F359455

General Info

Members Datasets Scaffolds Average Seq Length
247 176 494 261

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221676|2644424110
Length 329
Sequence SIKVTGLQKSYKQHQVLKGVDFEVEKGSIFALLGSNGAGKTTVVKILTTLLKQDSGTATVNGFDVASKPENVRQAISLTGQFAAVDEILTGRENLIMIAKLRYLKNPRQVADXSKPENVRQAISLTGQFAAVDEILTGRENLIMIAKLRYLNNPRQVADDLLKRFDLTDAADRRASTYSGGMRRRLDIALSLVGKPQIIFLDEPTTGLDPESRGMRRRLDIALSLVGKPQIIFLDEPTTGLDPESRIEVWKIVKELADGGTTVLLTTQYLEEAEQLADRIAILHEGRIIANGTLSDLKKLFPSAKVEYVEKQPTLEEIFLAIVGKKEAK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
151 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
152 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
159 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
160 2643221575 Microbacterium sp. Root61 Isolate Unclassified
161 2643221630 Microbacterium sp. Root322 Isolate Unclassified
162 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
163 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
164 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
165 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
166 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
167 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
168 2919395869 Microbacterium resistens 2980 Isolate Unclassified
169 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
170 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
171 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
172 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
173 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
174 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
175 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
176 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.69
Metatranscriptomes 1.62
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.07
Nodule 0
Rhizoplane 6.07
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10033850 3300001979 Bacteria 1616
2 JGI25406J46586_10001945 3300003203 Bacteria 9758
3 JGI25160J50197_1018767 3300003354 Bacteria 2143
4 JGI25407J50210_10007954 3300003373 Bacteria 2665
5 Ga0065704_10000951 3300005289 Bacteria 21531
6 Ga0065704_10011808 3300005289 Bacteria 1987
7 Ga0065704_10138057 3300005289 Bacteria 1548
8 Ga0065707_10000757 3300005295 Bacteria 20925
9 Ga0065707_10017050 3300005295 Bacteria 1810
10 Ga0065707_10092674 3300005295 Bacteria 3735
11 Ga0065707_10104422 3300005295 Bacteria 2694
12 Ga0070680_100124327 3300005336 Bacteria 2155
13 Ga0070706_100277564 3300005467 Bacteria 1564
14 Ga0070698_100037624 3300005471 Bacteria 4988
15 Ga0070698_100057913 3300005471 Bacteria 3919
16 Ga0070698_100139334 3300005471 Bacteria 2378
17 Ga0070699_100033059 3300005518 Bacteria 4468
18 Ga0070699_100044125 3300005518 Bacteria 3860
19 Ga0070679_100321367 3300005530 Bacteria 1497
20 Ga0070684_100410280 3300005535 Bacteria 1250
21 Ga0070697_100100857 3300005536 Bacteria 2398
22 Ga0068853_100101471 3300005539 Bacteria 2545
23 Ga0070704_100087101 3300005549 Bacteria 2317
24 Ga0068857_100054800 3300005577 Bacteria 3539
25 Ga0068857_100067887 3300005577 Bacteria 3174
26 Ga0068864_100013369 3300005618 Bacteria 6803
27 Ga0068864_100111483 3300005618 Bacteria 2437
28 Ga0068863_100145365 3300005841 Bacteria 2267
29 Ga0068860_100034950 3300005843 Bacteria 4822
30 Ga0068862_100058729 3300005844 Bacteria 3300
31 Ga0081539_10001176 3300005985 Bacteria 47379
32 Ga0075428_100304068 3300006844 Bacteria 1715
33 Ga0075430_100254949 3300006846 Bacteria 1453
34 Ga0075431_100022707 3300006847 Bacteria 6413
35 Ga0075429_100037963 3300006880 Bacteria 4192
36 Ga0075429_100126772 3300006880 Bacteria 2232
37 Ga0075429_100227186 3300006880 Bacteria 1635
38 Ga0075429_100241661 3300006880 Bacteria 1582
39 Ga0105245_10341280 3300009098 Bacteria 1481
40 Ga0114129_10091140 3300009147 Bacteria 4225
41 Ga0114129_10149605 3300009147 Bacteria 3195
42 Ga0114129_10329132 3300009147 Bacteria 2029
43 Ga0114129_10423297 3300009147 Bacteria 1751
44 Ga0114129_10645464 3300009147 Bacteria 1367
45 Ga0114129_10902138 3300009147 Bacteria 1120
46 Ga0105243_10251316 3300009148 Bacteria 1579
47 Ga0105237_10188623 3300009545 Bacteria 2062
48 Ga0105249_10052828 3300009553 Bacteria 3713
49 Ga0105239_10042641 3300010375 Bacteria 4972
50 Ga0157371_10074600 3300013102 Bacteria 2402
51 Ga0157370_10258255 3300013104 Bacteria 1610
52 Ga0157369_10103973 3300013105 Bacteria 3025
53 Ga0163162_10930642 3300013306 Bacteria 981
54 Ga0163163_10042401 3300014325 Bacteria 4456
55 Ga0157380_10216171 3300014326 Bacteria 1712
56 Ga0182008_10012803 3300014497 Bacteria 4422
57 Ga0157376_10028367 3300014969 Bacteria 4448
58 Ga0157376_10269869 3300014969 Bacteria 1598
59 Ga0182006_1068641 3300015261 Bacteria 1319
60 Ga0182007_10002103 3300015262 Bacteria 10193
61 Ga0163161_10098660 3300017792 Bacteria 2172
62 Ga0206356_10014926 3300020070 Bacteria 2808
63 Ga0206351_10359267 3300020077 Bacteria 2814
64 Ga0206350_11522736 3300020080 Bacteria 2313
65 Ga0224712_10002482 3300022467 Bacteria 4559
66 Ga0209436_100233 3300025208 Bacteria 25515
67 Ga0209130_1002047 3300025284 Bacteria 10968
68 Ga0207426_1000539 3300025302 Bacteria 54198
69 Ga0207688_10138464 3300025901 Bacteria 1431
70 Ga0207643_10251994 3300025908 Bacteria 1088
71 Ga0207705_10319621 3300025909 Bacteria 1193
72 Ga0207684_10023196 3300025910 Bacteria 5299
73 Ga0207684_10156684 3300025910 Bacteria 1960
74 Ga0207684_10396841 3300025910 Bacteria 1186
75 Ga0207663_10067916 3300025916 Bacteria 2288
76 Ga0207662_10293798 3300025918 Bacteria 1078
77 Ga0207652_10210930 3300025921 Bacteria 1749
78 Ga0207646_10088792 3300025922 Bacteria 2766
79 Ga0207687_10438586 3300025927 Bacteria 1081
80 Ga0207700_10173141 3300025928 Bacteria 1802
81 Ga0207709_10405398 3300025935 Bacteria 1043
82 Ga0207679_10158050 3300025945 Bacteria 1853
83 Ga0207667_10474085 3300025949 Bacteria 1271
84 Ga0207712_10075675 3300025961 Bacteria 2434
85 Ga0207677_10585031 3300026023 Bacteria 977
86 Ga0207703_10481121 3300026035 Bacteria 1163
87 Ga0207639_10080845 3300026041 Bacteria 2572
88 Ga0207641_10080012 3300026088 Bacteria 2834
89 Ga0207641_10186199 3300026088 Bacteria 1905
90 Ga0207674_10025662 3300026116 Bacteria 6276
91 Ga0207674_10106359 3300026116 Bacteria 2783
92 Ga0207674_10454124 3300026116 Bacteria 1238
93 Ga0207683_10177752 3300026121 Bacteria 1929
94 Ga0268264_10127272 3300028381 Bacteria 2253
95 Ga0307517_10233855 3300028786 Bacteria 1099
96 Ga0307515_10054239 3300028794 Bacteria 5890
97 Ga0307512_10061821 3300030522 Bacteria 2880
98 Ga0265320_10039832 3300031240 Bacteria 2347
99 Ga0265320_10104385 3300031240 Bacteria 1303
100 Ga0307513_10434004 3300031456 Bacteria 1041
101 Ga0307508_10000931 3300031616 Bacteria 34054
102 Ga0307508_10020499 3300031616 Bacteria 6003
103 Ga0307410_10472702 3300031852 Bacteria 1027
104 Ga0307412_10136941 3300031911 Bacteria 1788
105 Ga0307414_10239180 3300032004 Bacteria 1502
106 Ga0307414_10589313 3300032004 Bacteria 996
107 Ga0373926_0016809 3300035083 Bacteria 2507
108 Ga0373944_0008359 3300035089 Bacteria 2796
109 Ga0373923_0104225 3300035111 Bacteria 1254
110 Ga0373936_0008251 3300035113 Bacteria 3916
111 Ga0373943_0000237 3300035170 Bacteria 22674
112 Ga0373946_0000406 3300035171 Bacteria 14067
113 Ga0373924_0002210 3300035410 Bacteria 6520
114 Ga0373935_0016330 3300035692 Bacteria 4492
115 Ga0373927_0027168 3300035695 Bacteria 3738
116 Ga0373933_0346649 3300035724 Bacteria 964
117 Ga0395900_0187527 3300037418 Bacteria 2099
118 Ga0395900_0229071 3300037418 Bacteria 1870
119 Ga0395898_0363484 3300037466 Bacteria 1380
120 Ga0451577_0068052 3300042876 Bacteria 3176
121 Ga0451577_0155675 3300042876 Bacteria 2057
122 Ga0453683_0000037 3300044673 Bacteria 230268
123 Ga0453683_0118052 3300044673 Bacteria 1669
124 Ga0453684_0000007 3300044712 Bacteria 1301482
125 Ga0453684_0000402 3300044712 Bacteria 178427
126 Ga0453684_0110473 3300044712 Bacteria 3341
127 Ga0453684_0123183 3300044712 Bacteria 3126
128 Ga0453684_0196277 3300044712 Bacteria 2357
129 Ga0453684_0394360 3300044712 Bacteria 1551
130 Ga0453684_0447193 3300044712 Bacteria 1439
131 Ga0453684_0676392 3300044712 Bacteria 1124
132 Ga0453684_0709310 3300044712 Bacteria 1092
133 Ga0451576_0020383 3300045051 Bacteria 7222
134 Ga0451576_0066536 3300045051 Bacteria 3751
135 Ga0451576_0408796 3300045051 Bacteria 1423
136 Ga0495617_008068 3300046452 Bacteria 3638
137 Ga0495629_0196055 3300046459 Bacteria 1397
138 Ga0495651_0009046 3300046462 Bacteria 7645
139 Ga0495651_0009846 3300046462 Bacteria 7349
140 Ga0495653_0001000 3300046463 Bacteria 21793
141 Ga0495653_0197834 3300046463 Bacteria 1366
142 Ga0495662_0012812 3300046476 Bacteria 4087
143 Ga0495664_0004919 3300046477 Bacteria 7310
144 Ga0495664_0060441 3300046477 Bacteria 2256
145 Ga0495608_0032396 3300046511 Bacteria 3533
146 Ga0495618_0092254 3300046514 Bacteria 1936
147 Ga0495630_0011793 3300046517 Bacteria 6335
148 Ga0495652_0007052 3300046529 Bacteria 10384
149 Ga0495652_0039712 3300046529 Bacteria 4069
150 Ga0495667_0026141 3300046559 Bacteria 3932
151 Ga0495668_0009864 3300046616 Bacteria 5825
152 Ga0495634_0044636 3300046642 Bacteria 2999
153 Ga0495634_0055728 3300046642 Bacteria 2643
154 Ga0495635_0003863 3300046663 Bacteria 10411
155 Ga0495635_0324193 3300046663 Bacteria 1030
156 Ga0495657_0072105 3300046675 Bacteria 2254
157 Ga0495599_0003120 3300046678 Bacteria 9656
158 Ga0495599_0059063 3300046678 Bacteria 2399
159 Ga0495658_0189260 3300046683 Bacteria 1279
160 Ga0495624_0004760 3300046690 Bacteria 9875
161 Ga0495600_0020658 3300046809 Bacteria 4211
162 Ga0495600_0115407 3300046809 Bacteria 1748
163 Ga0495600_0136624 3300046809 Bacteria 1592
164 Ga0495581_0025613 3300047315 Bacteria 3420
165 Ga0495674_0004890 3300047319 Bacteria 12878
166 Ga0495674_0888062 3300047319 Bacteria 689
167 Ga0495676_0002009 3300047321 Bacteria 17914
168 Ga0495680_0003102 3300047322 Bacteria 16553
169 Ga0495680_0063314 3300047322 Bacteria 2840
170 Ga0495680_0187819 3300047322 Bacteria 1488
171 Ga0495683_0015124 3300047323 Bacteria 4019
172 Ga0495684_0018851 3300047471 Bacteria 5315
173 Ga0495593_0042986 3300047673 Bacteria 2424
174 Ga0496102_0295376 3300048905 Bacteria 1527
175 Ga0496105_0237064 3300048908 Bacteria 1481
176 Ga0496108_0067383 3300048911 Bacteria 3019
177 Ga0496108_0295080 3300048911 Bacteria 1412
178 Ga0496109_0036627 3300048912 Bacteria 4429
179 Ga0496109_0231428 3300048912 Bacteria 1739
180 Ga0496110_0201719 3300048913 Bacteria 1807
181 Ga0496111_0020068 3300048914 Bacteria 4648
182 Ga0496112_0049649 3300048915 Bacteria 4112
183 Ga0496113_0002502 3300048916 Bacteria 10703
184 Ga0496114_0058447 3300048917 Bacteria 3220
185 Ga0496114_0083630 3300048917 Bacteria 2701
186 Ga0496114_0267521 3300048917 Bacteria 1506
187 Ga0496115_0095578 3300048918 Bacteria 2432
188 Ga0496115_0356651 3300048918 Bacteria 1192
189 Ga0496117_0001132 3300048920 Bacteria 40215
190 Ga0496117_0164729 3300048920 Bacteria 1294
191 Ga0496122_0014882 3300048925 Bacteria 7491
192 Ga0496125_0024008 3300048928 Bacteria 5616
193 Ga0496126_0001669 3300048929 Bacteria 33303
194 Ga0496126_0005378 3300048929 Bacteria 14626
195 Ga0496126_0027360 3300048929 Bacteria 5448
196 Ga0496126_0127621 3300048929 Bacteria 2200
197 Ga0501034_0004011 3300049571 Bacteria 16517
198 Ga0501038_0001094 3300049574 Bacteria 24528
199 Ga0501047_0051014 3300049581 Bacteria 3996
200 Ga0501071_0179834 3300049587 Bacteria 1585
201 Ga0501073_0058607 3300049589 Bacteria 2691
202 Ga0501083_0000047 3300049744 Bacteria 88014
203 Ga0501044_0343862 3300049823 Bacteria 1412
204 nmdc:mga05p37_169644_c1 3300050507 Bacteria 2662
205 nmdc:mga05p37_560236_c1 3300050507 Bacteria 1299
206 nmdc:mga05p37_6147_c1 3300050507 Bacteria 14129
207 nmdc:mga09592_110764_c1 3300050508 Bacteria 2355
208 nmdc:mga09592_18201_c1 3300050508 Bacteria 5760
209 nmdc:mga09592_44187_c1 3300050508 Bacteria 3750
210 nmdc:mga09592_596341_c1 3300050508 Bacteria 947
211 nmdc:mga09592_6377_c2 3300050508 Bacteria 2425
212 nmdc:mga09592_73894_c1 3300050508 Bacteria 2897
213 nmdc:mga0qj67_103461_c1 3300050509 Bacteria 2297
214 nmdc:mga0qj67_165097_c1 3300050509 Bacteria 1797
215 nmdc:mga06r32_397212_c1 3300050510 Bacteria 1361
216 Ga0495619_0136564 3300053085 Bacteria 1687
217 Ga0500644_0002440 3300053088 Bacteria 4648
218 Ga0500651_0056049 3300053093 Bacteria 2468
219 Ga0500641_0028140 3300053096 Bacteria 2193
220 Ga0500650_0025374 3300053098 Bacteria 2650
221 Ga0500569_008604 3300053109 Bacteria 2341
222 Ga0500559_0011869 3300053136 Bacteria 3713
223 Ga0500568_0032504 3300053139 Bacteria 2145
224 Ga0500616_0000289 3300053153 Bacteria 73129
225 Ga0500616_0001807 3300053153 Bacteria 19448
226 Ga0500616_0204870 3300053153 Bacteria 871
227 Ga0500636_0073489 3300053177 Bacteria 1980
228 Ga0530510_0007112 3300061734 Bacteria 7790
229 2644424110 2643221676 Bacteria 8119172
230 2643735411 2643221542 Bacteria 3563959
231 2643886696 2643221575 Bacteria 4022601
232 2644172253 2643221630 Bacteria 3601215
233 2728531716 2728368933 Bacteria 7044283
234 2791914317 2791354901 Bacteria 8322202
235 2852667072 2852663356 Bacteria 4090475
236 2857472598 2857465823 Bacteria 6772595
237 2857725460 2857723135 Bacteria 4217853
238 2895662564 2895660088 Bacteria 3782833
239 2919398492 2919395869 Bacteria 3704152
240 2935411747 2935409751 Bacteria 4179611
241 2939601511 2939598168 Bacteria 4687164
242 2946082899 2946080515 Bacteria 4310960
243 2971411340 2971410472 Bacteria 8311090
244 2988231777 2988225383 Bacteria 7221625
245 8004182910 8004182704 Bacteria 3391155
246 8056537156 8056533031 Bacteria 8964429
247 8057982075 8057977335 Bacteria 5694872
248 JGI24740J21852_10033850
249 JGI25406J46586_10001945
250 JGI25160J50197_1018767
251 JGI25407J50210_10007954
252 Ga0065704_10000951
253 Ga0065704_10011808
254 Ga0065704_10138057
255 Ga0065707_10000757
256 Ga0065707_10017050
257 Ga0065707_10092674
258 Ga0065707_10104422
259 Ga0070680_100124327
260 Ga0070706_100277564
261 Ga0070698_100037624
262 Ga0070698_100057913
263 Ga0070698_100139334
264 Ga0070699_100033059
265 Ga0070699_100044125
266 Ga0070679_100321367
267 Ga0070684_100410280
268 Ga0070697_100100857
269 Ga0068853_100101471
270 Ga0070704_100087101
271 Ga0068857_100054800
272 Ga0068857_100067887
273 Ga0068864_100013369
274 Ga0068864_100111483
275 Ga0068863_100145365
276 Ga0068860_100034950
277 Ga0068862_100058729
278 Ga0081539_10001176
279 Ga0075428_100304068
280 Ga0075430_100254949
281 Ga0075431_100022707
282 Ga0075429_100037963
283 Ga0075429_100126772
284 Ga0075429_100227186
285 Ga0075429_100241661
286 Ga0105245_10341280
287 Ga0114129_10091140
288 Ga0114129_10149605
289 Ga0114129_10329132
290 Ga0114129_10423297
291 Ga0114129_10645464
292 Ga0114129_10902138
293 Ga0105243_10251316
294 Ga0105237_10188623
295 Ga0105249_10052828
296 Ga0105239_10042641
297 Ga0157371_10074600
298 Ga0157370_10258255
299 Ga0157369_10103973
300 Ga0163162_10930642
301 Ga0163163_10042401
302 Ga0157380_10216171
303 Ga0182008_10012803
304 Ga0157376_10028367
305 Ga0157376_10269869
306 Ga0182006_1068641
307 Ga0182007_10002103
308 Ga0163161_10098660
309 Ga0206356_10014926
310 Ga0206351_10359267
311 Ga0206350_11522736
312 Ga0224712_10002482
313 Ga0209436_100233
314 Ga0209130_1002047
315 Ga0207426_1000539
316 Ga0207688_10138464
317 Ga0207643_10251994
318 Ga0207705_10319621
319 Ga0207684_10023196
320 Ga0207684_10156684
321 Ga0207684_10396841
322 Ga0207663_10067916
323 Ga0207662_10293798
324 Ga0207652_10210930
325 Ga0207646_10088792
326 Ga0207687_10438586
327 Ga0207700_10173141
328 Ga0207709_10405398
329 Ga0207679_10158050
330 Ga0207667_10474085
331 Ga0207712_10075675
332 Ga0207677_10585031
333 Ga0207703_10481121
334 Ga0207639_10080845
335 Ga0207641_10080012
336 Ga0207641_10186199
337 Ga0207674_10025662
338 Ga0207674_10106359
339 Ga0207674_10454124
340 Ga0207683_10177752
341 Ga0268264_10127272
342 Ga0307517_10233855
343 Ga0307515_10054239
344 Ga0307512_10061821
345 Ga0265320_10039832
346 Ga0265320_10104385
347 Ga0307513_10434004
348 Ga0307508_10000931
349 Ga0307508_10020499
350 Ga0307410_10472702
351 Ga0307412_10136941
352 Ga0307414_10239180
353 Ga0307414_10589313
354 Ga0373926_0016809
355 Ga0373944_0008359
356 Ga0373923_0104225
357 Ga0373936_0008251
358 Ga0373943_0000237
359 Ga0373946_0000406
360 Ga0373924_0002210
361 Ga0373935_0016330
362 Ga0373927_0027168
363 Ga0373933_0346649
364 Ga0395900_0187527
365 Ga0395900_0229071
366 Ga0395898_0363484
367 Ga0451577_0068052
368 Ga0451577_0155675
369 Ga0453683_0000037
370 Ga0453683_0118052
371 Ga0453684_0000007
372 Ga0453684_0000402
373 Ga0453684_0110473
374 Ga0453684_0123183
375 Ga0453684_0196277
376 Ga0453684_0394360
377 Ga0453684_0447193
378 Ga0453684_0676392
379 Ga0453684_0709310
380 Ga0451576_0020383
381 Ga0451576_0066536
382 Ga0451576_0408796
383 Ga0495617_008068
384 Ga0495629_0196055
385 Ga0495651_0009046
386 Ga0495651_0009846
387 Ga0495653_0001000
388 Ga0495653_0197834
389 Ga0495662_0012812
390 Ga0495664_0004919
391 Ga0495664_0060441
392 Ga0495608_0032396
393 Ga0495618_0092254
394 Ga0495630_0011793
395 Ga0495652_0007052
396 Ga0495652_0039712
397 Ga0495667_0026141
398 Ga0495668_0009864
399 Ga0495634_0044636
400 Ga0495634_0055728
401 Ga0495635_0003863
402 Ga0495635_0324193
403 Ga0495657_0072105
404 Ga0495599_0003120
405 Ga0495599_0059063
406 Ga0495658_0189260
407 Ga0495624_0004760
408 Ga0495600_0020658
409 Ga0495600_0115407
410 Ga0495600_0136624
411 Ga0495581_0025613
412 Ga0495674_0004890
413 Ga0495674_0888062
414 Ga0495676_0002009
415 Ga0495680_0003102
416 Ga0495680_0063314
417 Ga0495680_0187819
418 Ga0495683_0015124
419 Ga0495684_0018851
420 Ga0495593_0042986
421 Ga0496102_0295376
422 Ga0496105_0237064
423 Ga0496108_0067383
424 Ga0496108_0295080
425 Ga0496109_0036627
426 Ga0496109_0231428
427 Ga0496110_0201719
428 Ga0496111_0020068
429 Ga0496112_0049649
430 Ga0496113_0002502
431 Ga0496114_0058447
432 Ga0496114_0083630
433 Ga0496114_0267521
434 Ga0496115_0095578
435 Ga0496115_0356651
436 Ga0496117_0001132
437 Ga0496117_0164729
438 Ga0496122_0014882
439 Ga0496125_0024008
440 Ga0496126_0001669
441 Ga0496126_0005378
442 Ga0496126_0027360
443 Ga0496126_0127621
444 Ga0501034_0004011
445 Ga0501038_0001094
446 Ga0501047_0051014
447 Ga0501071_0179834
448 Ga0501073_0058607
449 Ga0501083_0000047
450 Ga0501044_0343862
451 nmdc:mga05p37_169644_c1
452 nmdc:mga05p37_560236_c1
453 nmdc:mga05p37_6147_c1
454 nmdc:mga09592_110764_c1
455 nmdc:mga09592_18201_c1
456 nmdc:mga09592_44187_c1
457 nmdc:mga09592_596341_c1
458 nmdc:mga09592_6377_c2
459 nmdc:mga09592_73894_c1
460 nmdc:mga0qj67_103461_c1
461 nmdc:mga0qj67_165097_c1
462 nmdc:mga06r32_397212_c1
463 Ga0495619_0136564
464 Ga0500644_0002440
465 Ga0500651_0056049
466 Ga0500641_0028140
467 Ga0500650_0025374
468 Ga0500569_008604
469 Ga0500559_0011869
470 Ga0500568_0032504
471 Ga0500616_0000289
472 Ga0500616_0001807
473 Ga0500616_0204870
474 Ga0500636_0073489
475 Ga0530510_0007112
476 2644424110
477 2643735411
478 2643886696
479 2644172253
480 2728531716
481 2791914317
482 2852667072
483 2857472598
484 2857725460
485 2895662564
486 2919398492
487 2935411747
488 2939601511
489 2946082899
490 2971411340
491 2988231777
492 8004182910
493 8056537156
494 8057982075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

206

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

211

271

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9364 2 216
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9346 4 246
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9273 5 220
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9262 1 244
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9231 4 246
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9535 3 232 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9407 2 210 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9346 4 246 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.928 4 216 3.40.50.300
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9268 1 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7I7QNW9-F1-model_v4 Daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein 0.9756 2 223 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A6G3WW48-F1-model_v4 DUF4162 domain-containing protein 0.9706 125 221 GO:0005524
GO:0016887
GO:0046677
AF-U2QFR0-F1-model_v4 ABC transporter, ATP-binding protein 0.9682 2 223 GO:0005524
GO:0016887
GO:0046677
AF-M0LXT0-F1-model_v4 Antibiotic resistance aBC transporter aTP-binding protein 0.968 33 223 GO:0005524
GO:0016887
GO:0043215
GO:1900753
AF-A0A7G9REB6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9671 3 223 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753

Map