F359178

General Info

Members Datasets Scaffolds Average Seq Length
247 145 494 216

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0064026|Ga0395899_0064026_160_930
Length 256
Sequence LSQSTLDAHGARGNLRRKTHRGQSTADIVGTFRKEIFMTLALGDTAPDFKAQTTEGPISFHEWLGDSWGLFFSHPKDFTPVCTTELGAVARLAPEWKKRNVKPIGISVDPVDDHGKWAADIAETQGTAPNFPVIGDPDLSIAKLYGMLPAAAGTTSEGRTASDNQTVRNVFIIGPDKKIKLILVYPMTTGRNFDEIIRIIDSLQLTAKHRVATPADWRQGDDVIIAGSVSNEEAQKIYPGGWKAPKPYLRIVPQPK

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
135 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
140 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
141 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
142 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
143 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
144 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
145 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.55
Metatranscriptomes 1.62
Isolates 2.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 1.62
Rhizoplane 0
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0064026 3300037312 Bacteria 2704
2 JGI24735J21928_10000290 3300002067 Bacteria 17505
3 JGI24742J22300_10024062 3300002244 Bacteria 1049
4 Ga0058862_12690635 3300004803 Bacteria 880
5 Ga0065715_10359880 3300005293 Bacteria 937
6 Ga0070658_10002487 3300005327 Bacteria 15395
7 Ga0070658_10486892 3300005327 Bacteria 1065
8 Ga0070683_100161064 3300005329 Bacteria 2129
9 Ga0070680_100027078 3300005336 Bacteria 4590
10 Ga0070680_100718303 3300005336 Bacteria 860
11 Ga0070660_100001648 3300005339 Bacteria 15352
12 Ga0070660_100016179 3300005339 Bacteria 5408
13 Ga0070691_10033815 3300005341 Bacteria 2406
14 Ga0070661_100000551 3300005344 Bacteria 28749
15 Ga0070661_100220039 3300005344 Bacteria 1456
16 Ga0070661_100344435 3300005344 Bacteria 1168
17 Ga0070668_100000306 3300005347 Bacteria 32248
18 Ga0070669_100538323 3300005353 Bacteria 972
19 Ga0070659_100274339 3300005366 Bacteria 1402
20 Ga0070659_100281320 3300005366 Bacteria 1384
21 Ga0070694_100005777 3300005444 Bacteria 7504
22 Ga0070663_100762543 3300005455 Bacteria 827
23 Ga0070662_100000429 3300005457 Bacteria 24862
24 Ga0070662_100159799 3300005457 Bacteria 1762
25 Ga0070681_10015007 3300005458 Bacteria 7704
26 Ga0070681_10017096 3300005458 Bacteria 7249
27 Ga0070681_10142850 3300005458 Bacteria 2323
28 Ga0070681_10615062 3300005458 Bacteria 1001
29 Ga0070681_10696500 3300005458 Bacteria 932
30 Ga0070706_100409870 3300005467 Bacteria 1262
31 Ga0070707_100097675 3300005468 Bacteria 2845
32 Ga0070698_100062681 3300005471 Bacteria 3751
33 Ga0070679_100000431 3300005530 Bacteria 35640
34 Ga0070679_100038254 3300005530 Bacteria 4769
35 Ga0070679_100065385 3300005530 Bacteria 3625
36 Ga0070684_100316546 3300005535 Bacteria 1433
37 Ga0068853_100127199 3300005539 Bacteria 2277
38 Ga0068853_100384640 3300005539 Bacteria 1311
39 Ga0068853_100647064 3300005539 Bacteria 1006
40 Ga0070695_100216945 3300005545 Bacteria 1376
41 Ga0068855_100004067 3300005563 Bacteria 17852
42 Ga0068855_100045279 3300005563 Bacteria 5204
43 Ga0068855_100062027 3300005563 Bacteria 4366
44 Ga0068855_100619864 3300005563 Bacteria 1165
45 Ga0070664_100043422 3300005564 Bacteria 3793
46 Ga0070664_100276950 3300005564 Bacteria 1512
47 Ga0068857_100063498 3300005577 Bacteria 3283
48 Ga0068854_100116208 3300005578 Bacteria 2025
49 Ga0068856_100066232 3300005614 Bacteria 3570
50 Ga0068856_100176911 3300005614 Bacteria 2146
51 Ga0068852_100036195 3300005616 Bacteria 4127
52 Ga0068852_100083973 3300005616 Bacteria 2833
53 Ga0068852_100133573 3300005616 Bacteria 2288
54 Ga0068852_100263348 3300005616 Bacteria 1656
55 Ga0068862_100000858 3300005844 Bacteria 29795
56 Ga0081455_10033748 3300005937 Bacteria 4594
57 Ga0097621_100635652 3300006237 Bacteria 978
58 Ga0075370_10000001 3300006353 Bacteria 239876
59 Ga0105240_10178704 3300009093 Bacteria 2506
60 Ga0105240_10528201 3300009093 Bacteria 1308
61 Ga0105240_11192566 3300009093 Bacteria 806
62 Ga0114129_10016500 3300009147 Bacteria 10516
63 Ga0105241_10252592 3300009174 Bacteria 1495
64 Ga0105241_10605078 3300009174 Bacteria 991
65 Ga0105237_10275900 3300009545 Bacteria 1684
66 Ga0105237_10397078 3300009545 Bacteria 1384
67 Ga0105238_10318953 3300009551 Bacteria 1540
68 Ga0105238_10411570 3300009551 Bacteria 1346
69 Ga0105239_10076355 3300010375 Bacteria 3685
70 Ga0157373_10039229 3300013100 Bacteria 3391
71 Ga0157373_10349993 3300013100 Bacteria 1054
72 Ga0157371_10078027 3300013102 Bacteria 2346
73 Ga0157371_10194587 3300013102 Bacteria 1452
74 Ga0157370_10155176 3300013104 Bacteria 2130
75 Ga0157378_10384687 3300013297 Bacteria 1379
76 Ga0157372_10065890 3300013307 Bacteria 4069
77 Ga0157372_10104857 3300013307 Bacteria 3233
78 Ga0206351_10859604 3300020077 Bacteria 690
79 Ga0206350_11026449 3300020080 Bacteria 677
80 Ga0213872_10036316 3300021361 Bacteria 2252
81 Ga0213875_10111692 3300021388 Bacteria 1276
82 Ga0213871_10008655 3300021441 Bacteria 2255
83 Ga0224712_10289993 3300022467 Bacteria 763
84 Ga0207647_10075961 3300025904 Bacteria 2021
85 Ga0207647_10148099 3300025904 Bacteria 1373
86 Ga0207705_10517789 3300025909 Bacteria 927
87 Ga0207684_10000077 3300025910 Bacteria 182957
88 Ga0207654_10154663 3300025911 Bacteria 1476
89 Ga0207707_10021467 3300025912 Bacteria 5644
90 Ga0207707_10028056 3300025912 Bacteria 4920
91 Ga0207707_10355695 3300025912 Bacteria 1261
92 Ga0207695_10042022 3300025913 Bacteria 4888
93 Ga0207695_10188809 3300025913 Bacteria 1979
94 Ga0207671_10026914 3300025914 Bacteria 4303
95 Ga0207660_10072798 3300025917 Bacteria 2504
96 Ga0207660_10234519 3300025917 Bacteria 1444
97 Ga0207657_10002606 3300025919 Bacteria 19487
98 Ga0207657_10025636 3300025919 Bacteria 5432
99 Ga0207657_10047286 3300025919 Bacteria 3763
100 Ga0207657_10124976 3300025919 Bacteria 2113
101 Ga0207649_10166598 3300025920 Bacteria 1531
102 Ga0207649_10600956 3300025920 Bacteria 846
103 Ga0207652_10007674 3300025921 Bacteria 8675
104 Ga0207652_10029684 3300025921 Bacteria 4574
105 Ga0207652_10564140 3300025921 Bacteria 1022
106 Ga0207646_10108926 3300025922 Bacteria 2486
107 Ga0207694_10288237 3300025924 Bacteria 1350
108 Ga0207690_10004893 3300025932 Bacteria 7902
109 Ga0207690_10092879 3300025932 Bacteria 2137
110 Ga0207706_10004324 3300025933 Bacteria 13339
111 Ga0207706_10162186 3300025933 Bacteria 1965
112 Ga0207686_10250849 3300025934 Bacteria 1293
113 Ga0207686_10337641 3300025934 Bacteria 1131
114 Ga0207661_10054606 3300025944 Bacteria 3201
115 Ga0207661_10081552 3300025944 Bacteria 2672
116 Ga0207679_10008634 3300025945 Bacteria 6496
117 Ga0207679_10074411 3300025945 Bacteria 2574
118 Ga0207667_10003767 3300025949 Bacteria 18678
119 Ga0207667_10066522 3300025949 Bacteria 3757
120 Ga0207667_10095700 3300025949 Bacteria 3065
121 Ga0207667_10355227 3300025949 Bacteria 1494
122 Ga0207667_10552222 3300025949 Bacteria 1165
123 Ga0207667_10774435 3300025949 Bacteria 958
124 Ga0207668_10001166 3300025972 Bacteria 15615
125 Ga0207640_10095747 3300025981 Bacteria 2068
126 Ga0207640_10292508 3300025981 Bacteria 1285
127 Ga0207658_10121169 3300025986 Bacteria 2086
128 Ga0207639_10002044 3300026041 Bacteria 13606
129 Ga0207639_10104153 3300026041 Bacteria 2300
130 Ga0207639_10328310 3300026041 Bacteria 1360
131 Ga0207639_10357083 3300026041 Bacteria 1307
132 Ga0207639_10733137 3300026041 Bacteria 918
133 Ga0207678_10053526 3300026067 Bacteria 3478
134 Ga0207678_10352713 3300026067 Bacteria 1269
135 Ga0207702_10410709 3300026078 Bacteria 1307
136 Ga0207674_10076013 3300026116 Bacteria 3367
137 Ga0207698_10191584 3300026142 Bacteria 1822
138 Ga0268266_10010193 3300028379 Bacteria 8233
139 Ga0268265_10000827 3300028380 Bacteria 29294
140 Ga0268264_11364908 3300028381 Bacteria 719
141 Ga0265337_1002607 3300028556 Bacteria 8142
142 Ga0265334_10005694 3300028573 Bacteria 5438
143 Ga0265338_10010311 3300028800 Bacteria 10980
144 Ga0265325_10053884 3300031241 Bacteria 2061
145 Ga0265331_10200515 3300031250 Bacteria 899
146 Ga0265316_10448097 3300031344 Bacteria 926
147 Ga0265314_10146514 3300031711 Bacteria 1453
148 Ga0307405_10263936 3300031731 Bacteria 1288
149 Ga0307413_10031214 3300031824 Bacteria 3003
150 Ga0307413_10187504 3300031824 Bacteria 1482
151 Ga0307410_10042139 3300031852 Bacteria 3015
152 Ga0307407_10007140 3300031903 Bacteria 5036
153 Ga0307409_100477826 3300031995 Bacteria 1209
154 Ga0307414_10004450 3300032004 Bacteria 7609
155 Ga0307414_10013826 3300032004 Bacteria 4816
156 Ga0307414_10496252 3300032004 Unclassified 1079
157 Ga0307411_10003912 3300032005 Bacteria 7026
158 Ga0307411_10371865 3300032005 Bacteria 1173
159 Ga0373941_0015726 3300035115 Bacteria 2046
160 Ga0395899_0068450 3300037312 Bacteria 2603
161 Ga0395899_0121695 3300037312 Bacteria 1869
162 Ga0395899_0581926 3300037312 Bacteria 715
163 Ga0395900_0009578 3300037418 Bacteria 9931
164 Ga0395905_0116047 3300037471 Bacteria 2516
165 Ga0395905_0220482 3300037471 Bacteria 1775
166 Ga0436364_0732143 3300037853 Bacteria 2645
167 Ga0395901_0020189 3300038443 Bacteria 6819
168 Ga0395901_0027543 3300038443 Bacteria 5840
169 Ga0395901_0798699 3300038443 Bacteria 933
170 Ga0436360_0345154 3300039438 Bacteria 809
171 Ga0436360_1193358 3300039438 Bacteria 1288
172 Ga0436361_0425952 3300039447 Bacteria 2194
173 Ga0436362_0560986 3300039453 Bacteria 1259
174 Ga0466960_0311839 3300044901 Bacteria 889
175 Ga0495582_0088932 3300046473 Bacteria 1721
176 Ga0495586_0013153 3300046535 Bacteria 4386
177 Ga0501031_0077341 3300049568 Bacteria 2167
178 Ga0501031_0314807 3300049568 Bacteria 1014
179 Ga0501032_0027470 3300049569 Bacteria 3910
180 Ga0501033_0004470 3300049570 Bacteria 11185
181 Ga0501034_0003072 3300049571 Bacteria 19259
182 Ga0501034_0011201 3300049571 Bacteria 9310
183 Ga0501034_0098950 3300049571 Bacteria 2912
184 Ga0501034_0148941 3300049571 Bacteria 2316
185 Ga0501034_0184159 3300049571 Bacteria 2052
186 Ga0501036_0001047 3300049572 Bacteria 20902
187 Ga0501037_0003914 3300049573 Bacteria 10804
188 Ga0501037_0013828 3300049573 Bacteria 5947
189 Ga0501037_0261173 3300049573 Bacteria 1210
190 Ga0501038_0001324 3300049574 Bacteria 22533
191 Ga0501038_0020386 3300049574 Bacteria 5960
192 Ga0501039_0030421 3300049575 Bacteria 4163
193 Ga0501043_0002442 3300049579 Bacteria 15737
194 Ga0501043_0011494 3300049579 Bacteria 6929
195 Ga0501043_0142467 3300049579 Bacteria 1877
196 Ga0501043_0437940 3300049579 Bacteria 984
197 Ga0501046_0018710 3300049580 Bacteria 5757
198 Ga0501046_0146568 3300049580 Bacteria 1782
199 Ga0501047_0003560 3300049581 Bacteria 14702
200 Ga0501047_0054199 3300049581 Bacteria 3878
201 Ga0501047_0110320 3300049581 Bacteria 2634
202 Ga0501047_0563329 3300049581 Bacteria 963
203 Ga0501068_0016902 3300049584 Bacteria 4212
204 Ga0501069_0008219 3300049585 Bacteria 5478
205 Ga0501070_0004498 3300049586 Bacteria 11967
206 Ga0501071_0220927 3300049587 Bacteria 1426
207 Ga0501072_0006076 3300049588 Bacteria 9219
208 Ga0501072_0043062 3300049588 Bacteria 3548
209 Ga0501072_0206574 3300049588 Bacteria 1566
210 Ga0501073_0002214 3300049589 Bacteria 14529
211 Ga0501074_0017484 3300049590 Bacteria 5205
212 Ga0501074_0074540 3300049590 Bacteria 2437
213 Ga0501074_0487176 3300049590 Bacteria 874
214 Ga0501075_0044017 3300049591 Bacteria 3349
215 Ga0501076_0022546 3300049592 Bacteria 4840
216 Ga0501076_0507873 3300049592 Bacteria 994
217 Ga0501257_007303 3300049686 Bacteria 2468
218 Ga0501080_0008952 3300049742 Bacteria 9103
219 Ga0501080_0072808 3300049742 Bacteria 3197
220 Ga0501080_0085158 3300049742 Bacteria 2937
221 Ga0501083_0003331 3300049744 Bacteria 11235
222 Ga0501083_0014561 3300049744 Bacteria 5497
223 Ga0501035_0013222 3300049822 Bacteria 7617
224 Ga0501035_0108241 3300049822 Bacteria 2437
225 Ga0501035_0191568 3300049822 Bacteria 1758
226 Ga0501035_0320920 3300049822 Bacteria 1301
227 Ga0501035_0666172 3300049822 Bacteria 842
228 Ga0501044_0000572 3300049823 Bacteria 44721
229 Ga0501044_0007151 3300049823 Bacteria 12277
230 Ga0501044_0076540 3300049823 Bacteria 3395
231 Ga0501044_0559053 3300049823 Bacteria 1041
232 Ga0501045_0093389 3300049824 Bacteria 2225
233 Ga0501045_0159850 3300049824 Bacteria 1677
234 Ga0500595_006437 3300053119 Bacteria 4983
235 Ga0500637_0008971 3300053178 Bacteria 5070
236 Ga0500645_028400 3300053730 Bacteria 1693
237 Ga0501084_0045343 3300054114 Bacteria 3681
238 Ga0501084_0102038 3300054114 Bacteria 2409
239 Ga0501082_0018787 3300060353 Bacteria 5955
240 Ga0501082_0034649 3300060353 Bacteria 4351
241 2857353981 2857349434 Bacteria 7926032
242 2876384983 2876377896 Bacteria 6565995
243 2904481907 2904479285 Bacteria 5073931
244 2929203842 2929199973 Bacteria 7260745
245 2938019801 2938014810 Bacteria 6700592
246 2987642607 2987636660 Bacteria 8088555
247 8055912860 8055909800 Bacteria 7278581
248 Ga0395899_0064026
249 JGI24735J21928_10000290
250 JGI24742J22300_10024062
251 Ga0058862_12690635
252 Ga0065715_10359880
253 Ga0070658_10002487
254 Ga0070658_10486892
255 Ga0070683_100161064
256 Ga0070680_100027078
257 Ga0070680_100718303
258 Ga0070660_100001648
259 Ga0070660_100016179
260 Ga0070691_10033815
261 Ga0070661_100000551
262 Ga0070661_100220039
263 Ga0070661_100344435
264 Ga0070668_100000306
265 Ga0070669_100538323
266 Ga0070659_100274339
267 Ga0070659_100281320
268 Ga0070694_100005777
269 Ga0070663_100762543
270 Ga0070662_100000429
271 Ga0070662_100159799
272 Ga0070681_10015007
273 Ga0070681_10017096
274 Ga0070681_10142850
275 Ga0070681_10615062
276 Ga0070681_10696500
277 Ga0070706_100409870
278 Ga0070707_100097675
279 Ga0070698_100062681
280 Ga0070679_100000431
281 Ga0070679_100038254
282 Ga0070679_100065385
283 Ga0070684_100316546
284 Ga0068853_100127199
285 Ga0068853_100384640
286 Ga0068853_100647064
287 Ga0070695_100216945
288 Ga0068855_100004067
289 Ga0068855_100045279
290 Ga0068855_100062027
291 Ga0068855_100619864
292 Ga0070664_100043422
293 Ga0070664_100276950
294 Ga0068857_100063498
295 Ga0068854_100116208
296 Ga0068856_100066232
297 Ga0068856_100176911
298 Ga0068852_100036195
299 Ga0068852_100083973
300 Ga0068852_100133573
301 Ga0068852_100263348
302 Ga0068862_100000858
303 Ga0081455_10033748
304 Ga0097621_100635652
305 Ga0075370_10000001
306 Ga0105240_10178704
307 Ga0105240_10528201
308 Ga0105240_11192566
309 Ga0114129_10016500
310 Ga0105241_10252592
311 Ga0105241_10605078
312 Ga0105237_10275900
313 Ga0105237_10397078
314 Ga0105238_10318953
315 Ga0105238_10411570
316 Ga0105239_10076355
317 Ga0157373_10039229
318 Ga0157373_10349993
319 Ga0157371_10078027
320 Ga0157371_10194587
321 Ga0157370_10155176
322 Ga0157378_10384687
323 Ga0157372_10065890
324 Ga0157372_10104857
325 Ga0206351_10859604
326 Ga0206350_11026449
327 Ga0213872_10036316
328 Ga0213875_10111692
329 Ga0213871_10008655
330 Ga0224712_10289993
331 Ga0207647_10075961
332 Ga0207647_10148099
333 Ga0207705_10517789
334 Ga0207684_10000077
335 Ga0207654_10154663
336 Ga0207707_10021467
337 Ga0207707_10028056
338 Ga0207707_10355695
339 Ga0207695_10042022
340 Ga0207695_10188809
341 Ga0207671_10026914
342 Ga0207660_10072798
343 Ga0207660_10234519
344 Ga0207657_10002606
345 Ga0207657_10025636
346 Ga0207657_10047286
347 Ga0207657_10124976
348 Ga0207649_10166598
349 Ga0207649_10600956
350 Ga0207652_10007674
351 Ga0207652_10029684
352 Ga0207652_10564140
353 Ga0207646_10108926
354 Ga0207694_10288237
355 Ga0207690_10004893
356 Ga0207690_10092879
357 Ga0207706_10004324
358 Ga0207706_10162186
359 Ga0207686_10250849
360 Ga0207686_10337641
361 Ga0207661_10054606
362 Ga0207661_10081552
363 Ga0207679_10008634
364 Ga0207679_10074411
365 Ga0207667_10003767
366 Ga0207667_10066522
367 Ga0207667_10095700
368 Ga0207667_10355227
369 Ga0207667_10552222
370 Ga0207667_10774435
371 Ga0207668_10001166
372 Ga0207640_10095747
373 Ga0207640_10292508
374 Ga0207658_10121169
375 Ga0207639_10002044
376 Ga0207639_10104153
377 Ga0207639_10328310
378 Ga0207639_10357083
379 Ga0207639_10733137
380 Ga0207678_10053526
381 Ga0207678_10352713
382 Ga0207702_10410709
383 Ga0207674_10076013
384 Ga0207698_10191584
385 Ga0268266_10010193
386 Ga0268265_10000827
387 Ga0268264_11364908
388 Ga0265337_1002607
389 Ga0265334_10005694
390 Ga0265338_10010311
391 Ga0265325_10053884
392 Ga0265331_10200515
393 Ga0265316_10448097
394 Ga0265314_10146514
395 Ga0307405_10263936
396 Ga0307413_10031214
397 Ga0307413_10187504
398 Ga0307410_10042139
399 Ga0307407_10007140
400 Ga0307409_100477826
401 Ga0307414_10004450
402 Ga0307414_10013826
403 Ga0307414_10496252
404 Ga0307411_10003912
405 Ga0307411_10371865
406 Ga0373941_0015726
407 Ga0395899_0068450
408 Ga0395899_0121695
409 Ga0395899_0581926
410 Ga0395900_0009578
411 Ga0395905_0116047
412 Ga0395905_0220482
413 Ga0436364_0732143
414 Ga0395901_0020189
415 Ga0395901_0027543
416 Ga0395901_0798699
417 Ga0436360_0345154
418 Ga0436360_1193358
419 Ga0436361_0425952
420 Ga0436362_0560986
421 Ga0466960_0311839
422 Ga0495582_0088932
423 Ga0495586_0013153
424 Ga0501031_0077341
425 Ga0501031_0314807
426 Ga0501032_0027470
427 Ga0501033_0004470
428 Ga0501034_0003072
429 Ga0501034_0011201
430 Ga0501034_0098950
431 Ga0501034_0148941
432 Ga0501034_0184159
433 Ga0501036_0001047
434 Ga0501037_0003914
435 Ga0501037_0013828
436 Ga0501037_0261173
437 Ga0501038_0001324
438 Ga0501038_0020386
439 Ga0501039_0030421
440 Ga0501043_0002442
441 Ga0501043_0011494
442 Ga0501043_0142467
443 Ga0501043_0437940
444 Ga0501046_0018710
445 Ga0501046_0146568
446 Ga0501047_0003560
447 Ga0501047_0054199
448 Ga0501047_0110320
449 Ga0501047_0563329
450 Ga0501068_0016902
451 Ga0501069_0008219
452 Ga0501070_0004498
453 Ga0501071_0220927
454 Ga0501072_0006076
455 Ga0501072_0043062
456 Ga0501072_0206574
457 Ga0501073_0002214
458 Ga0501074_0017484
459 Ga0501074_0074540
460 Ga0501074_0487176
461 Ga0501075_0044017
462 Ga0501076_0022546
463 Ga0501076_0507873
464 Ga0501257_007303
465 Ga0501080_0008952
466 Ga0501080_0072808
467 Ga0501080_0085158
468 Ga0501083_0003331
469 Ga0501083_0014561
470 Ga0501035_0013222
471 Ga0501035_0108241
472 Ga0501035_0191568
473 Ga0501035_0320920
474 Ga0501035_0666172
475 Ga0501044_0000572
476 Ga0501044_0007151
477 Ga0501044_0076540
478 Ga0501044_0559053
479 Ga0501045_0093389
480 Ga0501045_0159850
481 Ga0500595_006437
482 Ga0500637_0008971
483 Ga0500645_028400
484 Ga0501084_0045343
485 Ga0501084_0102038
486 Ga0501082_0018787
487 Ga0501082_0034649
488 2857353981
489 2876384983
490 2904481907
491 2929203842
492 2938019801
493 2987642607
494 8055912860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

42

182

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

202

241

0.94

PF08534

Redoxin

Redoxin

41

197

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9727 3 207
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9645 2 207
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9538 3 207
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9458 2 207
1prx-assembly1.cif.gz_B horf6 a novel human peroxidase enzyme 0.9438 3 207
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.975 146 207 3.30.1020.10
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9699 146 207 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9541 146 207 3.30.1020.10
3a2vB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9529 1 141 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9468 5 106 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2N3DL12-F1-model_v4 Peroxidase 0.9862 1 208 GO:0005829
GO:0045454
GO:0051920
AF-A0A3B0MZ76-F1-model_v4 Putative peroxiredoxin (EC 1.11.1.15) 0.9862 1 208 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9856 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-U7HQQ4-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9837 1 207 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1H2PQ68-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9832 1 207 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Map