F359372

General Info

Members Datasets Scaffolds Average Seq Length
247 158 494 157

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0005574|Ga0501032_0005574_7111_7614
Length 167
Sequence MTTTQHPIPSTSLPPSAPAPTGARYVQPGWFTRQVFNRLVRRLTRMGVSVMGSRELRVRGRSSGEWRSTPVNLLKVDGSEFLVAPRGETQWVRNLRAAGDGELQVGRRVQPFHAREVTDDAAKVELLRAYLRRWKAEVGVFFDGVGADASDDELRAIAPGYPVFEVR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
36 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
146 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
147 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
153 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
154 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
155 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
156 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
157 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
158 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 0
Isolates 2.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0
Rhizoplane 5.67
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0005574 3300049569 Bacteria 9336
2 rootH1_10152170 3300003316 Bacteria 1163
3 Ga0070658_10177082 3300005327 Bacteria 1794
4 Ga0070658_10489157 3300005327 Bacteria 1062
5 Ga0070670_101044625 3300005331 Bacteria 744
6 Ga0070687_100159216 3300005343 Bacteria 1333
7 Ga0070671_100449018 3300005355 Bacteria 1106
8 Ga0070673_100259343 3300005364 Unclassified 1518
9 Ga0070688_100402055 3300005365 Bacteria 1014
10 Ga0070667_100694571 3300005367 Bacteria 941
11 Ga0070667_100833859 3300005367 Bacteria 857
12 Ga0070678_100154572 3300005456 Bacteria 1852
13 Ga0068867_100344745 3300005459 Bacteria 1241
14 Ga0070686_100788534 3300005544 Bacteria 765
15 Ga0070695_100739409 3300005545 Bacteria 784
16 Ga0070665_100629379 3300005548 Bacteria 1086
17 Ga0070665_101540833 3300005548 Bacteria 673
18 Ga0070702_100094433 3300005615 Bacteria 1821
19 Ga0070702_100363156 3300005615 Bacteria 1024
20 Ga0068861_100302486 3300005719 Bacteria 1386
21 Ga0068861_100693721 3300005719 Bacteria 945
22 Ga0068863_100990328 3300005841 Bacteria 843
23 Ga0070717_10946596 3300006028 Unclassified 784
24 Ga0075368_10095888 3300006042 Bacteria 1216
25 Ga0075363_100190655 3300006048 Bacteria 1169
26 Ga0075367_10009086 3300006178 Bacteria 5177
27 Ga0097621_100825628 3300006237 Bacteria 860
28 Ga0075428_100828966 3300006844 Bacteria 983
29 Ga0075434_100537351 3300006871 Bacteria 1189
30 Ga0068865_100061024 3300006881 Bacteria 2642
31 Ga0105245_10020395 3300009098 Bacteria 5814
32 Ga0105243_10056635 3300009148 Bacteria 3118
33 Ga0105241_10307736 3300009174 Bacteria 1362
34 Ga0105242_13046778 3300009176 Bacteria 519
35 Ga0105249_10131129 3300009553 Bacteria 2393
36 Ga0157369_10001200 3300013105 Bacteria 32252
37 Ga0157372_10290676 3300013307 Bacteria 1901
38 Ga0157372_11149225 3300013307 Bacteria 898
39 Ga0157375_10067590 3300013308 Bacteria 3571
40 Ga0157375_11488832 3300013308 Bacteria 799
41 Ga0182006_1133873 3300015261 Bacteria 851
42 Ga0182007_10005997 3300015262 Bacteria 5267
43 Ga0183367_1003 3300015688 Bacteria 814276
44 Ga0213875_10117261 3300021388 Bacteria 1244
45 Ga0207647_10014042 3300025904 Bacteria 5538
46 Ga0207643_10402694 3300025908 Bacteria 865
47 Ga0207705_10655439 3300025909 Bacteria 816
48 Ga0207693_10126999 3300025915 Bacteria 2005
49 Ga0207662_10406514 3300025918 Bacteria 924
50 Ga0207644_10258911 3300025931 Bacteria 1391
51 Ga0207644_11031113 3300025931 Bacteria 691
52 Ga0207669_10494987 3300025937 Bacteria 977
53 Ga0207669_11291838 3300025937 Unclassified 620
54 Ga0207667_10023148 3300025949 Bacteria 6842
55 Ga0207651_10360254 3300025960 Bacteria 1227
56 Ga0207712_10555052 3300025961 Unclassified 988
57 Ga0207658_10111593 3300025986 Bacteria 2163
58 Ga0207658_10637364 3300025986 Bacteria 960
59 Ga0207677_10605755 3300026023 Bacteria 962
60 Ga0207702_10013374 3300026078 Bacteria 6827
61 Ga0207641_10623292 3300026088 Bacteria 1058
62 Ga0207648_10466003 3300026089 Bacteria 1152
63 Ga0207675_100061974 3300026118 Bacteria 3492
64 Ga0207683_10155128 3300026121 Bacteria 2068
65 Ga0209813_10062108 3300027866 Bacteria 1195
66 Ga0268266_10335081 3300028379 Bacteria 1419
67 Ga0268266_11169990 3300028379 Bacteria 744
68 Ga0307515_10305654 3300028794 Bacteria 1271
69 Ga0307511_10161167 3300030521 Bacteria 1259
70 Ga0307512_10030600 3300030522 Bacteria 4679
71 Ga0307513_10372375 3300031456 Bacteria 1170
72 Ga0307508_10360445 3300031616 Bacteria 1045
73 Ga0307514_10306952 3300031649 Bacteria 883
74 Ga0307412_11285810 3300031911 Bacteria 658
75 Ga0395900_1477288 3300037418 Bacteria 592
76 Ga0395898_0001876 3300037466 Bacteria 26857
77 Ga0395898_0016707 3300037466 Bacteria 7500
78 Ga0436364_0641628 3300037853 Bacteria 968
79 Ga0436364_1459592 3300037853 Bacteria 3585
80 Ga0395901_0343274 3300038443 Bacteria 1542
81 Ga0436362_0309346 3300039453 Bacteria 1261
82 Ga0451793_1727633 3300041452 Bacteria 635
83 Ga0451853_2204347 3300041512 Bacteria 744
84 Ga0466966_0322038 3300044684 Bacteria 929
85 Ga0466963_0016898 3300044694 Bacteria 4545
86 Ga0466963_0020375 3300044694 Bacteria 4170
87 Ga0466963_0026083 3300044694 Bacteria 3735
88 Ga0466964_0007916 3300044706 Bacteria 3981
89 Ga0466957_0081150 3300044842 Bacteria 2020
90 Ga0466958_0150781 3300045836 Bacteria 1466
91 Ga0466967_0000522 3300045976 Bacteria 18716
92 Ga0466967_0031649 3300045976 Bacteria 4456
93 Ga0466967_0196000 3300045976 Bacteria 1911
94 Ga0466967_1179221 3300045976 Bacteria 763
95 Ga0495629_0011097 3300046459 Bacteria 6546
96 Ga0495629_0025480 3300046459 Bacteria 4203
97 Ga0495629_0369016 3300046459 Bacteria 978
98 Ga0495629_0643107 3300046459 Bacteria 707
99 Ga0495585_0034227 3300046492 Bacteria 2872
100 Ga0495594_0001917 3300046499 Bacteria 10845
101 Ga0495594_0460386 3300046499 Bacteria 723
102 Ga0495666_0070513 3300046526 Bacteria 1662
103 Ga0495640_0007669 3300046533 Bacteria 8486
104 Ga0495640_0084720 3300046533 Bacteria 2102
105 Ga0495622_0008015 3300046557 Bacteria 4897
106 Ga0495634_0057512 3300046642 Bacteria 2595
107 Ga0495588_0004354 3300046674 Bacteria 6252
108 Ga0495657_0083240 3300046675 Bacteria 2066
109 Ga0495658_0031900 3300046683 Bacteria 2873
110 Ga0495613_0762932 3300046689 Bacteria 633
111 Ga0495624_0061539 3300046690 Bacteria 2352
112 Ga0495670_0724073 3300046691 Bacteria 543
113 Ga0495581_0500843 3300047315 Bacteria 706
114 Ga0495604_0006769 3300047317 Bacteria 9094
115 Ga0495604_0011235 3300047317 Bacteria 7107
116 Ga0495676_0001692 3300047321 Bacteria 19269
117 Ga0495676_0265096 3300047321 Bacteria 1167
118 Ga0495687_146466 3300047443 Bacteria 813
119 Ga0495675_0171957 3300047444 Bacteria 1330
120 Ga0496100_0179611 3300048903 Bacteria 1530
121 Ga0496100_0284192 3300048903 Bacteria 1234
122 Ga0496101_0307045 3300048904 Bacteria 1243
123 Ga0496102_0567364 3300048905 Bacteria 1058
124 Ga0496104_0075882 3300048907 Bacteria 3201
125 Ga0496105_0005312 3300048908 Bacteria 9765
126 Ga0496105_0242842 3300048908 Bacteria 1461
127 Ga0496105_0450669 3300048908 Unclassified 1016
128 Ga0496110_0709542 3300048913 Bacteria 908
129 Ga0496113_1343182 3300048916 Bacteria 555
130 Ga0496114_0078599 3300048917 Bacteria 2783
131 Ga0496114_0232017 3300048917 Unclassified 1621
132 Ga0496115_0115838 3300048918 Bacteria 2204
133 Ga0496117_0048836 3300048920 Bacteria 3017
134 Ga0496118_0093665 3300048921 Bacteria 2057
135 Ga0496119_0056785 3300048922 Bacteria 2370
136 Ga0496120_0039497 3300048923 Bacteria 2783
137 Ga0496122_0022658 3300048925 Bacteria 5575
138 Ga0496123_0282967 3300048926 Bacteria 800
139 Ga0496126_0735313 3300048929 Unclassified 763
140 Ga0501031_0111941 3300049568 Bacteria 1783
141 Ga0501031_0136382 3300049568 Bacteria 1603
142 Ga0501031_0337077 3300049568 Bacteria 976
143 Ga0501032_0138199 3300049569 Bacteria 1605
144 Ga0501032_0463179 3300049569 Bacteria 811
145 Ga0501032_0763274 3300049569 Bacteria 611
146 Ga0501033_0000850 3300049570 Bacteria 27891
147 Ga0501033_0014791 3300049570 Bacteria 5924
148 Ga0501033_0117108 3300049570 Bacteria 1935
149 Ga0501033_0146139 3300049570 Bacteria 1707
150 Ga0501033_0870852 3300049570 Bacteria 606
151 Ga0501034_0036041 3300049571 Bacteria 5015
152 Ga0501034_0129715 3300049571 Bacteria 2505
153 Ga0501034_0129865 3300049571 Bacteria 2503
154 Ga0501034_0563893 3300049571 Bacteria 1047
155 Ga0501036_0015250 3300049572 Bacteria 6416
156 Ga0501036_0325960 3300049572 Bacteria 1283
157 Ga0501036_0634814 3300049572 Bacteria 885
158 Ga0501037_0019657 3300049573 Bacteria 4983
159 Ga0501037_0227376 3300049573 Bacteria 1310
160 Ga0501038_0002101 3300049574 Bacteria 18462
161 Ga0501038_0019826 3300049574 Bacteria 6054
162 Ga0501038_0135343 3300049574 Bacteria 2019
163 Ga0501039_0274413 3300049575 Bacteria 1325
164 Ga0501040_0076891 3300049576 Bacteria 2308
165 Ga0501041_0191387 3300049577 Bacteria 1281
166 Ga0501043_0000682 3300049579 Bacteria 29934
167 Ga0501043_0056627 3300049579 Bacteria 3079
168 Ga0501043_0141059 3300049579 Bacteria 1887
169 Ga0501043_0198653 3300049579 Bacteria 1557
170 Ga0501043_0212648 3300049579 Bacteria 1498
171 Ga0501046_0041459 3300049580 Bacteria 3673
172 Ga0501046_0168925 3300049580 Bacteria 1642
173 Ga0501046_0226446 3300049580 Bacteria 1383
174 Ga0501047_0000947 3300049581 Bacteria 29395
175 Ga0501047_0064134 3300049581 Bacteria 3543
176 Ga0501047_0073774 3300049581 Bacteria 3285
177 Ga0501047_0148390 3300049581 Bacteria 2221
178 Ga0501047_0225911 3300049581 Bacteria 1727
179 Ga0501048_0371722 3300049582 Bacteria 1020
180 Ga0501068_0001844 3300049584 Bacteria 11242
181 Ga0501069_0524544 3300049585 Bacteria 707
182 Ga0501070_0001724 3300049586 Bacteria 19336
183 Ga0501070_0018961 3300049586 Bacteria 5769
184 Ga0501070_0063759 3300049586 Bacteria 3052
185 Ga0501070_0074051 3300049586 Bacteria 2818
186 Ga0501070_0097714 3300049586 Bacteria 2429
187 Ga0501070_0772405 3300049586 Bacteria 756
188 Ga0501070_1057139 3300049586 Bacteria 628
189 Ga0501071_0000360 3300049587 Bacteria 22335
190 Ga0501072_0001023 3300049588 Bacteria 20717
191 Ga0501072_1284939 3300049588 Bacteria 567
192 Ga0501073_0083159 3300049589 Bacteria 2227
193 Ga0501073_0094482 3300049589 Bacteria 2076
194 Ga0501073_0251542 3300049589 Bacteria 1220
195 Ga0501074_0009177 3300049590 Bacteria 7184
196 Ga0501074_0023885 3300049590 Bacteria 4442
197 Ga0501074_0102754 3300049590 Bacteria 2046
198 Ga0501076_0033609 3300049592 Bacteria 4005
199 Ga0501079_0000101 3300049741 Bacteria 43428
200 Ga0501080_0041053 3300049742 Bacteria 4313
201 Ga0501080_0068488 3300049742 Bacteria 3301
202 Ga0501080_0077880 3300049742 Bacteria 3084
203 Ga0501080_0440720 3300049742 Bacteria 1168
204 Ga0501080_1459272 3300049742 Bacteria 582
205 Ga0501083_0057613 3300049744 Bacteria 2600
206 Ga0501035_0019662 3300049822 Bacteria 6207
207 Ga0501035_0023265 3300049822 Bacteria 5682
208 Ga0501035_0038475 3300049822 Bacteria 4330
209 Ga0501035_0082658 3300049822 Bacteria 2834
210 Ga0501035_0120433 3300049822 Bacteria 2295
211 Ga0501035_0125829 3300049822 Bacteria 2237
212 Ga0501035_0402152 3300049822 Bacteria 1139
213 Ga0501035_1372521 3300049822 Bacteria 542
214 Ga0501044_0001028 3300049823 Bacteria 33648
215 Ga0501044_0013646 3300049823 Bacteria 8781
216 Ga0501044_0022815 3300049823 Bacteria 6666
217 Ga0501044_0027734 3300049823 Bacteria 5978
218 Ga0501044_0053202 3300049823 Bacteria 4166
219 Ga0501044_0092293 3300049823 Bacteria 3054
220 Ga0501044_0139603 3300049823 Bacteria 2412
221 Ga0501044_0222774 3300049823 Bacteria 1836
222 Ga0501044_0275424 3300049823 Bacteria 1617
223 Ga0501044_0485848 3300049823 Bacteria 1137
224 Ga0501045_0101244 3300049824 Bacteria 2133
225 Ga0501045_0117862 3300049824 Bacteria 1971
226 nmdc:mga03n38_43424_c1 3300050490 Bacteria 1970
227 nmdc:mga06z11_5098_c1 3300050494 Bacteria 5236
228 nmdc:mga04h51_159246_c1 3300050495 Bacteria 868
229 nmdc:mga06r32_894778_c1 3300050510 Bacteria 844
230 nmdc:mga08y16_497994_c1 3300050511 Bacteria 1238
231 nmdc:mga0rr50_451280_c1 3300050513 Bacteria 1090
232 Ga0495595_0452389 3300053084 Bacteria 653
233 Ga0500553_189054 3300053101 Bacteria 724
234 Ga0500560_000257 3300053107 Bacteria 6563
235 Ga0500614_029967 3300053123 Bacteria 1324
236 Ga0501084_0010182 3300054114 Bacteria 7774
237 Ga0501082_0027876 3300060353 Bacteria 4864
238 Ga0466962_0002126 3300061719 Bacteria 9356
239 Ga0530510_0024741 3300061734 Bacteria 4289
240 Ga0530510_0965159 3300061734 Bacteria 652
241 2643947391 2643221587 Bacteria 7586415
242 2644433138 2643221677 Bacteria 7584031
243 2768647381 2767802112 Bacteria 6465194
244 2862181046 2862178590 Bacteria 8583590
245 2946073457 2946072368 Bacteria 8999607
246 2990088832 2990088156 Bacteria 6657676
247 3006327742 3006321560 Bacteria 8247479
248 Ga0501032_0005574
249 rootH1_10152170
250 Ga0070658_10177082
251 Ga0070658_10489157
252 Ga0070670_101044625
253 Ga0070687_100159216
254 Ga0070671_100449018
255 Ga0070673_100259343
256 Ga0070688_100402055
257 Ga0070667_100694571
258 Ga0070667_100833859
259 Ga0070678_100154572
260 Ga0068867_100344745
261 Ga0070686_100788534
262 Ga0070695_100739409
263 Ga0070665_100629379
264 Ga0070665_101540833
265 Ga0070702_100094433
266 Ga0070702_100363156
267 Ga0068861_100302486
268 Ga0068861_100693721
269 Ga0068863_100990328
270 Ga0070717_10946596
271 Ga0075368_10095888
272 Ga0075363_100190655
273 Ga0075367_10009086
274 Ga0097621_100825628
275 Ga0075428_100828966
276 Ga0075434_100537351
277 Ga0068865_100061024
278 Ga0105245_10020395
279 Ga0105243_10056635
280 Ga0105241_10307736
281 Ga0105242_13046778
282 Ga0105249_10131129
283 Ga0157369_10001200
284 Ga0157372_10290676
285 Ga0157372_11149225
286 Ga0157375_10067590
287 Ga0157375_11488832
288 Ga0182006_1133873
289 Ga0182007_10005997
290 Ga0183367_1003
291 Ga0213875_10117261
292 Ga0207647_10014042
293 Ga0207643_10402694
294 Ga0207705_10655439
295 Ga0207693_10126999
296 Ga0207662_10406514
297 Ga0207644_10258911
298 Ga0207644_11031113
299 Ga0207669_10494987
300 Ga0207669_11291838
301 Ga0207667_10023148
302 Ga0207651_10360254
303 Ga0207712_10555052
304 Ga0207658_10111593
305 Ga0207658_10637364
306 Ga0207677_10605755
307 Ga0207702_10013374
308 Ga0207641_10623292
309 Ga0207648_10466003
310 Ga0207675_100061974
311 Ga0207683_10155128
312 Ga0209813_10062108
313 Ga0268266_10335081
314 Ga0268266_11169990
315 Ga0307515_10305654
316 Ga0307511_10161167
317 Ga0307512_10030600
318 Ga0307513_10372375
319 Ga0307508_10360445
320 Ga0307514_10306952
321 Ga0307412_11285810
322 Ga0395900_1477288
323 Ga0395898_0001876
324 Ga0395898_0016707
325 Ga0436364_0641628
326 Ga0436364_1459592
327 Ga0395901_0343274
328 Ga0436362_0309346
329 Ga0451793_1727633
330 Ga0451853_2204347
331 Ga0466966_0322038
332 Ga0466963_0016898
333 Ga0466963_0020375
334 Ga0466963_0026083
335 Ga0466964_0007916
336 Ga0466957_0081150
337 Ga0466958_0150781
338 Ga0466967_0000522
339 Ga0466967_0031649
340 Ga0466967_0196000
341 Ga0466967_1179221
342 Ga0495629_0011097
343 Ga0495629_0025480
344 Ga0495629_0369016
345 Ga0495629_0643107
346 Ga0495585_0034227
347 Ga0495594_0001917
348 Ga0495594_0460386
349 Ga0495666_0070513
350 Ga0495640_0007669
351 Ga0495640_0084720
352 Ga0495622_0008015
353 Ga0495634_0057512
354 Ga0495588_0004354
355 Ga0495657_0083240
356 Ga0495658_0031900
357 Ga0495613_0762932
358 Ga0495624_0061539
359 Ga0495670_0724073
360 Ga0495581_0500843
361 Ga0495604_0006769
362 Ga0495604_0011235
363 Ga0495676_0001692
364 Ga0495676_0265096
365 Ga0495687_146466
366 Ga0495675_0171957
367 Ga0496100_0179611
368 Ga0496100_0284192
369 Ga0496101_0307045
370 Ga0496102_0567364
371 Ga0496104_0075882
372 Ga0496105_0005312
373 Ga0496105_0242842
374 Ga0496105_0450669
375 Ga0496110_0709542
376 Ga0496113_1343182
377 Ga0496114_0078599
378 Ga0496114_0232017
379 Ga0496115_0115838
380 Ga0496117_0048836
381 Ga0496118_0093665
382 Ga0496119_0056785
383 Ga0496120_0039497
384 Ga0496122_0022658
385 Ga0496123_0282967
386 Ga0496126_0735313
387 Ga0501031_0111941
388 Ga0501031_0136382
389 Ga0501031_0337077
390 Ga0501032_0138199
391 Ga0501032_0463179
392 Ga0501032_0763274
393 Ga0501033_0000850
394 Ga0501033_0014791
395 Ga0501033_0117108
396 Ga0501033_0146139
397 Ga0501033_0870852
398 Ga0501034_0036041
399 Ga0501034_0129715
400 Ga0501034_0129865
401 Ga0501034_0563893
402 Ga0501036_0015250
403 Ga0501036_0325960
404 Ga0501036_0634814
405 Ga0501037_0019657
406 Ga0501037_0227376
407 Ga0501038_0002101
408 Ga0501038_0019826
409 Ga0501038_0135343
410 Ga0501039_0274413
411 Ga0501040_0076891
412 Ga0501041_0191387
413 Ga0501043_0000682
414 Ga0501043_0056627
415 Ga0501043_0141059
416 Ga0501043_0198653
417 Ga0501043_0212648
418 Ga0501046_0041459
419 Ga0501046_0168925
420 Ga0501046_0226446
421 Ga0501047_0000947
422 Ga0501047_0064134
423 Ga0501047_0073774
424 Ga0501047_0148390
425 Ga0501047_0225911
426 Ga0501048_0371722
427 Ga0501068_0001844
428 Ga0501069_0524544
429 Ga0501070_0001724
430 Ga0501070_0018961
431 Ga0501070_0063759
432 Ga0501070_0074051
433 Ga0501070_0097714
434 Ga0501070_0772405
435 Ga0501070_1057139
436 Ga0501071_0000360
437 Ga0501072_0001023
438 Ga0501072_1284939
439 Ga0501073_0083159
440 Ga0501073_0094482
441 Ga0501073_0251542
442 Ga0501074_0009177
443 Ga0501074_0023885
444 Ga0501074_0102754
445 Ga0501076_0033609
446 Ga0501079_0000101
447 Ga0501080_0041053
448 Ga0501080_0068488
449 Ga0501080_0077880
450 Ga0501080_0440720
451 Ga0501080_1459272
452 Ga0501083_0057613
453 Ga0501035_0019662
454 Ga0501035_0023265
455 Ga0501035_0038475
456 Ga0501035_0082658
457 Ga0501035_0120433
458 Ga0501035_0125829
459 Ga0501035_0402152
460 Ga0501035_1372521
461 Ga0501044_0001028
462 Ga0501044_0013646
463 Ga0501044_0022815
464 Ga0501044_0027734
465 Ga0501044_0053202
466 Ga0501044_0092293
467 Ga0501044_0139603
468 Ga0501044_0222774
469 Ga0501044_0275424
470 Ga0501044_0485848
471 Ga0501045_0101244
472 Ga0501045_0117862
473 nmdc:mga03n38_43424_c1
474 nmdc:mga06z11_5098_c1
475 nmdc:mga04h51_159246_c1
476 nmdc:mga06r32_894778_c1
477 nmdc:mga08y16_497994_c1
478 nmdc:mga0rr50_451280_c1
479 Ga0495595_0452389
480 Ga0500553_189054
481 Ga0500560_000257
482 Ga0500614_029967
483 Ga0501084_0010182
484 Ga0501082_0027876
485 Ga0466962_0002126
486 Ga0530510_0024741
487 Ga0530510_0965159
488 2643947391
489 2644433138
490 2768647381
491 2862181046
492 2946073457
493 2990088832
494 3006327742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

30

145

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7879 29 146
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.775 29 146
4y9i-assembly1.cif.gz_A structure of f420-h2 dependent reductase (fdr-a) msmeg_2027 0.7431 31 144
2fhq-assembly1.cif.gz_B crystal structure of general stress protein from bacteroides thetaiotaomicron 0.7389 31 144
4l82-assembly2.cif.gz_D structure of a putative oxidoreductase from rickettsia felis 0.7184 29 83
ID Description Score Start End Superfamily
2ptfB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8032 30 81 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7866 27 147 2.30.110.10
af_O53777_34_155_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7557 29 140 2.30.110.10
af_Q58848_1_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7514 28 81 2.30.110.10
4y9iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7429 31 144 2.30.110.10
ID Description Score Start End GO Terms
AF-G8SDI0-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9888 29 146 GO:0016491
AF-A0A388ST72-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.985 37 145 GO:0016491
AF-A0A5H2UID3-F1-model_v4 deleted 0.9825 29 147
AF-G8SDI0-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9806 29 146 GO:0016491
AF-A0A6G2S0P6-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9781 14 147 GO:0016491

Map