F359755

General Info

Members Datasets Scaffolds Average Seq Length
248 177 496 127

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10003481|Ga0081455_1000348114
Length 135
Sequence MSDAQPPRDTPALDVERVICRLSDIDDPGARSFTIGQGDWPLRGFVVRVGAEAHAYVNSCPHARHPLNLGPNRFLTPGGELILCSSHGALFDKRTGFCVAGPCGGQSLARVPITIEAGFVMLADDVDVQALADRY

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
102 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
108 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
172 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.85
Nodule 0
Rhizoplane 2.42
Rhizosphere 86.29
Stem 0
Stem Tuber 0
Unclassified 25.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10003481 3300005937 Bacteria 18082
2 JGI25406J46586_10030076 3300003203 Unclassified 2047
3 rootL2_10109055 3300003322 Bacteria 4758
4 JGI25405J52794_10015940 3300003911 Bacteria 1480
5 Ga0070676_10175368 3300005328 Bacteria 1390
6 Ga0070670_101722845 3300005331 Bacteria 577
7 Ga0070677_10007957 3300005333 Bacteria 3549
8 Ga0070677_10038562 3300005333 Bacteria 1871
9 Ga0068869_100176964 3300005334 Bacteria 1670
10 Ga0068869_100416983 3300005334 Unclassified 1107
11 Ga0070682_100039357 3300005337 Bacteria 2905
12 Ga0070682_100139922 3300005337 Bacteria 1648
13 Ga0070682_101240560 3300005337 Unclassified 631
14 Ga0068868_100422950 3300005338 Bacteria 1154
15 Ga0068868_100659727 3300005338 Bacteria 932
16 Ga0070689_100029905 3300005340 Bacteria 4130
17 Ga0070668_101098552 3300005347 Unclassified 718
18 Ga0070669_100183675 3300005353 Bacteria 1637
19 Ga0070675_100037679 3300005354 Bacteria 3940
20 Ga0070671_100290235 3300005355 Bacteria 1392
21 Ga0070674_100016438 3300005356 Bacteria 4637
22 Ga0070674_100101897 3300005356 Bacteria 2093
23 Ga0070674_100157816 3300005356 Bacteria 1718
24 Ga0070673_100069882 3300005364 Bacteria 2816
25 Ga0070673_100268388 3300005364 Bacteria 1493
26 Ga0070673_100702554 3300005364 Bacteria 929
27 Ga0070688_100122537 3300005365 Bacteria 1743
28 Ga0070667_100229234 3300005367 Bacteria 1656
29 Ga0070701_10065793 3300005438 Bacteria 1925
30 Ga0070705_100145826 3300005440 Bacteria 1564
31 Ga0070678_100974000 3300005456 Bacteria 778
32 Ga0068867_101616266 3300005459 Unclassified 606
33 Ga0070685_10017897 3300005466 Bacteria 3803
34 Ga0068853_101128733 3300005539 Unclassified 756
35 Ga0070672_100069426 3300005543 Bacteria 2797
36 Ga0070672_100086808 3300005543 Unclassified 2517
37 Ga0070686_100052437 3300005544 Bacteria 2601
38 Ga0070686_100109568 3300005544 Unclassified 1879
39 Ga0070696_100533238 3300005546 Unclassified 938
40 Ga0070665_100012223 3300005548 Bacteria 8655
41 Ga0070665_100582575 3300005548 Unclassified 1132
42 Ga0070702_100043915 3300005615 Bacteria 2521
43 Ga0068859_100274413 3300005617 Bacteria 1779
44 Ga0068859_100779965 3300005617 Unclassified 1044
45 Ga0068870_10012786 3300005840 Bacteria 3931
46 Ga0068863_100070361 3300005841 Bacteria 3309
47 Ga0068863_100100424 3300005841 Bacteria 2750
48 Ga0068858_100464916 3300005842 Unclassified 1220
49 Ga0068860_100066215 3300005843 Bacteria 3432
50 Ga0068862_100099597 3300005844 Bacteria 2541
51 Ga0068862_100113199 3300005844 Bacteria 2383
52 Ga0068862_100134529 3300005844 Bacteria 2190
53 Ga0068862_100937315 3300005844 Unclassified 853
54 Ga0068862_100996180 3300005844 Unclassified 828
55 Ga0081455_10004966 3300005937 Bacteria 14710
56 Ga0081539_10000006 3300005985 Bacteria 534555
57 Ga0075364_11131358 3300006051 Bacteria 531
58 Ga0075366_10619731 3300006195 Unclassified 671
59 Ga0097621_100176504 3300006237 Bacteria 1844
60 Ga0097621_100789469 3300006237 Bacteria 879
61 Ga0068871_100213324 3300006358 Bacteria 1670
62 Ga0068871_100292825 3300006358 Bacteria 1427
63 Ga0068871_102257442 3300006358 Bacteria 519
64 Ga0068865_100015466 3300006881 Bacteria 4867
65 Ga0068865_100116517 3300006881 Bacteria 1979
66 Ga0097620_100274419 3300006931 Bacteria 1779
67 Ga0097620_100780009 3300006931 Unclassified 1044
68 Ga0111539_12020189 3300009094 Bacteria 669
69 Ga0111539_12298297 3300009094 Unclassified 626
70 Ga0105242_10059562 3300009176 Bacteria 3133
71 Ga0105242_11759419 3300009176 Unclassified 657
72 Ga0105248_10399405 3300009177 Bacteria 1548
73 Ga0105248_12268234 3300009177 Bacteria 618
74 Ga0105237_11626025 3300009545 Unclassified 653
75 Ga0105249_10184406 3300009553 Bacteria 2033
76 Ga0157378_11044187 3300013297 Bacteria 853
77 Ga0163162_11549243 3300013306 Bacteria 755
78 Ga0157375_10719410 3300013308 Bacteria 1151
79 Ga0163163_11033256 3300014325 Unclassified 885
80 Ga0163163_11522528 3300014325 Unclassified 730
81 Ga0157380_10011411 3300014326 Bacteria 6421
82 Ga0157380_10096457 3300014326 Bacteria 2452
83 Ga0157380_10485842 3300014326 Unclassified 1196
84 Ga0157380_10576351 3300014326 Bacteria 1109
85 Ga0157380_11008795 3300014326 Unclassified 866
86 Ga0157380_11080992 3300014326 Bacteria 840
87 Ga0157380_11733484 3300014326 Archaea 683
88 Ga0157379_10098666 3300014968 Unclassified 2622
89 Ga0163161_11162699 3300017792 Bacteria 666
90 Ga0207682_10001767 3300025893 Bacteria 9913
91 Ga0207682_10040211 3300025893 Bacteria 1904
92 Ga0207688_10556197 3300025901 Unclassified 721
93 Ga0207680_11109634 3300025903 Unclassified 565
94 Ga0207645_10137300 3300025907 Bacteria 1592
95 Ga0207643_10303562 3300025908 Bacteria 994
96 Ga0207662_10362427 3300025918 Bacteria 976
97 Ga0207681_10061545 3300025923 Bacteria 2581
98 Ga0207650_10806542 3300025925 Bacteria 796
99 Ga0207659_10164041 3300025926 Bacteria 1747
100 Ga0207659_10444932 3300025926 Bacteria 1090
101 Ga0207644_10954787 3300025931 Unclassified 719
102 Ga0207644_11007835 3300025931 Unclassified 699
103 Ga0207686_10079769 3300025934 Bacteria 2132
104 Ga0207670_10021906 3300025936 Bacteria 3950
105 Ga0207704_10006026 3300025938 Bacteria 5620
106 Ga0207691_10005134 3300025940 Bacteria 12638
107 Ga0207691_10012709 3300025940 Bacteria 8063
108 Ga0207689_10022981 3300025942 Bacteria 5237
109 Ga0207689_10101532 3300025942 Bacteria 2363
110 Ga0207689_10195463 3300025942 Bacteria 1669
111 Ga0207689_11733723 3300025942 Unclassified 517
112 Ga0207651_10112923 3300025960 Bacteria 2043
113 Ga0207651_10232557 3300025960 Bacteria 1497
114 Ga0207712_10125869 3300025961 Bacteria 1945
115 Ga0207712_10261216 3300025961 Bacteria 1404
116 Ga0207668_10275571 3300025972 Bacteria 1377
117 Ga0207658_10779419 3300025986 Bacteria 867
118 Ga0207677_10272511 3300026023 Bacteria 1385
119 Ga0207677_10563623 3300026023 Bacteria 995
120 Ga0207703_11630555 3300026035 Bacteria 621
121 Ga0207678_10242972 3300026067 Bacteria 1542
122 Ga0207708_10336081 3300026075 Bacteria 1236
123 Ga0207708_10429331 3300026075 Bacteria 1097
124 Ga0207641_10114341 3300026088 Unclassified 2398
125 Ga0207648_10025905 3300026089 Bacteria 5217
126 Ga0207648_10087143 3300026089 Bacteria 2725
127 Ga0207676_10277527 3300026095 Bacteria 1520
128 Ga0207676_10960308 3300026095 Unclassified 841
129 Ga0207674_10099634 3300026116 Bacteria 2888
130 Ga0207675_100105619 3300026118 Bacteria 2655
131 Ga0207675_100198214 3300026118 Unclassified 1928
132 Ga0207428_10050897 3300027907 Bacteria 3311
133 Ga0268266_10021450 3300028379 Bacteria 5502
134 Ga0268265_10040899 3300028380 Bacteria 3426
135 Ga0268265_10555062 3300028380 Bacteria 1091
136 Ga0268265_11094001 3300028380 Unclassified 791
137 Ga0307515_10081201 3300028794 Bacteria 4215
138 Ga0307515_10885309 3300028794 Unclassified 522
139 Ga0307511_10000172 3300030521 Bacteria 63607
140 Ga0265320_10069520 3300031240 Bacteria 1662
141 Ga0307513_10006568 3300031456 Bacteria 15190
142 Ga0307513_10044622 3300031456 Bacteria 4854
143 Ga0307513_10435532 3300031456 Bacteria 1038
144 Ga0307513_10496677 3300031456 Unclassified 938
145 Ga0307509_10246842 3300031507 Unclassified 1572
146 Ga0307516_10315387 3300031730 Unclassified 1236
147 Ga0307405_10046702 3300031731 Bacteria 2663
148 Ga0307413_10035151 3300031824 Unclassified 2871
149 Ga0307413_10416304 3300031824 Bacteria 1057
150 Ga0307410_10244450 3300031852 Bacteria 1392
151 Ga0307407_10491559 3300031903 Bacteria 898
152 Ga0307409_101671258 3300031995 Unclassified 665
153 Ga0307409_102046649 3300031995 Bacteria 602
154 Ga0307416_100111402 3300032002 Bacteria 2413
155 Ga0307416_100354188 3300032002 Bacteria 1487
156 Ga0307416_100426332 3300032002 Unclassified 1372
157 Ga0307416_101556070 3300032002 Unclassified 767
158 Ga0307411_10008854 3300032005 Bacteria 5245
159 Ga0307415_100105625 3300032126 Unclassified 2077
160 Ga0307415_100143226 3300032126 Unclassified 1829
161 Ga0451797_0769695 3300041453 Bacteria 649
162 Ga0451798_0196474 3300041458 Unclassified 662
163 Ga0451802_0154554 3300041460 Unclassified 655
164 Ga0451804_0702192 3300041463 Bacteria 642
165 Ga0451807_0130625 3300041486 Unclassified 562
166 Ga0451807_0176559 3300041486 Unclassified 776
167 Ga0451849_0295004 3300041505 Unclassified 609
168 Ga0450890_051392 3300042127 Unclassified 629
169 Ga0450906_019771 3300042145 Bacteria 1206
170 Ga0439459_0174747 3300042438 Bacteria 574
171 Ga0451577_0067551 3300042876 Bacteria 3188
172 Ga0466969_0003887 3300044656 Bacteria 7927
173 Ga0466972_0351535 3300044658 Bacteria 689
174 Ga0466965_0283422 3300044683 Bacteria 895
175 Ga0466966_0000859 3300044684 Bacteria 19399
176 Ga0466961_0000578 3300044693 Bacteria 23292
177 Ga0466964_0000961 3300044706 Bacteria 9520
178 Ga0453684_0780821 3300044712 Bacteria 1032
179 Ga0453684_0901836 3300044712 Bacteria 947
180 Ga0466971_0000941 3300044719 Bacteria 11963
181 Ga0466970_0004619 3300044765 Bacteria 6792
182 Ga0466957_0001452 3300044842 Bacteria 12407
183 Ga0466959_0003539 3300045049 Bacteria 10261
184 Ga0466967_2014763 3300045976 Unclassified 574
185 Ga0495617_092322 3300046452 Bacteria 987
186 Ga0495590_0021353 3300046457 Bacteria 2295
187 Ga0495629_0956275 3300046459 Bacteria 559
188 Ga0495638_0005360 3300046460 Bacteria 9563
189 Ga0495638_0021484 3300046460 Bacteria 4252
190 Ga0495585_0309823 3300046492 Bacteria 774
191 Ga0495616_0031477 3300046513 Unclassified 2777
192 Ga0495616_0034874 3300046513 Unclassified 2608
193 Ga0495620_0103369 3300046515 Bacteria 1134
194 Ga0495630_0532098 3300046517 Bacteria 901
195 Ga0495632_0039849 3300046519 Unclassified 2369
196 Ga0495668_0152632 3300046616 Unclassified 1265
197 Ga0495668_0719744 3300046616 Unclassified 552
198 Ga0495611_0378495 3300046648 Unclassified 648
199 Ga0495625_0007720 3300046660 Bacteria 9311
200 Ga0495625_0010777 3300046660 Bacteria 7524
201 Ga0495625_0022923 3300046660 Bacteria 4777
202 Ga0495669_0079710 3300046684 Bacteria 1502
203 Ga0495670_0116153 3300046691 Bacteria 1388
204 Ga0495671_0116901 3300046692 Bacteria 1302
205 Ga0495649_0002977 3300046694 Bacteria 11663
206 Ga0495672_0186650 3300047320 Bacteria 1046
207 Ga0495686_0331495 3300047472 Unclassified 832
208 Ga0495686_0457028 3300047472 Unclassified 677
209 Ga0501037_0660031 3300049573 Bacteria 698
210 Ga0501039_0743247 3300049575 Bacteria 766
211 Ga0501067_0245994 3300049583 Bacteria 995
212 Ga0501068_0004726 3300049584 Bacteria 7405
213 Ga0501069_0333605 3300049585 Bacteria 892
214 Ga0501071_0004322 3300049587 Bacteria 9009
215 Ga0501072_0262304 3300049588 Bacteria 1375
216 Ga0501073_0024295 3300049589 Bacteria 4351
217 Ga0501074_0028678 3300049590 Bacteria 4034
218 Ga0501075_0579356 3300049591 Bacteria 856
219 Ga0501076_0038907 3300049592 Bacteria 3733
220 Ga0501077_0001753 3300049593 Bacteria 13077
221 Ga0501223_100559 3300049663 Unclassified 595
222 Ga0501079_0000277 3300049741 Bacteria 31633
223 Ga0501080_0044298 3300049742 Bacteria 4142
224 Ga0501081_0912572 3300049743 Bacteria 663
225 Ga0501083_0012407 3300049744 Bacteria 5964
226 Ga0501083_0455922 3300049744 Bacteria 832
227 nmdc:mga08y16_34873_c1 3300050511 Bacteria 5286
228 Ga0500644_0004910 3300053088 Bacteria 3363
229 Ga0500583_0006737 3300053092 Bacteria 3981
230 Ga0500651_0161918 3300053093 Bacteria 1338
231 Ga0500641_0023009 3300053096 Bacteria 2392
232 Ga0500556_0021321 3300053104 Bacteria 2088
233 Ga0500617_013397 3300053124 Bacteria 3479
234 Ga0500642_0136713 3300053130 Unclassified 1149
235 Ga0500652_184112 3300053131 Bacteria 854
236 Ga0500658_0427703 3300053134 Bacteria 604
237 Ga0500568_0210432 3300053139 Unclassified 711
238 Ga0500588_0041864 3300053146 Bacteria 1384
239 Ga0500616_0000092 3300053153 Bacteria 183860
240 Ga0500616_0002995 3300053153 Bacteria 13353
241 Ga0500633_0113975 3300053160 Bacteria 1003
242 Ga0500611_087072 3300053727 Unclassified 789
243 Ga0501084_0003829 3300054114 Bacteria 12238
244 Ga0501084_1573061 3300054114 Unclassified 550
245 Ga0587071_050945 3300060344 Bacteria 856
246 Ga0501082_0019428 3300060353 Bacteria 5857
247 Ga0466962_0000530 3300061719 Bacteria 16710
248 Ga0530510_0298131 3300061734 Bacteria 1206
249 Ga0081455_10003481
250 JGI25406J46586_10030076
251 rootL2_10109055
252 JGI25405J52794_10015940
253 Ga0070676_10175368
254 Ga0070670_101722845
255 Ga0070677_10007957
256 Ga0070677_10038562
257 Ga0068869_100176964
258 Ga0068869_100416983
259 Ga0070682_100039357
260 Ga0070682_100139922
261 Ga0070682_101240560
262 Ga0068868_100422950
263 Ga0068868_100659727
264 Ga0070689_100029905
265 Ga0070668_101098552
266 Ga0070669_100183675
267 Ga0070675_100037679
268 Ga0070671_100290235
269 Ga0070674_100016438
270 Ga0070674_100101897
271 Ga0070674_100157816
272 Ga0070673_100069882
273 Ga0070673_100268388
274 Ga0070673_100702554
275 Ga0070688_100122537
276 Ga0070667_100229234
277 Ga0070701_10065793
278 Ga0070705_100145826
279 Ga0070678_100974000
280 Ga0068867_101616266
281 Ga0070685_10017897
282 Ga0068853_101128733
283 Ga0070672_100069426
284 Ga0070672_100086808
285 Ga0070686_100052437
286 Ga0070686_100109568
287 Ga0070696_100533238
288 Ga0070665_100012223
289 Ga0070665_100582575
290 Ga0070702_100043915
291 Ga0068859_100274413
292 Ga0068859_100779965
293 Ga0068870_10012786
294 Ga0068863_100070361
295 Ga0068863_100100424
296 Ga0068858_100464916
297 Ga0068860_100066215
298 Ga0068862_100099597
299 Ga0068862_100113199
300 Ga0068862_100134529
301 Ga0068862_100937315
302 Ga0068862_100996180
303 Ga0081455_10004966
304 Ga0081539_10000006
305 Ga0075364_11131358
306 Ga0075366_10619731
307 Ga0097621_100176504
308 Ga0097621_100789469
309 Ga0068871_100213324
310 Ga0068871_100292825
311 Ga0068871_102257442
312 Ga0068865_100015466
313 Ga0068865_100116517
314 Ga0097620_100274419
315 Ga0097620_100780009
316 Ga0111539_12020189
317 Ga0111539_12298297
318 Ga0105242_10059562
319 Ga0105242_11759419
320 Ga0105248_10399405
321 Ga0105248_12268234
322 Ga0105237_11626025
323 Ga0105249_10184406
324 Ga0157378_11044187
325 Ga0163162_11549243
326 Ga0157375_10719410
327 Ga0163163_11033256
328 Ga0163163_11522528
329 Ga0157380_10011411
330 Ga0157380_10096457
331 Ga0157380_10485842
332 Ga0157380_10576351
333 Ga0157380_11008795
334 Ga0157380_11080992
335 Ga0157380_11733484
336 Ga0157379_10098666
337 Ga0163161_11162699
338 Ga0207682_10001767
339 Ga0207682_10040211
340 Ga0207688_10556197
341 Ga0207680_11109634
342 Ga0207645_10137300
343 Ga0207643_10303562
344 Ga0207662_10362427
345 Ga0207681_10061545
346 Ga0207650_10806542
347 Ga0207659_10164041
348 Ga0207659_10444932
349 Ga0207644_10954787
350 Ga0207644_11007835
351 Ga0207686_10079769
352 Ga0207670_10021906
353 Ga0207704_10006026
354 Ga0207691_10005134
355 Ga0207691_10012709
356 Ga0207689_10022981
357 Ga0207689_10101532
358 Ga0207689_10195463
359 Ga0207689_11733723
360 Ga0207651_10112923
361 Ga0207651_10232557
362 Ga0207712_10125869
363 Ga0207712_10261216
364 Ga0207668_10275571
365 Ga0207658_10779419
366 Ga0207677_10272511
367 Ga0207677_10563623
368 Ga0207703_11630555
369 Ga0207678_10242972
370 Ga0207708_10336081
371 Ga0207708_10429331
372 Ga0207641_10114341
373 Ga0207648_10025905
374 Ga0207648_10087143
375 Ga0207676_10277527
376 Ga0207676_10960308
377 Ga0207674_10099634
378 Ga0207675_100105619
379 Ga0207675_100198214
380 Ga0207428_10050897
381 Ga0268266_10021450
382 Ga0268265_10040899
383 Ga0268265_10555062
384 Ga0268265_11094001
385 Ga0307515_10081201
386 Ga0307515_10885309
387 Ga0307511_10000172
388 Ga0265320_10069520
389 Ga0307513_10006568
390 Ga0307513_10044622
391 Ga0307513_10435532
392 Ga0307513_10496677
393 Ga0307509_10246842
394 Ga0307516_10315387
395 Ga0307405_10046702
396 Ga0307413_10035151
397 Ga0307413_10416304
398 Ga0307410_10244450
399 Ga0307407_10491559
400 Ga0307409_101671258
401 Ga0307409_102046649
402 Ga0307416_100111402
403 Ga0307416_100354188
404 Ga0307416_100426332
405 Ga0307416_101556070
406 Ga0307411_10008854
407 Ga0307415_100105625
408 Ga0307415_100143226
409 Ga0451797_0769695
410 Ga0451798_0196474
411 Ga0451802_0154554
412 Ga0451804_0702192
413 Ga0451807_0130625
414 Ga0451807_0176559
415 Ga0451849_0295004
416 Ga0450890_051392
417 Ga0450906_019771
418 Ga0439459_0174747
419 Ga0451577_0067551
420 Ga0466969_0003887
421 Ga0466972_0351535
422 Ga0466965_0283422
423 Ga0466966_0000859
424 Ga0466961_0000578
425 Ga0466964_0000961
426 Ga0453684_0780821
427 Ga0453684_0901836
428 Ga0466971_0000941
429 Ga0466970_0004619
430 Ga0466957_0001452
431 Ga0466959_0003539
432 Ga0466967_2014763
433 Ga0495617_092322
434 Ga0495590_0021353
435 Ga0495629_0956275
436 Ga0495638_0005360
437 Ga0495638_0021484
438 Ga0495585_0309823
439 Ga0495616_0031477
440 Ga0495616_0034874
441 Ga0495620_0103369
442 Ga0495630_0532098
443 Ga0495632_0039849
444 Ga0495668_0152632
445 Ga0495668_0719744
446 Ga0495611_0378495
447 Ga0495625_0007720
448 Ga0495625_0010777
449 Ga0495625_0022923
450 Ga0495669_0079710
451 Ga0495670_0116153
452 Ga0495671_0116901
453 Ga0495649_0002977
454 Ga0495672_0186650
455 Ga0495686_0331495
456 Ga0495686_0457028
457 Ga0501037_0660031
458 Ga0501039_0743247
459 Ga0501067_0245994
460 Ga0501068_0004726
461 Ga0501069_0333605
462 Ga0501071_0004322
463 Ga0501072_0262304
464 Ga0501073_0024295
465 Ga0501074_0028678
466 Ga0501075_0579356
467 Ga0501076_0038907
468 Ga0501077_0001753
469 Ga0501223_100559
470 Ga0501079_0000277
471 Ga0501080_0044298
472 Ga0501081_0912572
473 Ga0501083_0012407
474 Ga0501083_0455922
475 nmdc:mga08y16_34873_c1
476 Ga0500644_0004910
477 Ga0500583_0006737
478 Ga0500651_0161918
479 Ga0500641_0023009
480 Ga0500556_0021321
481 Ga0500617_013397
482 Ga0500642_0136713
483 Ga0500652_184112
484 Ga0500658_0427703
485 Ga0500568_0210432
486 Ga0500588_0041864
487 Ga0500616_0000092
488 Ga0500616_0002995
489 Ga0500633_0113975
490 Ga0500611_087072
491 Ga0501084_0003829
492 Ga0501084_1573061
493 Ga0587071_050945
494 Ga0501082_0019428
495 Ga0466962_0000530
496 Ga0530510_0298131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

16

122

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8381 12 119
1vm9-assembly1.cif.gz_A the x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1 0.8372 12 119
4p1c-assembly1.cif.gz_I crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex 0.8312 12 119
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.827 12 117
4p1b-assembly1.cif.gz_I crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s e16c c84a c85a variant electron-transfer complex 0.8224 12 119
ID Description Score Start End Superfamily
1vm9A00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8372 12 119 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.827 12 117 2.102.10.10
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8139 17 49 3.40.50.150
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8078 12 119 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7911 12 125 2.102.10.10
ID Description Score Start End GO Terms
AF-M2ZK85-F1-model_v4 Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenase 0.9889 36 117 GO:0046872
GO:0051213
GO:0051537
AF-A0A6I6LDD6-F1-model_v4 Rieske (2Fe-2S) protein 0.9832 40 117 GO:0046872
GO:0051537
AF-A0A178MWM8-F1-model_v4 Rieske domain-containing protein 0.9828 36 118 GO:0046872
GO:0051537
AF-A0A560JV06-F1-model_v4 Nitrite reductase/ring-hydroxylating ferredoxin subunit 0.9804 12 117 GO:0046872
GO:0051537
AF-A0A353PB00-F1-model_v4 (2Fe-2S)-binding protein 0.9777 40 108 GO:0046872
GO:0051537

Map