F359022

General Info

Members Datasets Scaffolds Average Seq Length
247 216 495 216

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10759124|Ga0157380_107591241
Length 220
Sequence MTAFPRSPRLLKGGLVLIDPATAAVQRIIVLQYNPDTLSRTLQVQGVGESGDRSEALRLKGPPVETIKLEAEVDVTDQLELPQQGQNHLAVELGLHPQLAALETVVYPSSRQVEESNLLAKLGTLEIAPAEAPLTLFIWSATRVLPVRVTELSITEEAFDPALNPIRAKISLGLRVLNVNDLGFSHKGGDLFMTYFKQKEQLAARIAGGGFGALGIGDIS

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
138 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
139 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
142 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
182 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
183 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
184 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
187 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
188 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
196 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
201 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
215 2902582711 Micromonospora sp. AP08 Isolate Unclassified
216 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.55
Nodule 0
Rhizoplane 2.02
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 14.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10759124 3300014326 Bacteria 982
2 JGI24739J22299_10010045 3300001989 Bacteria 3519
3 JGI24735J21928_10006358 3300002067 Bacteria 3897
4 JGI24748J21848_1000002 3300002074 Bacteria 426946
5 JGI24034J26672_10000004 3300002239 Bacteria 426946
6 JGI25156J39149_1006164 3300002705 Bacteria 3319
7 JGI25162J39368_1000951 3300002737 Bacteria 18558
8 JGI25157J39369_1002677 3300002741 Bacteria 4156
9 JGI25164J39214_1000116 3300002772 Bacteria 76944
10 JGI25165J46597_1000382 3300003214 Bacteria 48091
11 rootH2_10080878 3300003320 Bacteria 4686
12 rootL2_10118078 3300003322 Bacteria 6116
13 rootH1_10071972 3300003316 Bacteria 1620
14 rootH1_10071972 3300003323 Bacteria 14797
15 Ga0055533_1001306 3300003756 Bacteria 6771
16 Ga0055527_1003742 3300003760 Bacteria 2196
17 Ga0055535_1000637 3300003761 Bacteria 27979
18 Ga0055535_1000853 3300003761 Bacteria 21692
19 Ga0055542_1001130 3300003762 Bacteria 15854
20 Ga0055529_1000366 3300003763 Bacteria 49046
21 Ga0065715_10100035 3300005293 Bacteria 3343
22 Ga0070670_100002333 3300005331 Bacteria 15632
23 Ga0070670_100313142 3300005331 Bacteria 1374
24 Ga0068869_101071644 3300005334 Unclassified 704
25 Ga0070689_100000789 3300005340 Bacteria 19452
26 Ga0070691_10381295 3300005341 Bacteria 790
27 Ga0070669_100095189 3300005353 Bacteria 2239
28 Ga0070671_100046913 3300005355 Bacteria 3593
29 Ga0070673_100421220 3300005364 Unclassified 1197
30 Ga0070703_10000004 3300005406 Bacteria 136572
31 Ga0070709_10149702 3300005434 Bacteria 1612
32 Ga0070708_100143899 3300005445 Bacteria 2213
33 Ga0070678_100084266 3300005456 Bacteria 2419
34 Ga0070662_100005929 3300005457 Bacteria 7839
35 Ga0070662_100115001 3300005457 Unclassified 2055
36 Ga0070681_10658487 3300005458 Bacteria 962
37 Ga0068867_100133603 3300005459 Bacteria 1931
38 Ga0070685_10000611 3300005466 Bacteria 19687
39 Ga0070706_100001593 3300005467 Bacteria 23652
40 Ga0070706_100177257 3300005467 Bacteria 1990
41 Ga0070707_100002110 3300005468 Bacteria 19055
42 Ga0070707_100664353 3300005468 Bacteria 1005
43 Ga0070698_100119176 3300005471 Bacteria 2600
44 Ga0070699_100944547 3300005518 Unclassified 790
45 Ga0070697_100000140 3300005536 Bacteria 58765
46 Ga0070697_100002233 3300005536 Bacteria 14855
47 Ga0070686_100000080 3300005544 Bacteria 70371
48 Ga0070695_100564831 3300005545 Bacteria 889
49 Ga0070693_100191099 3300005547 Unclassified 1324
50 Ga0070693_100266771 3300005547 Bacteria 1141
51 Ga0070665_100000365 3300005548 Bacteria 67635
52 Ga0070704_100473489 3300005549 Unclassified 1082
53 Ga0070664_100085380 3300005564 Bacteria 2726
54 Ga0068854_100072193 3300005578 Bacteria 2527
55 Ga0068852_100556239 3300005616 Bacteria 1148
56 Ga0068859_100000046 3300005617 Bacteria 142733
57 Ga0068859_101035405 3300005617 Unclassified 902
58 Ga0068864_100001094 3300005618 Bacteria 22718
59 Ga0068870_10280365 3300005840 Bacteria 1045
60 Ga0068858_100000249 3300005842 Bacteria 57714
61 Ga0068858_100001031 3300005842 Bacteria 28780
62 Ga0068858_100028754 3300005842 Bacteria 5162
63 Ga0070717_10000134 3300006028 Bacteria 54840
64 Ga0075368_10002748 3300006042 Bacteria 5810
65 Ga0075364_10005531 3300006051 Bacteria 7355
66 Ga0070716_100221972 3300006173 Bacteria 1270
67 Ga0075367_10005069 3300006178 Bacteria 6502
68 Ga0075366_10046611 3300006195 Bacteria 2569
69 Ga0097621_100001093 3300006237 Bacteria 18962
70 Ga0075370_10027088 3300006353 Bacteria 3179
71 Ga0068871_100023286 3300006358 Unclassified 4788
72 Ga0075428_100015781 3300006844 Bacteria 8366
73 Ga0075431_100458272 3300006847 Bacteria 1270
74 Ga0075433_10522423 3300006852 Unclassified 1044
75 Ga0075434_100022420 3300006871 Bacteria 6151
76 Ga0075436_100099140 3300006914 Unclassified 2028
77 Ga0097620_100000046 3300006931 Bacteria 142733
78 Ga0097620_101035417 3300006931 Unclassified 902
79 Ga0105245_10368727 3300009098 Bacteria 1427
80 Ga0105247_10000005 3300009101 Bacteria 426989
81 Ga0105247_10022238 3300009101 Bacteria 3818
82 Ga0105247_10313991 3300009101 Unclassified 1091
83 Ga0105247_10327873 3300009101 Bacteria 1070
84 Ga0105243_10000996 3300009148 Bacteria 26244
85 Ga0105243_10591212 3300009148 Bacteria 1067
86 Ga0105242_10011854 3300009176 Bacteria 6710
87 Ga0105248_10629746 3300009177 Bacteria 1210
88 Ga0105238_11307410 3300009551 Bacteria 751
89 Ga0105249_10156227 3300009553 Bacteria 2200
90 Ga0157370_10014885 3300013104 Bacteria 7936
91 Ga0157369_10281485 3300013105 Bacteria 1732
92 Ga0157374_10386151 3300013296 Bacteria 1395
93 Ga0157378_10000015 3300013297 Bacteria 143601
94 Ga0163162_10013307 3300013306 Bacteria 8036
95 Ga0157375_10000092 3300013308 Bacteria 90157
96 Ga0157375_10006043 3300013308 Bacteria 10558
97 Ga0163163_10227088 3300014325 Bacteria 1916
98 Ga0157380_10855908 3300014326 Bacteria 931
99 Ga0183368_1004 3300015687 Bacteria 1211761
100 Ga0163161_10072645 3300017792 Bacteria 2519
101 Ga0207672_1000316 3300025223 Bacteria 6483
102 Ga0209674_100016 3300025226 Bacteria 696756
103 Ga0209672_100129 3300025228 Bacteria 76300
104 Ga0207427_100062 3300025231 Bacteria 178598
105 Ga0209437_100426 3300025233 Bacteria 37186
106 Ga0209258_100088 3300025242 Bacteria 237738
107 Ga0209646_1004332 3300025246 Bacteria 2602
108 Ga0209026_1002744 3300025250 Bacteria 6299
109 Ga0209148_1000024 3300025254 Bacteria 669890
110 Ga0209759_1001219 3300025256 Bacteria 15749
111 Ga0209233_1000023 3300025261 Bacteria 738870
112 Ga0209455_1000025 3300025272 Bacteria 670673
113 Ga0207710_10000004 3300025900 Bacteria 846540
114 Ga0207710_10009833 3300025900 Bacteria 4020
115 Ga0207643_10069041 3300025908 Unclassified 2031
116 Ga0207684_10001536 3300025910 Bacteria 24717
117 Ga0207684_10011559 3300025910 Bacteria 7714
118 Ga0207654_10353511 3300025911 Unclassified 1012
119 Ga0207707_10509402 3300025912 Bacteria 1026
120 Ga0207646_10003167 3300025922 Bacteria 18830
121 Ga0207650_10022197 3300025925 Bacteria 4493
122 Ga0207644_10002425 3300025931 Bacteria 12009
123 Ga0207706_10012101 3300025933 Bacteria 7858
124 Ga0207686_10010095 3300025934 Bacteria 5135
125 Ga0207709_10001187 3300025935 Bacteria 18824
126 Ga0207709_10186039 3300025935 Bacteria 1471
127 Ga0207670_10000653 3300025936 Bacteria 18358
128 Ga0207704_10871421 3300025938 Bacteria 756
129 Ga0207665_10139999 3300025939 Bacteria 1724
130 Ga0207711_10389614 3300025941 Unclassified 1294
131 Ga0207689_10672432 3300025942 Bacteria 873
132 Ga0207679_10161939 3300025945 Bacteria 1833
133 Ga0207651_10115849 3300025960 Unclassified 2022
134 Ga0207703_10000034 3300026035 Bacteria 184136
135 Ga0207703_10000323 3300026035 Bacteria 52038
136 Ga0207703_10038289 3300026035 Unclassified 3826
137 Ga0207648_10164101 3300026089 Bacteria 1962
138 Ga0207676_10000541 3300026095 Bacteria 31495
139 Ga0207698_10449219 3300026142 Bacteria 1244
140 Ga0209813_10004189 3300027866 Bacteria 3428
141 Ga0268266_10017328 3300028379 Bacteria 6148
142 Ga0307513_10277622 3300031456 Unclassified 1455
143 Ga0307408_100006007 3300031548 Bacteria 8080
144 Ga0307408_100405279 3300031548 Bacteria 1172
145 Ga0307508_10000022 3300031616 Bacteria 180417
146 Ga0316578_10140744 3300031728 Bacteria 1453
147 Ga0316577_10401198 3300031733 Bacteria 779
148 Ga0307413_10009133 3300031824 Bacteria 4727
149 Ga0307410_10009883 3300031852 Bacteria 5377
150 Ga0307407_10057142 3300031903 Bacteria 2262
151 Ga0307407_10410454 3300031903 Bacteria 974
152 Ga0307412_10013714 3300031911 Bacteria 4761
153 Ga0307409_100162070 3300031995 Unclassified 1957
154 Ga0307416_100016556 3300032002 Bacteria 5129
155 Ga0307414_10006929 3300032004 Bacteria 6349
156 Ga0307411_10012168 3300032005 Bacteria 4680
157 Ga0307415_100005575 3300032126 Bacteria 6699
158 Ga0316574_0298683 3300035398 Bacteria 1024
159 Ga0373924_0055959 3300035410 Bacteria 1642
160 Ga0373935_0101690 3300035692 Bacteria 1896
161 Ga0373937_0000967 3300036401 Bacteria 24372
162 Ga0400484_19089 3300038725 Bacteria 2022
163 Ga0400490_09010 3300038726 Bacteria 1103
164 Ga0400490_44035 3300038726 Bacteria 9020
165 Ga0400488_55484 3300038741 Bacteria 4750
166 Ga0400483_118306 3300039062 Bacteria 6787
167 Ga0450896_015407 3300042133 Bacteria 1095
168 Ga0450903_005142 3300042138 Bacteria 2198
169 Ga0439435_0001633 3300042436 Bacteria 4216
170 Ga0453683_0559209 3300044673 Unclassified 745
171 Ga0453684_0114551 3300044712 Bacteria 3268
172 Ga0495603_0061807 3300046455 Bacteria 2211
173 Ga0495638_0156886 3300046460 Bacteria 1316
174 Ga0495639_0008205 3300046475 Bacteria 4486
175 Ga0495607_0001591 3300046501 Bacteria 19757
176 Ga0495632_0201167 3300046519 Bacteria 907
177 Ga0495643_0000034 3300046522 Bacteria 238524
178 Ga0495654_0111139 3300046530 Bacteria 1250
179 Ga0495609_0000873 3300046538 Bacteria 22111
180 Ga0495597_0057817 3300046542 Bacteria 1696
181 Ga0495656_0001288 3300046615 Bacteria 8155
182 Ga0495625_0010658 3300046660 Bacteria 7576
183 Ga0495669_0015151 3300046684 Bacteria 3299
184 Ga0495613_0520111 3300046689 Bacteria 799
185 Ga0495670_0000120 3300046691 Bacteria 34491
186 Ga0495671_0031474 3300046692 Bacteria 2712
187 Ga0495672_0001117 3300047320 Bacteria 27196
188 Ga0495683_0002718 3300047323 Bacteria 10548
189 Ga0495687_000310 3300047443 Bacteria 63709
190 Ga0495677_0015647 3300047445 Bacteria 2755
191 Ga0495684_0547560 3300047471 Bacteria 788
192 Ga0495593_0204851 3300047673 Bacteria 991
193 Ga0496106_0004180 3300048909 Bacteria 10759
194 Ga0496112_0000122 3300048915 Bacteria 48608
195 Ga0496112_0124847 3300048915 Unclassified 2545
196 Ga0496113_0055601 3300048916 Bacteria 2967
197 Ga0496115_0000462 3300048918 Bacteria 32479
198 Ga0496123_0103479 3300048926 Bacteria 1649
199 Ga0496125_0023215 3300048928 Bacteria 5732
200 Ga0495682_0075657 3300049460 Unclassified 1211
201 Ga0501040_0003471 3300049576 Bacteria 10167
202 Ga0501040_0047175 3300049576 Bacteria 2942
203 Ga0501042_0078357 3300049578 Bacteria 2367
204 Ga0501043_0288023 3300049579 Bacteria 1258
205 Ga0501048_0453890 3300049582 Bacteria 918
206 Ga0501072_0048754 3300049588 Bacteria 3334
207 Ga0501075_0220671 3300049591 Bacteria 1446
208 Ga0501076_0061860 3300049592 Bacteria 2980
209 Ga0501076_0141490 3300049592 Bacteria 1955
210 Ga0501202_000507 3300049652 Bacteria 5592
211 Ga0501206_018517 3300049653 Unclassified 981
212 Ga0501207_005780 3300049654 Unclassified 1720
213 Ga0501216_006253 3300049660 Unclassified 1821
214 Ga0501217_002038 3300049661 Bacteria 3908
215 Ga0501223_001594 3300049663 Bacteria 5221
216 Ga0501224_001015 3300049664 Bacteria 3639
217 Ga0501230_011328 3300049667 Unclassified 1410
218 Ga0501233_002874 3300049668 Unclassified 3066
219 Ga0501235_001666 3300049669 Bacteria 4762
220 Ga0501239_003369 3300049672 Unclassified 1516
221 Ga0501249_024050 3300049679 Unclassified 1341
222 Ga0501252_012463 3300049682 Unclassified 1030
223 Ga0501225_0006209 3300049705 Bacteria 3490
224 Ga0501229_001775 3300049706 Unclassified 2528
225 Ga0501234_001766 3300049707 Bacteria 3405
226 Ga0501079_0172388 3300049741 Bacteria 1687
227 Ga0501079_0368422 3300049741 Bacteria 1126
228 Ga0501080_0694381 3300049742 Bacteria 898
229 Ga0501081_0233773 3300049743 Bacteria 1339
230 Ga0501081_0287473 3300049743 Bacteria 1205
231 Ga0501212_009677 3300049851 Unclassified 1362
232 Ga0501226_000762 3300049853 Unclassified 4351
233 nmdc:mga03683_21930_c1 3300050489 Bacteria 2469
234 nmdc:mga00v17_64068_c1 3300050491 Unclassified 2265
235 nmdc:mga0k408_141571_c1 3300050493 Unclassified 1431
236 nmdc:mga06z11_26876_c1 3300050494 Bacteria 2745
237 nmdc:mga04h51_18523_c1 3300050495 Unclassified 2052
238 nmdc:mga07m45_29475_c1 3300050496 Bacteria 3035
239 nmdc:mga06r32_438611_c1 3300050510 Bacteria 1286
240 nmdc:mga0n895_19806_c1 3300050512 Bacteria 6260
241 Ga0500555_001478 3300053103 Bacteria 7142
242 Ga0500645_002141 3300053730 Bacteria 9066
243 Ga0501084_0024720 3300054114 Bacteria 5013
244 Ga0501084_0284593 3300054114 Bacteria 1396
245 Ga0530510_0012473 3300061734 Bacteria 5970
246 2552107563 2551306166 Bacteria 9731570
247 2902585185 2902582711 Bacteria 6187705
248 8006927023 8006926726 Bacteria 6749210
249 Ga0157380_10759124
250 JGI24739J22299_10010045
251 JGI24735J21928_10006358
252 JGI24748J21848_1000002
253 JGI24034J26672_10000004
254 JGI25156J39149_1006164
255 JGI25162J39368_1000951
256 JGI25157J39369_1002677
257 JGI25164J39214_1000116
258 JGI25165J46597_1000382
259 rootH2_10080878
260 rootL2_10118078
261 rootH1_10071972
262 Ga0055533_1001306
263 Ga0055527_1003742
264 Ga0055535_1000637
265 Ga0055535_1000853
266 Ga0055542_1001130
267 Ga0055529_1000366
268 Ga0065715_10100035
269 Ga0070670_100002333
270 Ga0070670_100313142
271 Ga0068869_101071644
272 Ga0070689_100000789
273 Ga0070691_10381295
274 Ga0070669_100095189
275 Ga0070671_100046913
276 Ga0070673_100421220
277 Ga0070703_10000004
278 Ga0070709_10149702
279 Ga0070708_100143899
280 Ga0070678_100084266
281 Ga0070662_100005929
282 Ga0070662_100115001
283 Ga0070681_10658487
284 Ga0068867_100133603
285 Ga0070685_10000611
286 Ga0070706_100001593
287 Ga0070706_100177257
288 Ga0070707_100002110
289 Ga0070707_100664353
290 Ga0070698_100119176
291 Ga0070699_100944547
292 Ga0070697_100000140
293 Ga0070697_100002233
294 Ga0070686_100000080
295 Ga0070695_100564831
296 Ga0070693_100191099
297 Ga0070693_100266771
298 Ga0070665_100000365
299 Ga0070704_100473489
300 Ga0070664_100085380
301 Ga0068854_100072193
302 Ga0068852_100556239
303 Ga0068859_100000046
304 Ga0068859_101035405
305 Ga0068864_100001094
306 Ga0068870_10280365
307 Ga0068858_100000249
308 Ga0068858_100001031
309 Ga0068858_100028754
310 Ga0070717_10000134
311 Ga0075368_10002748
312 Ga0075364_10005531
313 Ga0070716_100221972
314 Ga0075367_10005069
315 Ga0075366_10046611
316 Ga0097621_100001093
317 Ga0075370_10027088
318 Ga0068871_100023286
319 Ga0075428_100015781
320 Ga0075431_100458272
321 Ga0075433_10522423
322 Ga0075434_100022420
323 Ga0075436_100099140
324 Ga0097620_100000046
325 Ga0097620_101035417
326 Ga0105245_10368727
327 Ga0105247_10000005
328 Ga0105247_10022238
329 Ga0105247_10313991
330 Ga0105247_10327873
331 Ga0105243_10000996
332 Ga0105243_10591212
333 Ga0105242_10011854
334 Ga0105248_10629746
335 Ga0105238_11307410
336 Ga0105249_10156227
337 Ga0157370_10014885
338 Ga0157369_10281485
339 Ga0157374_10386151
340 Ga0157378_10000015
341 Ga0163162_10013307
342 Ga0157375_10000092
343 Ga0157375_10006043
344 Ga0163163_10227088
345 Ga0157380_10855908
346 Ga0183368_1004
347 Ga0163161_10072645
348 Ga0207672_1000316
349 Ga0209674_100016
350 Ga0209672_100129
351 Ga0207427_100062
352 Ga0209437_100426
353 Ga0209258_100088
354 Ga0209646_1004332
355 Ga0209026_1002744
356 Ga0209148_1000024
357 Ga0209759_1001219
358 Ga0209233_1000023
359 Ga0209455_1000025
360 Ga0207710_10000004
361 Ga0207710_10009833
362 Ga0207643_10069041
363 Ga0207684_10001536
364 Ga0207684_10011559
365 Ga0207654_10353511
366 Ga0207707_10509402
367 Ga0207646_10003167
368 Ga0207650_10022197
369 Ga0207644_10002425
370 Ga0207706_10012101
371 Ga0207686_10010095
372 Ga0207709_10001187
373 Ga0207709_10186039
374 Ga0207670_10000653
375 Ga0207704_10871421
376 Ga0207665_10139999
377 Ga0207711_10389614
378 Ga0207689_10672432
379 Ga0207679_10161939
380 Ga0207651_10115849
381 Ga0207703_10000034
382 Ga0207703_10000323
383 Ga0207703_10038289
384 Ga0207648_10164101
385 Ga0207676_10000541
386 Ga0207698_10449219
387 Ga0209813_10004189
388 Ga0268266_10017328
389 Ga0307513_10277622
390 Ga0307408_100006007
391 Ga0307408_100405279
392 Ga0307508_10000022
393 Ga0316578_10140744
394 Ga0316577_10401198
395 Ga0307413_10009133
396 Ga0307410_10009883
397 Ga0307407_10057142
398 Ga0307407_10410454
399 Ga0307412_10013714
400 Ga0307409_100162070
401 Ga0307416_100016556
402 Ga0307414_10006929
403 Ga0307411_10012168
404 Ga0307415_100005575
405 Ga0316574_0298683
406 Ga0373924_0055959
407 Ga0373935_0101690
408 Ga0373937_0000967
409 Ga0400484_19089
410 Ga0400490_09010
411 Ga0400490_44035
412 Ga0400488_55484
413 Ga0400483_118306
414 Ga0450896_015407
415 Ga0450903_005142
416 Ga0439435_0001633
417 Ga0453683_0559209
418 Ga0453684_0114551
419 Ga0495603_0061807
420 Ga0495638_0156886
421 Ga0495639_0008205
422 Ga0495607_0001591
423 Ga0495632_0201167
424 Ga0495643_0000034
425 Ga0495654_0111139
426 Ga0495609_0000873
427 Ga0495597_0057817
428 Ga0495656_0001288
429 Ga0495625_0010658
430 Ga0495669_0015151
431 Ga0495613_0520111
432 Ga0495670_0000120
433 Ga0495671_0031474
434 Ga0495672_0001117
435 Ga0495683_0002718
436 Ga0495687_000310
437 Ga0495677_0015647
438 Ga0495684_0547560
439 Ga0495593_0204851
440 Ga0496106_0004180
441 Ga0496112_0000122
442 Ga0496112_0124847
443 Ga0496113_0055601
444 Ga0496115_0000462
445 Ga0496123_0103479
446 Ga0496125_0023215
447 Ga0495682_0075657
448 Ga0501040_0003471
449 Ga0501040_0047175
450 Ga0501042_0078357
451 Ga0501043_0288023
452 Ga0501048_0453890
453 Ga0501072_0048754
454 Ga0501075_0220671
455 Ga0501076_0061860
456 Ga0501076_0141490
457 Ga0501202_000507
458 Ga0501206_018517
459 Ga0501207_005780
460 Ga0501216_006253
461 Ga0501217_002038
462 Ga0501223_001594
463 Ga0501224_001015
464 Ga0501230_011328
465 Ga0501233_002874
466 Ga0501235_001666
467 Ga0501239_003369
468 Ga0501249_024050
469 Ga0501252_012463
470 Ga0501225_0006209
471 Ga0501229_001775
472 Ga0501234_001766
473 Ga0501079_0172388
474 Ga0501079_0368422
475 Ga0501080_0694381
476 Ga0501081_0233773
477 Ga0501081_0287473
478 Ga0501212_009677
479 Ga0501226_000762
480 nmdc:mga03683_21930_c1
481 nmdc:mga00v17_64068_c1
482 nmdc:mga0k408_141571_c1
483 nmdc:mga06z11_26876_c1
484 nmdc:mga04h51_18523_c1
485 nmdc:mga07m45_29475_c1
486 nmdc:mga06r32_438611_c1
487 nmdc:mga0n895_19806_c1
488 Ga0500555_001478
489 Ga0500645_002141
490 Ga0501084_0024720
491 Ga0501084_0284593
492 Ga0530510_0012473
493 2552107563
494 2902585185
495 8006927023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xvq-assembly2.cif.gz_B crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) 0.6922 145 175
6j0n-assembly1.cif.gz_b cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6893 12 175
7aeb-assembly1.cif.gz_N cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.6791 9 175
7nbm-assembly2.cif.gz_B co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (33) 0.6711 145 175
6rbk-assembly1.cif.gz_A cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised 0.6691 12 195
ID Description Score Start End Superfamily
af_I1JPT8_30_125_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7356 10 35 2.60.40.1120
5yjfD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6283 145 175 3.40.50.150
af_O44511_12_210_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6258 12 34 1.20.140.150
4f0pD01 Mainly Beta;Roll;PUA domain-like; 0.5787 144 176 2.30.280.20
af_P71805_5_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5752 145 175 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W7XGP1-F1-model_v4 Uncharacterized protein 0.9464 7 217
AF-A0A023XMJ8-F1-model_v4 deleted 0.9365 16 218
AF-A0A150RXT0-F1-model_v4 Uncharacterized protein 0.9348 68 203
AF-A0A7W7XGP1-F1-model_v4 Uncharacterized protein 0.9333 7 217
AF-A0A6N6ZBJ3-F1-model_v4 Uncharacterized protein 0.9304 1 218

Map