F359337

General Info

Members Datasets Scaffolds Average Seq Length
247 173 494 219

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000944|Ga0495686_0000944_2539_3312
Length 257
Sequence LARHPFNCGRDPPSTSLCEAGDVRLPDTETIMADDTRPTTAAFPASTTIEGVSIPDSALGRAITEFVRDTETELLFNHSSRVYFFGALAGRQRGLSVNPELLYAATMFHDVGLMPLHSSQDLRFEVDGANAARDFLTSYGLDPSDIEKVWTGIALHTTPGVPEFMHPVIALTTAGVEMDVLGLTYDRYSDEIREAVVTAFPRTPRFKEDIIQAFYEGIKHKPDTTFGNVKADVIADKEPHFHRGNFCAVIRGSHWHA

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
71 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
150 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
151 2643221599 Rhizobium sp. Root708 Isolate Unclassified
152 2643221616 Leifsonia sp. Root227 Isolate Unclassified
153 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
154 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
155 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
156 2739367653 Kocuria sp. OV113 Isolate Unclassified
157 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
158 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
159 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
160 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
161 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
162 2857727296 Kocuria sp. R-72562 Isolate Unclassified
163 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
164 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
165 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
166 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
167 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
168 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
169 2919404418 Luteibacter sp. 3190 Isolate Unclassified
170 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
171 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
172 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
173 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 89.88
Metatranscriptomes 0
Isolates 10.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 12.55
Nodule 0.81
Rhizoplane 3.24
Rhizosphere 68.02
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000944 3300047472 Bacteria 36054
2 JGI24737J22298_10122345 3300001990 Bacteria 769
3 rootH2_10180068 3300003320 Bacteria 7567
4 Ga0070658_10038649 3300005327 Bacteria 3848
5 Ga0070683_100039829 3300005329 Bacteria 4317
6 Ga0070683_100185478 3300005329 Bacteria 1975
7 Ga0070670_100005017 3300005331 Bacteria 11137
8 Ga0068868_100132636 3300005338 Bacteria 2040
9 Ga0070661_100066814 3300005344 Bacteria 2642
10 Ga0070668_100622680 3300005347 Bacteria 946
11 Ga0070659_100009264 3300005366 Bacteria 7227
12 Ga0070714_100142083 3300005435 Bacteria 2156
13 Ga0070714_100161008 3300005435 Bacteria 2030
14 Ga0070714_100618102 3300005435 Bacteria 1041
15 Ga0070713_100221741 3300005436 Bacteria 1715
16 Ga0070711_100111822 3300005439 Bacteria 2006
17 Ga0070711_100385581 3300005439 Bacteria 1134
18 Ga0070679_100065879 3300005530 Bacteria 3610
19 Ga0070679_100320517 3300005530 Bacteria 1499
20 Ga0068853_100122318 3300005539 Bacteria 2323
21 Ga0068855_100015042 3300005563 Bacteria 9318
22 Ga0068855_100030351 3300005563 Bacteria 6466
23 Ga0068861_100377938 3300005719 Bacteria 1251
24 Ga0068862_100037635 3300005844 Bacteria 4101
25 Ga0070717_10029648 3300006028 Bacteria 4391
26 Ga0070717_10573117 3300006028 Bacteria 1023
27 Ga0075365_10109097 3300006038 Bacteria 1901
28 Ga0075363_100104485 3300006048 Bacteria 1570
29 Ga0075363_100132746 3300006048 Bacteria 1397
30 Ga0075364_10000572 3300006051 Bacteria 18934
31 Ga0075364_10011599 3300006051 Bacteria 5357
32 Ga0075364_10012712 3300006051 Bacteria 5160
33 Ga0075364_10084945 3300006051 Bacteria 2096
34 Ga0075364_10341470 3300006051 Bacteria 1020
35 Ga0070712_100371869 3300006175 Bacteria 1175
36 Ga0075369_10022946 3300006186 Bacteria 2576
37 Ga0099826_10000019 3300006948 Bacteria 188386
38 Ga0105240_10016389 3300009093 Bacteria 10034
39 Ga0105240_10151766 3300009093 Bacteria 2759
40 Ga0111539_10783330 3300009094 Bacteria 1110
41 Ga0105248_10009295 3300009177 Bacteria 10824
42 Ga0105237_11435778 3300009545 Bacteria 696
43 Ga0105249_10012122 3300009553 Bacteria 7588
44 Ga0157370_10033270 3300013104 Bacteria 5026
45 Ga0157369_10028575 3300013105 Bacteria 6171
46 Ga0157369_10064468 3300013105 Bacteria 3946
47 Ga0157369_10114174 3300013105 Bacteria 2869
48 Ga0157369_10759048 3300013105 Bacteria 997
49 Ga0157369_10770034 3300013105 Bacteria 989
50 Ga0157372_10013374 3300013307 Bacteria 8762
51 Ga0213872_10017612 3300021361 Bacteria 3299
52 Ga0213872_10021868 3300021361 Bacteria 2945
53 Ga0213876_10021153 3300021384 Bacteria 3440
54 Ga0207692_10232071 3300025898 Bacteria 1099
55 Ga0207705_10021533 3300025909 Bacteria 4602
56 Ga0207695_10010386 3300025913 Bacteria 11392
57 Ga0207695_10349016 3300025913 Bacteria 1367
58 Ga0207693_10170374 3300025915 Bacteria 1715
59 Ga0207660_10485937 3300025917 Bacteria 1001
60 Ga0207657_10039275 3300025919 Bacteria 4208
61 Ga0207649_10343017 3300025920 Bacteria 1103
62 Ga0207649_10684747 3300025920 Bacteria 794
63 Ga0207652_10116219 3300025921 Bacteria 2376
64 Ga0207694_10410304 3300025924 Bacteria 1127
65 Ga0207650_10003897 3300025925 Bacteria 10201
66 Ga0207700_10181682 3300025928 Bacteria 1762
67 Ga0207664_10108702 3300025929 Bacteria 2303
68 Ga0207664_10451286 3300025929 Bacteria 1148
69 Ga0207690_10104009 3300025932 Bacteria 2033
70 Ga0207667_10027778 3300025949 Bacteria 6154
71 Ga0207667_10063987 3300025949 Bacteria 3842
72 Ga0207712_10086853 3300025961 Bacteria 2292
73 Ga0207639_10010902 3300026041 Bacteria 6302
74 Ga0207678_10114490 3300026067 Bacteria 2301
75 Ga0207675_100068241 3300026118 Bacteria 3324
76 Ga0209282_1000211 3300027666 Bacteria 30841
77 Ga0307515_10020996 3300028794 Bacteria 11605
78 Ga0307513_10120375 3300031456 Bacteria 2594
79 Ga0307509_10069384 3300031507 Bacteria 3684
80 Ga0307516_10183219 3300031730 Unclassified 1826
81 Ga0307405_10300346 3300031731 Bacteria 1218
82 Ga0307518_10212010 3300031838 Unclassified 1274
83 Ga0307407_10424504 3300031903 Unclassified 959
84 Ga0307412_10570550 3300031911 Unclassified 953
85 Ga0307507_10010106 3300033179 Bacteria 12328
86 Ga0307510_10052320 3300033180 Bacteria 4307
87 Ga0395899_0053810 3300037312 Plasmid 2980
88 Ga0395900_0045800 3300037418 Bacteria 4505
89 Ga0395898_0040300 3300037466 Bacteria 4619
90 Ga0395898_0470793 3300037466 Bacteria 1196
91 Ga0395905_0140095 3300037471 Bacteria 2276
92 Ga0395905_0453303 3300037471 Bacteria 1181
93 Ga0436361_0383364 3300039447 Bacteria 1682
94 Ga0436361_0566566 3300039447 Bacteria 1393
95 Ga0436361_0608645 3300039447 Bacteria 1309
96 Ga0436361_0670517 3300039447 Bacteria 6962
97 Ga0439461_0000325 3300041410 Bacteria 6759
98 Ga0439460_0112891 3300042461 Bacteria 883
99 Ga0466969_0069097 3300044656 Bacteria 1702
100 Ga0466972_0002290 3300044658 Bacteria 9407
101 Ga0466965_0004039 3300044683 Bacteria 6507
102 Ga0466965_0015385 3300044683 Bacteria 3635
103 Ga0466966_0002370 3300044684 Bacteria 12304
104 Ga0466966_0036759 3300044684 Bacteria 3161
105 Ga0466961_0030750 3300044693 Bacteria 3450
106 Ga0466961_0035787 3300044693 Bacteria 3188
107 Ga0466961_0345619 3300044693 Unclassified 906
108 Ga0466963_0021969 3300044694 Bacteria 4034
109 Ga0466963_0209219 3300044694 Bacteria 1365
110 Ga0466971_0070403 3300044719 Bacteria 1588
111 Ga0466968_0043971 3300044735 Bacteria 1892
112 Ga0466970_0075527 3300044765 Bacteria 1815
113 Ga0466957_0201846 3300044842 Bacteria 1306
114 Ga0466957_0500224 3300044842 Bacteria 842
115 Ga0466960_0000583 3300044901 Bacteria 12632
116 Ga0466960_0000631 3300044901 Bacteria 12145
117 Ga0466959_0105445 3300045049 Bacteria 2015
118 Ga0466959_0249531 3300045049 Bacteria 1224
119 Ga0466959_0281986 3300045049 Bacteria 1140
120 Ga0466959_0368093 3300045049 Bacteria 979
121 Ga0466958_0010014 3300045836 Bacteria 5296
122 Ga0466958_0026340 3300045836 Bacteria 3436
123 Ga0466958_0140891 3300045836 Bacteria 1518
124 Ga0466967_0001505 3300045976 Bacteria 13615
125 Ga0466967_0008964 3300045976 Bacteria 7388
126 Ga0466967_0020161 3300045976 Bacteria 5380
127 Ga0495629_0168434 3300046459 Bacteria 1521
128 Ga0495641_0180784 3300046461 Bacteria 944
129 Ga0495650_0071207 3300046471 Bacteria 1364
130 Ga0495594_0218390 3300046499 Bacteria 1087
131 Ga0495583_0000001 3300046506 Bacteria 811973
132 Ga0495640_0154888 3300046533 Bacteria 1471
133 Ga0495625_0247275 3300046660 Bacteria 1159
134 Ga0495635_0130980 3300046663 Bacteria 1710
135 Ga0495588_0017527 3300046674 Bacteria 3480
136 Ga0495658_0165778 3300046683 Bacteria 1365
137 Ga0495669_0135700 3300046684 Bacteria 1160
138 Ga0495624_0078883 3300046690 Bacteria 2042
139 Ga0495581_0115239 3300047315 Bacteria 1563
140 Ga0495674_0113670 3300047319 Bacteria 2293
141 Ga0495672_0047142 3300047320 Bacteria 2565
142 Ga0495686_0000053 3300047472 Bacteria 259537
143 Ga0495686_0000302 3300047472 Bacteria 84826
144 Ga0495686_0002694 3300047472 Bacteria 16296
145 Ga0495686_0048918 3300047472 Bacteria 2663
146 Ga0495686_0082742 3300047472 Bacteria 1959
147 Ga0495593_0045324 3300047673 Bacteria 2347
148 Ga0496101_0025288 3300048904 Bacteria 4118
149 Ga0496109_0298906 3300048912 Bacteria 1518
150 Ga0496111_0507350 3300048914 Bacteria 887
151 Ga0496112_0165820 3300048915 Bacteria 2175
152 Ga0496112_0292723 3300048915 Bacteria 1574
153 Ga0496113_0021327 3300048916 Bacteria 4568
154 Ga0496114_0874905 3300048917 Bacteria 779
155 Ga0496118_0000444 3300048921 Bacteria 68615
156 Ga0496119_0109783 3300048922 Bacteria 1533
157 Ga0496120_0054085 3300048923 Bacteria 2278
158 Ga0496121_0171695 3300048924 Bacteria 1574
159 Ga0496122_0000218 3300048925 Bacteria 127770
160 Ga0496122_0008997 3300048925 Bacteria 10613
161 Ga0496123_0000327 3300048926 Bacteria 90879
162 Ga0496123_0005066 3300048926 Bacteria 13463
163 Ga0496124_0225183 3300048927 Bacteria 1407
164 Ga0496126_0006516 3300048929 Bacteria 12993
165 Ga0496126_0017400 3300048929 Bacteria 7161
166 Ga0496126_0094034 3300048929 Bacteria 2631
167 Ga0496126_0163461 3300048929 Bacteria 1901
168 Ga0501032_0090099 3300049569 Bacteria 2035
169 Ga0501033_0032256 3300049570 Bacteria 3934
170 Ga0501034_0002870 3300049571 Bacteria 20041
171 Ga0501034_0294448 3300049571 Bacteria 1560
172 Ga0501034_0427507 3300049571 Bacteria 1245
173 Ga0501037_0009144 3300049573 Bacteria 7260
174 Ga0501037_0090003 3300049573 Bacteria 2220
175 Ga0501038_0323648 3300049574 Bacteria 1205
176 Ga0501039_0027592 3300049575 Bacteria 4365
177 Ga0501043_0043567 3300049579 Bacteria 3527
178 Ga0501046_0006958 3300049580 Bacteria 9966
179 Ga0501047_0023256 3300049581 Bacteria 5951
180 Ga0501047_0036567 3300049581 Bacteria 4746
181 Ga0501047_0149277 3300049581 Bacteria 2214
182 Ga0501047_0427325 3300049581 Bacteria 1156
183 Ga0501048_0028548 3300049582 Bacteria 4050
184 Ga0501069_0004310 3300049585 Bacteria 7352
185 Ga0501069_0059145 3300049585 Bacteria 2139
186 Ga0501070_0005561 3300049586 Bacteria 10746
187 Ga0501070_0572670 3300049586 Bacteria 902
188 Ga0501073_0039785 3300049589 Bacteria 3330
189 Ga0501077_0212914 3300049593 Bacteria 1228
190 Ga0501080_0056575 3300049742 Bacteria 3652
191 Ga0501035_0042014 3300049822 Bacteria 4125
192 Ga0501044_0009509 3300049823 Bacteria 10583
193 Ga0501044_0067621 3300049823 Bacteria 3640
194 Ga0501044_0227855 3300049823 Bacteria 1812
195 nmdc:mga03683_82897_c2 3300050489 Bacteria 1008
196 nmdc:mga03n38_349420_c1 3300050490 Bacteria 804
197 nmdc:mga03n38_4138_c1 3300050490 Bacteria 4763
198 nmdc:mga00v17_13971_c1 3300050491 Bacteria 4471
199 nmdc:mga00v17_37963_c1 3300050491 Bacteria 2878
200 nmdc:mga00v17_99477_c1 3300050491 Bacteria 1834
201 nmdc:mga07m45_164719_c1 3300050496 Bacteria 1288
202 nmdc:mga08y16_600741_c1 3300050511 Bacteria 1109
203 nmdc:mga0sz30_104365_c1 3300050516 Bacteria 1239
204 nmdc:mga0sz30_81108_c1 3300050516 Bacteria 1404
205 Ga0495601_0156385 3300053077 Bacteria 1489
206 Ga0495619_0053182 3300053085 Bacteria 2678
207 Ga0500643_059210 3300053087 Bacteria 1078
208 Ga0500651_0033282 3300053093 Bacteria 3251
209 Ga0500651_0206874 3300053093 Bacteria 1156
210 Ga0500562_057082 3300053108 Bacteria 1047
211 Ga0500618_000106 3300053125 Bacteria 67801
212 Ga0500618_000753 3300053125 Bacteria 18333
213 Ga0500618_004126 3300053125 Bacteria 4752
214 Ga0500618_007367 3300053125 Bacteria 3145
215 Ga0500618_015917 3300053125 Bacteria 1890
216 Ga0500559_0112241 3300053136 Bacteria 1263
217 Ga0500559_0112866 3300053136 Bacteria 1260
218 Ga0500645_000004 3300053730 Bacteria 305014
219 Ga0500645_007822 3300053730 Bacteria 3696
220 Ga0501084_0605059 3300054114 Bacteria 926
221 Ga0466962_0018116 3300061719 Bacteria 3387
222 Ga0466962_0259931 3300061719 Bacteria 854
223 2511130094 2510917021 Bacteria 5705459
224 2600377246 2600254933 Bacteria 4750527
225 2644003928 2643221599 Bacteria 6292121
226 2644094264 2643221616 Bacteria 4066575
227 2644637706 2643221715 Bacteria 6671032
228 2691515971 2690315906 Bacteria 4517044
229 2723879025 2721755763 Bacteria 4464185
230 2739603912 2739367653 Bacteria 2780952
231 2758639959 2758568016 Bacteria 5645291
232 2791922508 2791354903 Bacteria 4937680
233 2817509646 2816332305 Bacteria 2697803
234 2819714911 2818991466 Bacteria 4748179
235 2857508874 2857504554 Bacteria 5369913
236 2857728441 2857727296 Bacteria 2745552
237 2857740959 2857740372 Bacteria 4782044
238 2884219667 2884215851 Bacteria 4554841
239 2902802692 2902799365 Bacteria 5419524
240 2902815218 2902810491 Bacteria 6794147
241 2909399114 2909399089 Bacteria 3922598
242 2919040298 2919039151 Bacteria 3391018
243 2919405732 2919404418 Bacteria 4232372
244 2929218701 2929212328 Bacteria 7708288
245 2939674911 2939674588 Bacteria 4844420
246 2954000681 2953998280 Bacteria 4812144
247 2984552936 2984551494 Bacteria 3877562
248 Ga0495686_0000944
249 JGI24737J22298_10122345
250 rootH2_10180068
251 Ga0070658_10038649
252 Ga0070683_100039829
253 Ga0070683_100185478
254 Ga0070670_100005017
255 Ga0068868_100132636
256 Ga0070661_100066814
257 Ga0070668_100622680
258 Ga0070659_100009264
259 Ga0070714_100142083
260 Ga0070714_100161008
261 Ga0070714_100618102
262 Ga0070713_100221741
263 Ga0070711_100111822
264 Ga0070711_100385581
265 Ga0070679_100065879
266 Ga0070679_100320517
267 Ga0068853_100122318
268 Ga0068855_100015042
269 Ga0068855_100030351
270 Ga0068861_100377938
271 Ga0068862_100037635
272 Ga0070717_10029648
273 Ga0070717_10573117
274 Ga0075365_10109097
275 Ga0075363_100104485
276 Ga0075363_100132746
277 Ga0075364_10000572
278 Ga0075364_10011599
279 Ga0075364_10012712
280 Ga0075364_10084945
281 Ga0075364_10341470
282 Ga0070712_100371869
283 Ga0075369_10022946
284 Ga0099826_10000019
285 Ga0105240_10016389
286 Ga0105240_10151766
287 Ga0111539_10783330
288 Ga0105248_10009295
289 Ga0105237_11435778
290 Ga0105249_10012122
291 Ga0157370_10033270
292 Ga0157369_10028575
293 Ga0157369_10064468
294 Ga0157369_10114174
295 Ga0157369_10759048
296 Ga0157369_10770034
297 Ga0157372_10013374
298 Ga0213872_10017612
299 Ga0213872_10021868
300 Ga0213876_10021153
301 Ga0207692_10232071
302 Ga0207705_10021533
303 Ga0207695_10010386
304 Ga0207695_10349016
305 Ga0207693_10170374
306 Ga0207660_10485937
307 Ga0207657_10039275
308 Ga0207649_10343017
309 Ga0207649_10684747
310 Ga0207652_10116219
311 Ga0207694_10410304
312 Ga0207650_10003897
313 Ga0207700_10181682
314 Ga0207664_10108702
315 Ga0207664_10451286
316 Ga0207690_10104009
317 Ga0207667_10027778
318 Ga0207667_10063987
319 Ga0207712_10086853
320 Ga0207639_10010902
321 Ga0207678_10114490
322 Ga0207675_100068241
323 Ga0209282_1000211
324 Ga0307515_10020996
325 Ga0307513_10120375
326 Ga0307509_10069384
327 Ga0307516_10183219
328 Ga0307405_10300346
329 Ga0307518_10212010
330 Ga0307407_10424504
331 Ga0307412_10570550
332 Ga0307507_10010106
333 Ga0307510_10052320
334 Ga0395899_0053810
335 Ga0395900_0045800
336 Ga0395898_0040300
337 Ga0395898_0470793
338 Ga0395905_0140095
339 Ga0395905_0453303
340 Ga0436361_0383364
341 Ga0436361_0566566
342 Ga0436361_0608645
343 Ga0436361_0670517
344 Ga0439461_0000325
345 Ga0439460_0112891
346 Ga0466969_0069097
347 Ga0466972_0002290
348 Ga0466965_0004039
349 Ga0466965_0015385
350 Ga0466966_0002370
351 Ga0466966_0036759
352 Ga0466961_0030750
353 Ga0466961_0035787
354 Ga0466961_0345619
355 Ga0466963_0021969
356 Ga0466963_0209219
357 Ga0466971_0070403
358 Ga0466968_0043971
359 Ga0466970_0075527
360 Ga0466957_0201846
361 Ga0466957_0500224
362 Ga0466960_0000583
363 Ga0466960_0000631
364 Ga0466959_0105445
365 Ga0466959_0249531
366 Ga0466959_0281986
367 Ga0466959_0368093
368 Ga0466958_0010014
369 Ga0466958_0026340
370 Ga0466958_0140891
371 Ga0466967_0001505
372 Ga0466967_0008964
373 Ga0466967_0020161
374 Ga0495629_0168434
375 Ga0495641_0180784
376 Ga0495650_0071207
377 Ga0495594_0218390
378 Ga0495583_0000001
379 Ga0495640_0154888
380 Ga0495625_0247275
381 Ga0495635_0130980
382 Ga0495588_0017527
383 Ga0495658_0165778
384 Ga0495669_0135700
385 Ga0495624_0078883
386 Ga0495581_0115239
387 Ga0495674_0113670
388 Ga0495672_0047142
389 Ga0495686_0000053
390 Ga0495686_0000302
391 Ga0495686_0002694
392 Ga0495686_0048918
393 Ga0495686_0082742
394 Ga0495593_0045324
395 Ga0496101_0025288
396 Ga0496109_0298906
397 Ga0496111_0507350
398 Ga0496112_0165820
399 Ga0496112_0292723
400 Ga0496113_0021327
401 Ga0496114_0874905
402 Ga0496118_0000444
403 Ga0496119_0109783
404 Ga0496120_0054085
405 Ga0496121_0171695
406 Ga0496122_0000218
407 Ga0496122_0008997
408 Ga0496123_0000327
409 Ga0496123_0005066
410 Ga0496124_0225183
411 Ga0496126_0006516
412 Ga0496126_0017400
413 Ga0496126_0094034
414 Ga0496126_0163461
415 Ga0501032_0090099
416 Ga0501033_0032256
417 Ga0501034_0002870
418 Ga0501034_0294448
419 Ga0501034_0427507
420 Ga0501037_0009144
421 Ga0501037_0090003
422 Ga0501038_0323648
423 Ga0501039_0027592
424 Ga0501043_0043567
425 Ga0501046_0006958
426 Ga0501047_0023256
427 Ga0501047_0036567
428 Ga0501047_0149277
429 Ga0501047_0427325
430 Ga0501048_0028548
431 Ga0501069_0004310
432 Ga0501069_0059145
433 Ga0501070_0005561
434 Ga0501070_0572670
435 Ga0501073_0039785
436 Ga0501077_0212914
437 Ga0501080_0056575
438 Ga0501035_0042014
439 Ga0501044_0009509
440 Ga0501044_0067621
441 Ga0501044_0227855
442 nmdc:mga03683_82897_c2
443 nmdc:mga03n38_349420_c1
444 nmdc:mga03n38_4138_c1
445 nmdc:mga00v17_13971_c1
446 nmdc:mga00v17_37963_c1
447 nmdc:mga00v17_99477_c1
448 nmdc:mga07m45_164719_c1
449 nmdc:mga08y16_600741_c1
450 nmdc:mga0sz30_104365_c1
451 nmdc:mga0sz30_81108_c1
452 Ga0495601_0156385
453 Ga0495619_0053182
454 Ga0500643_059210
455 Ga0500651_0033282
456 Ga0500651_0206874
457 Ga0500562_057082
458 Ga0500618_000106
459 Ga0500618_000753
460 Ga0500618_004126
461 Ga0500618_007367
462 Ga0500618_015917
463 Ga0500559_0112241
464 Ga0500559_0112866
465 Ga0500645_000004
466 Ga0500645_007822
467 Ga0501084_0605059
468 Ga0466962_0018116
469 Ga0466962_0259931
470 2511130094
471 2600377246
472 2644003928
473 2644094264
474 2644637706
475 2691515971
476 2723879025
477 2739603912
478 2758639959
479 2791922508
480 2817509646
481 2819714911
482 2857508874
483 2857728441
484 2857740959
485 2884219667
486 2902802692
487 2902815218
488 2909399114
489 2919040298
490 2919405732
491 2929218701
492 2939674911
493 2954000681
494 2984552936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

75

197

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.8212 2 196
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.816 1 198
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8018 2 196
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7667 1 198
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.7596 2 196
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9168 12 167 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8795 12 167 1.10.3210.10
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6526 16 135 1.10.3210.10
af_Q54FD6_219_324_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5804 15 105 1.10.472.10
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.5726 15 170 1.10.3210.50
ID Description Score Start End GO Terms
AF-A0A370FDU1-F1-model_v4 HD domain-containing protein 0.993 1 211
AF-A0A7Z1U6Q2-F1-model_v4 deleted 0.989 1 211
AF-A0A1I5G940-F1-model_v4 HD domain-containing protein 0.9887 1 172
AF-A0A370FDU1-F1-model_v4 HD domain-containing protein 0.9884 1 211
AF-A0A3N1ZT72-F1-model_v4 HD domain-containing protein 0.9882 1 210

Map