 Ga0307515_105839671 177
169 3300031251 Ga0265327_10063471 Ga0265327_100634712 177
170 3300031456 Ga0307513_10076357 Ga0307513_100763572 177
171 3300031911 Ga0307412_11012346 Ga0307412_110123461 177
172 3300041453 Ga0451797_0372352 Ga0451797_0372352_115_651 177
173 3300041512 Ga0451853_1495030 Ga0451853_1495030_10916_11452 177
174 3300042010 Ga0439452_106296 Ga0439452_106296_20_556 177
175 3300042115 Ga0450911_000117 Ga0450911_000117_13596_14132 177
176 3300042532 Ga0450893_0010334 Ga0450893_0010334_674_1210 177
177 3300042876 Ga0451577_0224728 Ga0451577_0224728_1032_1577 177
178 3300042876 Ga0451577_0651978 Ga0451577_0651978_249_791 177
179 3300042876 Ga0451577_0985882 Ga0451577_0985882_111_647 177
180 3300044712 Ga0453684_0015372 Ga0453684_0015372_7714_8259 177
181 3300045051 Ga0451576_0302602 Ga0451576_0302602_957_1508 177
182 3300045976 Ga0466967_0094767 Ga0466967_0094767_1212_1751 177
183 3300046491 Ga0495584_0091510 Ga0495584_0091510_615_1151 177
184 3300046515 Ga0495620_0339739 Ga0495620_0339739_11_547 177
185 3300046615 Ga0495656_0076937 Ga0495656_0076937_737_1273 177
186 3300046663 Ga0495635_0112732 Ga0495635_0112732_341_877 177
187 3300046674 Ga0495588_0002335 Ga0495588_0002335_718_1254 177
188 3300046690 Ga0495624_0150196 Ga0495624_0150196_68_604 177
189 3300047318 Ga0495636_0071234 Ga0495636_0071234_372_917 177
190 3300047321 Ga0495676_0000456 Ga0495676_0000456_31066_31602 177
191 3300047443 Ga0495687_014451 Ga0495687_014451_234_782 177
192 3300047673 Ga0495593_0003207 Ga0495593_0003207_8089_8625 177
193 3300048088 Ga0495602_0077339 Ga0495602_0077339_15_551 177
194 3300048089 Ga0495614_0000445 Ga0495614_0000445_2697_3233 177
195 3300048091 Ga0495626_0002671 Ga0495626_0002671_394_930 177
196 3300048919 Ga0496116_0001738 Ga0496116_0001738_17016_17552 177
197 3300048920 Ga0496117_0000428 Ga0496117_0000428_10336_10872 177
198 3300048921 Ga0496118_0001373 Ga0496118_0001373_17372_17908 177
199 3300048924 Ga0496121_0038513 Ga0496121_0038513_1832_2368 177
200 3300048924 Ga0496121_0038615 Ga0496121_0038615_1551_2102 177
201 3300048924 Ga0496121_0040873 Ga0496121_0040873_1005_1541 177
202 3300048925 Ga0496122_0000582 Ga0496122_0000582_14255_14791 177
203 3300048926 Ga0496123_0000479 Ga0496123_0000479_59554_60090 177
204 3300048927 Ga0496124_0000036 Ga0496124_0000036_72081_72617 177
205 3300048927 Ga0496124_0041675 Ga0496124_0041675_1969_2505 177
206 3300048927 Ga0496124_0252062 Ga0496124_0252062_244_780 177
207 3300048928 Ga0496125_0060589 Ga0496125_0060589_318_854 177
208 3300049581 Ga0501047_0172843 Ga0501047_0172843_396_944 177
209 3300049823 Ga0501044_0101349 Ga0501044_0101349_2095_2643 177
210 3300050489 nmdc:mga03683_277891_c1 nmdc:mga03683_277891_c1_137_673 177
211 3300050489 nmdc:mga03683_64866_c1 nmdc:mga03683_64866_c1_178_714 177
212 3300050491 nmdc:mga00v17_202761_c1 nmdc:mga00v17_202761_c1_250_786 177
213 3300050491 nmdc:mga00v17_97197_c1 nmdc:mga00v17_97197_c1_375_953 177
214 3300050492 nmdc:mga0yw44_4500_c1 nmdc:mga0yw44_4500_c1_180_758 177
215 3300050493 nmdc:mga0k408_192283_c1 nmdc:mga0k408_192283_c1_433_1011 177
216 3300050493 nmdc:mga0k408_2618_c1 nmdc:mga0k408_2618_c1_350_958 177
217 3300050493 nmdc:mga0k408_74590_c1 nmdc:mga0k408_74590_c1_406_942 177
218 3300050493 nmdc:mga0k408_74764_c1 nmdc:mga0k408_74764_c1_85_621 177
219 3300050493 nmdc:mga0k408_80734_c1 nmdc:mga0k408_80734_c1_642_1217 177
220 3300050494 nmdc:mga06z11_174979_c1 nmdc:mga06z11_174979_c1_289_825 177
221 3300050496 nmdc:mga07m45_9626_c1 nmdc:mga07m45_9626_c1_2387_2962 177
222 3300050508 nmdc:mga09592_728_c1 nmdc:mga09592_728_c1_22355_22891 177
223 3300050509 nmdc:mga0qj67_27874_c1 nmdc:mga0qj67_27874_c1_2602_3138 177
224 3300050516 nmdc:mga0sz30_132519_c1 nmdc:mga0sz30_132519_c1_436_972 177
225 3300053079 Ga0500610_0000141 Ga0500610_0000141_4347_4883 177
226 3300053079 Ga0500610_0016329 Ga0500610_0016329_1700_2233 177
227 3300053087 Ga0500643_101275 Ga0500643_101275_144_680 177
228 3300053087 Ga0500643_140542 Ga0500643_140542_94_630 177
229 3300053088 Ga0500644_0003496 Ga0500644_0003496_2206_2742 177
230 3300053093 Ga0500651_0000099 Ga0500651_0000099_10778_11314 177
231 3300053094 Ga0500566_0008235 Ga0500566_0008235_1293_1829 177
232 3300053107 Ga0500560_003344 Ga0500560_003344_1743_2279 177
233 3300053108 Ga0500562_001385 Ga0500562_001385_941_1477 177
234 3300053109 Ga0500569_036810 Ga0500569_036810_133_669 177
235 3300053110 Ga0500571_000006 Ga0500571_000006_32960_33496 177
236 3300053120 Ga0500597_004806 Ga0500597_004806_1644_2180 177
237 3300053122 Ga0500608_177938 Ga0500608_177938_160_696 177
238 3300053125 Ga0500618_003284 Ga0500618_003284_136_684 177
239 3300053133 Ga0500655_000056 Ga0500655_000056_14301_14837 177
240 3300053134 Ga0500658_0000091 Ga0500658_0000091_32275_32811 177
241 3300053138 Ga0500564_051397 Ga0500564_051397_1144_1680 177
242 3300053141 Ga0500574_000057 Ga0500574_000057_5608_6144 177
243 3300053145 Ga0500586_002926 Ga0500586_002926_3343_3882 177
244 3300053158 Ga0500627_0004504 Ga0500627_0004504_3856_4392 177
245 3300053161 Ga0500634_0012052 Ga0500634_0012052_1574_2110 177
246 3300053162 Ga0500638_014520 Ga0500638_014520_2850_3386 177
247 3300053177 Ga0500636_0049435 Ga0500636_0049435_1808_2344 177
248 3300053734 Ga0500565_002343 Ga0500565_002343_283_819 177

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b46-assembly1.cif.gz_A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.822 11 168
2vk4-assembly1.cif.gz_B crystal structure of pyruvate decarboxylase from kluyveromyces lactis 0.8157 10 169
6efg-assembly1.cif.gz_B pyruvate decarboxylase from kluyveromyces lactis 0.8142 10 165
6yak-assembly1.cif.gz_DDD split gene transketolase, active alpha2beta2 heterotetramer 0.8137 9 167
1ozh-assembly1.cif.gz_B the crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate. 0.8129 10 167
ID Description Score Start End Superfamily
af_P58415_1_165_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9522 10 167 3.40.50.970
af_P58415_1_165_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9079 10 167 3.40.50.970
af_Q4D595_58_227_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8546 11 165 3.40.50.970
af_A4I3N7_14_187_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8488 11 165 3.40.50.970
af_A0A0R0ECS7_251_324_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8326 10 74 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7Z9M8S4-F1-model_v4 Phosphonopyruvate decarboxylase 0.985 8 161 GO:0016831
AF-A0A077LKS3-F1-model_v4 Sulfopyruvate decarboxylase alpha subunit 0.9822 10 176 GO:0016831
GO:0030976
AF-A0A424MWX8-F1-model_v4 Phosphonopyruvate decarboxylase 0.9816 15 172 GO:0016831
AF-A0A1V2H1T4-F1-model_v4 Phosphonopyruvate decarboxylase 0.9791 9 176 GO:0016831
GO:0030976
AF-A0A3D0TJG8-F1-model_v4 Phosphonopyruvate decarboxylase 0.978 7 167 GO:0016831

Feature Viewer

pLDDT pTM Quality
89.54 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map