F358679

General Info

Members Datasets Scaffolds Average Seq Length
247 187 494 293

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10001298|JGI25404J52841_100012982
Length 347
Sequence VITVRQLCYLDALARHQHFGRAAQECAVSQPALSMQLRELEEILGVELIERRPGAPTLTELGIEIAQRAGVILGAVRDLTDLAQHRAKVLCGTLRLGVIPTLALDEEHPDVCLELLEAQTKVLVAELGRGALDVLLLALPLKISEFETIHLFTDHFLLIVPADDPLPETVRATPRDVEQRRLILLEEGHCLRDQALEYCSKMRTSMDSGLRATSLATVLQMVASGYGVTLLPEVAVDVELHDDRVKLLRFAEPQPSRSIGLAWRRTSPRKTDFQTLGRTVKSALNAGLPRGRRSLTWDAGARNDLTKPFAQSWQLASTPVRGCKKSIIAKATASGRKRSDRSPSDYN

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 2643221626 Ensifer sp. Root31 Isolate Unclassified
181 2643221659 Ensifer sp. Root127 Isolate Unclassified
182 2643221698 Ensifer sp. Root142 Isolate Unclassified
183 2844163670 Ensifer sp. 1H6 Isolate Unclassified
184 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
185 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
186 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
187 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.4
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 13.77
Nodule 0.4
Rhizoplane 4.86
Rhizosphere 73.68
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10001298 3300003659 Bacteria 4337
2 LJQas_1005355 3300000549 Bacteria 1633
3 JGI25153J46596_10011558 3300003215 Bacteria 3891
4 rootH2_10111823 3300003320 Bacteria 4362
5 rootH1_10191779 3300003323 Bacteria 3610
6 Ga0065714_10149713 3300005288 Bacteria 1114
7 Ga0065715_10042867 3300005293 Bacteria 1362
8 Ga0070658_10073382 3300005327 Bacteria 2806
9 Ga0070670_100064320 3300005331 Bacteria 3147
10 Ga0070670_100203827 3300005331 Bacteria 1719
11 Ga0070677_10015570 3300005333 Bacteria 2694
12 Ga0070680_100012930 3300005336 Bacteria 6492
13 Ga0070689_100143654 3300005340 Bacteria 1920
14 Ga0070669_100147213 3300005353 Bacteria 1820
15 Ga0070671_100107162 3300005355 Bacteria 2346
16 Ga0070674_100001825 3300005356 Bacteria 11556
17 Ga0070688_100076945 3300005365 Bacteria 2149
18 Ga0070667_100137373 3300005367 Bacteria 2138
19 Ga0070709_10001768 3300005434 Bacteria 11742
20 Ga0070714_100042822 3300005435 Bacteria 3826
21 Ga0070714_100458793 3300005435 Bacteria 1211
22 Ga0070713_100010115 3300005436 Bacteria 6804
23 Ga0070711_100003472 3300005439 Bacteria 9187
24 Ga0070711_100144791 3300005439 Bacteria 1786
25 Ga0070678_100002124 3300005456 Bacteria 10738
26 Ga0070681_10008969 3300005458 Bacteria 9833
27 Ga0070685_10041797 3300005466 Bacteria 2614
28 Ga0070698_100434443 3300005471 Bacteria 1248
29 Ga0070697_100084639 3300005536 Bacteria 2615
30 Ga0070672_100053895 3300005543 Bacteria 3146
31 Ga0070665_100086075 3300005548 Bacteria 3149
32 Ga0068859_100070396 3300005617 Bacteria 3533
33 Ga0068864_100097324 3300005618 Bacteria 2605
34 Ga0068861_100083832 3300005719 Bacteria 2501
35 Ga0081455_10000267 3300005937 Bacteria 68735
36 Ga0081455_10006734 3300005937 Bacteria 12269
37 Ga0081540_1000002 3300005983 Bacteria 251149
38 Ga0081540_1084043 3300005983 Bacteria 1422
39 Ga0070717_10126854 3300006028 Bacteria 2191
40 Ga0070717_10342800 3300006028 Bacteria 1335
41 Ga0075365_10081298 3300006038 Bacteria 2195
42 Ga0075368_10000461 3300006042 Bacteria 12013
43 Ga0075368_10008465 3300006042 Bacteria 3666
44 Ga0075368_10021751 3300006042 Bacteria 2437
45 Ga0075363_100024217 3300006048 Bacteria 3083
46 Ga0075363_100065340 3300006048 Bacteria 1967
47 Ga0075363_100194182 3300006048 Bacteria 1158
48 Ga0075364_10005833 3300006051 Bacteria 7188
49 Ga0075364_10023563 3300006051 Bacteria 3898
50 Ga0070715_10094501 3300006163 Bacteria 1382
51 Ga0070716_100068382 3300006173 Bacteria 2078
52 Ga0070712_100004337 3300006175 Bacteria 8740
53 Ga0070712_100019943 3300006175 Bacteria 4383
54 Ga0075367_10001936 3300006178 Bacteria 9191
55 Ga0075367_10028996 3300006178 Bacteria 3162
56 Ga0075367_10158337 3300006178 Bacteria 1408
57 Ga0075369_10048172 3300006186 Bacteria 1839
58 Ga0075366_10005179 3300006195 Bacteria 7056
59 Ga0075366_10144743 3300006195 Bacteria 1438
60 Ga0075370_10076581 3300006353 Bacteria 1919
61 Ga0075428_100018136 3300006844 Bacteria 7776
62 Ga0075430_100000671 3300006846 Bacteria 26160
63 Ga0075430_100095542 3300006846 Bacteria 2484
64 Ga0075431_100197225 3300006847 Bacteria 2061
65 Ga0075431_100221333 3300006847 Bacteria 1931
66 Ga0075434_100123552 3300006871 Bacteria 2605
67 Ga0075434_100348344 3300006871 Bacteria 1502
68 Ga0068865_100203940 3300006881 Bacteria 1537
69 Ga0075436_100269035 3300006914 Bacteria 1217
70 Ga0097620_100070399 3300006931 Bacteria 3533
71 Ga0075435_100117504 3300007076 Bacteria 2216
72 Ga0099794_10000407 3300007265 Bacteria 14455
73 Ga0099795_10000221 3300007788 Bacteria 9899
74 Ga0111539_10296780 3300009094 Bacteria 1881
75 Ga0111539_10520689 3300009094 Unclassified 1385
76 Ga0114129_10189580 3300009147 Bacteria 2793
77 Ga0105243_10224282 3300009148 Bacteria 1663
78 Ga0105241_10056173 3300009174 Bacteria 3018
79 Ga0105237_10111432 3300009545 Bacteria 2728
80 Ga0105249_10087455 3300009553 Bacteria 2908
81 Ga0099796_10000105 3300010159 Bacteria 13192
82 Ga0105246_10126283 3300011119 Bacteria 1903
83 Ga0157378_10155884 3300013297 Bacteria 2132
84 Ga0157375_10351606 3300013308 Bacteria 1639
85 Ga0163163_10154367 3300014325 Bacteria 2339
86 Ga0163163_10200735 3300014325 Bacteria 2042
87 Ga0157380_10071454 3300014326 Bacteria 2807
88 Ga0157376_10366687 3300014969 Bacteria 1383
89 Ga0163161_10003363 3300017792 Bacteria 11217
90 Ga0213873_10003978 3300021358 Bacteria 2714
91 Ga0213876_10002134 3300021384 Bacteria 11690
92 Ga0213875_10000120 3300021388 Bacteria 88115
93 Ga0209758_1000760 3300025297 Bacteria 46690
94 Ga0207682_10010036 3300025893 Bacteria 3718
95 Ga0207692_10040865 3300025898 Bacteria 2291
96 Ga0207710_10014639 3300025900 Bacteria 3311
97 Ga0207680_10113867 3300025903 Bacteria 1759
98 Ga0207647_10094555 3300025904 Bacteria 1780
99 Ga0207699_10034228 3300025906 Bacteria 2879
100 Ga0207699_10088263 3300025906 Bacteria 1940
101 Ga0207684_10205189 3300025910 Bacteria 1700
102 Ga0207693_10016974 3300025915 Bacteria 5815
103 Ga0207693_10020106 3300025915 Bacteria 5310
104 Ga0207663_10034403 3300025916 Bacteria 3029
105 Ga0207660_10036312 3300025917 Bacteria 3425
106 Ga0207652_10263076 3300025921 Bacteria 1556
107 Ga0207681_10251341 3300025923 Bacteria 1380
108 Ga0207650_10353497 3300025925 Bacteria 1209
109 Ga0207700_10066145 3300025928 Bacteria 2762
110 Ga0207700_10400041 3300025928 Bacteria 1203
111 Ga0207664_10031216 3300025929 Bacteria 4075
112 Ga0207664_10515914 3300025929 Bacteria 1071
113 Ga0207644_10133006 3300025931 Bacteria 1907
114 Ga0207706_10119694 3300025933 Bacteria 2315
115 Ga0207686_10208489 3300025934 Bacteria 1404
116 Ga0207669_10002829 3300025937 Bacteria 7436
117 Ga0207669_10322020 3300025937 Bacteria 1184
118 Ga0207665_10085707 3300025939 Bacteria 2175
119 Ga0207691_10028109 3300025940 Bacteria 5267
120 Ga0207679_10337361 3300025945 Bacteria 1310
121 Ga0207651_10136337 3300025960 Bacteria 1888
122 Ga0207668_10015245 3300025972 Bacteria 4771
123 Ga0207668_10203638 3300025972 Bacteria 1578
124 Ga0207658_10088731 3300025986 Bacteria 2392
125 Ga0207658_10217642 3300025986 Bacteria 1605
126 Ga0207703_10223061 3300026035 Bacteria 1686
127 Ga0207648_10007671 3300026089 Bacteria 10560
128 Ga0207676_10125548 3300026095 Bacteria 2172
129 Ga0207675_100041231 3300026118 Bacteria 4311
130 Ga0207683_10001552 3300026121 Bacteria 20662
131 Ga0209179_1001513 3300027512 Bacteria 2873
132 Ga0209588_1000297 3300027671 Bacteria 13055
133 Ga0209813_10000414 3300027866 Bacteria 10410
134 Ga0268266_10137954 3300028379 Bacteria 2186
135 Ga0268266_10224581 3300028379 Bacteria 1728
136 Ga0265760_10015791 3300031090 Bacteria 2166
137 Ga0265330_10035240 3300031235 Bacteria 2234
138 Ga0265325_10000061 3300031241 Bacteria 75502
139 Ga0265331_10076549 3300031250 Bacteria 1559
140 Ga0307415_100113443 3300032126 Bacteria 2016
141 Ga0395900_0023285 3300037418 Bacteria 6339
142 Ga0395898_0401750 3300037466 Bacteria 1306
143 Ga0436364_0369195 3300037853 Bacteria 68092
144 Ga0395901_0193471 3300038443 Bacteria 2133
145 Ga0395901_0229483 3300038443 Bacteria 1938
146 Ga0436365_0839943 3300039437 Bacteria 1192
147 Ga0436365_1283571 3300039437 Bacteria 25666
148 Ga0436360_0187474 3300039438 Bacteria 1992
149 Ga0436360_0597381 3300039438 Bacteria 3747
150 Ga0436363_0633925 3300039450 Bacteria 1116
151 Ga0436362_0602283 3300039453 Bacteria 7551
152 Ga0451576_0780124 3300045051 Bacteria 1004
153 Ga0495603_0163230 3300046455 Bacteria 1292
154 Ga0495672_0075728 3300047320 Bacteria 1892
155 Ga0495685_093773 3300047447 Bacteria 994
156 Ga0496102_0505213 3300048905 Bacteria 1131
157 Ga0496104_0002964 3300048907 Bacteria 14626
158 Ga0496105_0014657 3300048908 Bacteria 6242
159 Ga0496106_0146782 3300048909 Bacteria 1859
160 Ga0496107_0074722 3300048910 Bacteria 2466
161 Ga0496108_0001389 3300048911 Bacteria 19048
162 Ga0496109_0006843 3300048912 Bacteria 9616
163 Ga0496110_0003347 3300048913 Bacteria 12253
164 Ga0496111_0034737 3300048914 Bacteria 3601
165 Ga0496112_0035180 3300048915 Bacteria 4877
166 Ga0496112_0365633 3300048915 Bacteria 1384
167 Ga0496113_0010779 3300048916 Bacteria 6062
168 Ga0496121_0001541 3300048924 Bacteria 38568
169 Ga0496126_0028134 3300048929 Bacteria 5360
170 Ga0496126_0040392 3300048929 Bacteria 4325
171 Ga0501031_0120042 3300049568 Bacteria 1717
172 Ga0501032_0004311 3300049569 Bacteria 10743
173 Ga0501032_0043186 3300049569 Bacteria 3055
174 Ga0501033_0156733 3300049570 Bacteria 1640
175 Ga0501033_0167769 3300049570 Bacteria 1578
176 Ga0501033_0200785 3300049570 Bacteria 1424
177 Ga0501034_0023873 3300049571 Bacteria 6226
178 Ga0501034_0144408 3300049571 Bacteria 2357
179 Ga0501034_0215007 3300049571 Bacteria 1876
180 Ga0501034_0218246 3300049571 Bacteria 1860
181 Ga0501034_0292405 3300049571 Bacteria 1567
182 Ga0501036_0165473 3300049572 Bacteria 1864
183 Ga0501037_0287399 3300049573 Bacteria 1145
184 Ga0501038_0032402 3300049574 Bacteria 4611
185 Ga0501039_0141279 3300049575 Bacteria 1891
186 Ga0501043_0065759 3300049579 Bacteria 2847
187 Ga0501043_0150780 3300049579 Bacteria 1819
188 Ga0501043_0370818 3300049579 Bacteria 1085
189 Ga0501046_0024950 3300049580 Bacteria 4898
190 Ga0501046_0248269 3300049580 Bacteria 1311
191 Ga0501047_0225232 3300049581 Bacteria 1730
192 Ga0501048_0002764 3300049582 Bacteria 13390
193 Ga0501067_0087334 3300049583 Bacteria 1730
194 Ga0501069_0002591 3300049585 Bacteria 9222
195 Ga0501070_0038947 3300049586 Bacteria 3966
196 Ga0501070_0178510 3300049586 Bacteria 1748
197 Ga0501070_0309977 3300049586 Bacteria 1285
198 Ga0501070_0389907 3300049586 Bacteria 1127
199 Ga0501071_0017627 3300049587 Bacteria 4929
200 Ga0501071_0098963 3300049587 Bacteria 2149
201 Ga0501073_0237581 3300049589 Bacteria 1258
202 Ga0501074_0014464 3300049590 Bacteria 5741
203 Ga0501076_0037628 3300049592 Bacteria 3796
204 Ga0501079_0069026 3300049741 Bacteria 2728
205 Ga0501080_0240299 3300049742 Bacteria 1653
206 Ga0501083_0091208 3300049744 Bacteria 2012
207 Ga0501035_0150722 3300049822 Bacteria 2018
208 Ga0501044_0001932 3300049823 Bacteria 23992
209 Ga0501044_0015931 3300049823 Bacteria 8089
210 Ga0501044_0077877 3300049823 Bacteria 3361
211 Ga0501044_0224947 3300049823 Bacteria 1826
212 Ga0501044_0263321 3300049823 Bacteria 1662
213 Ga0501044_0406609 3300049823 Bacteria 1273
214 nmdc:mga03683_103151_c1 3300050489 Bacteria 1255
215 nmdc:mga00v17_142977_c1 3300050491 Bacteria 1535
216 nmdc:mga00v17_214_c1 3300050491 Bacteria 34878
217 nmdc:mga00v17_248469_c1 3300050491 Bacteria 1153
218 nmdc:mga00v17_49_c1 3300050491 Bacteria 74057
219 nmdc:mga0yw44_37995_c1 3300050492 Bacteria 2846
220 nmdc:mga0k408_181481_c1 3300050493 Bacteria 1255
221 nmdc:mga0k408_72353_c2 3300050493 Bacteria 1050
222 nmdc:mga06z11_48690_c1 3300050494 Bacteria 2159
223 nmdc:mga06z11_735_c1 3300050494 Bacteria 11975
224 nmdc:mga06z11_81412_c1 3300050494 Bacteria 1738
225 nmdc:mga04h51_827_c1 3300050495 Bacteria 7172
226 nmdc:mga07m45_76821_c1 3300050496 Bacteria 1904
227 nmdc:mga05p37_193597_c1 3300050507 Bacteria 2467
228 nmdc:mga09592_375789_c1 3300050508 Bacteria 1229
229 nmdc:mga0qj67_18_c1 3300050509 Bacteria 120268
230 nmdc:mga0qj67_25556_c1 3300050509 Bacteria 4564
231 nmdc:mga06r32_110151_c1 3300050510 Bacteria 2708
232 nmdc:mga06r32_237190_c1 3300050510 Bacteria 1811
233 nmdc:mga08y16_339521_c1 3300050511 Bacteria 1544
234 nmdc:mga0n895_136126_c1 3300050512 Bacteria 2483
235 nmdc:mga0rr50_305308_c1 3300050513 Bacteria 1332
236 nmdc:mga08x19_218886_c1 3300050514 Bacteria 1308
237 Ga0500595_037684 3300053119 Bacteria 1576
238 Ga0500568_0029839 3300053139 Bacteria 2260
239 Ga0501084_0508199 3300054114 Bacteria 1019
240 2644146760 2643221626 Bacteria 8069654
241 2644334335 2643221659 Bacteria 7890716
242 2644545453 2643221698 Bacteria 7756764
243 2844166029 2844163670 Bacteria 7266046
244 2874609335 2874604998 Bacteria 7834745
245 2889038577 2889033259 Bacteria 9099371
246 2990269262 2990265787 Bacteria 3943888
247 2993697395 2993693658 Bacteria 4040749
248 JGI25404J52841_10001298
249 LJQas_1005355
250 JGI25153J46596_10011558
251 rootH2_10111823
252 rootH1_10191779
253 Ga0065714_10149713
254 Ga0065715_10042867
255 Ga0070658_10073382
256 Ga0070670_100064320
257 Ga0070670_100203827
258 Ga0070677_10015570
259 Ga0070680_100012930
260 Ga0070689_100143654
261 Ga0070669_100147213
262 Ga0070671_100107162
263 Ga0070674_100001825
264 Ga0070688_100076945
265 Ga0070667_100137373
266 Ga0070709_10001768
267 Ga0070714_100042822
268 Ga0070714_100458793
269 Ga0070713_100010115
270 Ga0070711_100003472
271 Ga0070711_100144791
272 Ga0070678_100002124
273 Ga0070681_10008969
274 Ga0070685_10041797
275 Ga0070698_100434443
276 Ga0070697_100084639
277 Ga0070672_100053895
278 Ga0070665_100086075
279 Ga0068859_100070396
280 Ga0068864_100097324
281 Ga0068861_100083832
282 Ga0081455_10000267
283 Ga0081455_10006734
284 Ga0081540_1000002
285 Ga0081540_1084043
286 Ga0070717_10126854
287 Ga0070717_10342800
288 Ga0075365_10081298
289 Ga0075368_10000461
290 Ga0075368_10008465
291 Ga0075368_10021751
292 Ga0075363_100024217
293 Ga0075363_100065340
294 Ga0075363_100194182
295 Ga0075364_10005833
296 Ga0075364_10023563
297 Ga0070715_10094501
298 Ga0070716_100068382
299 Ga0070712_100004337
300 Ga0070712_100019943
301 Ga0075367_10001936
302 Ga0075367_10028996
303 Ga0075367_10158337
304 Ga0075369_10048172
305 Ga0075366_10005179
306 Ga0075366_10144743
307 Ga0075370_10076581
308 Ga0075428_100018136
309 Ga0075430_100000671
310 Ga0075430_100095542
311 Ga0075431_100197225
312 Ga0075431_100221333
313 Ga0075434_100123552
314 Ga0075434_100348344
315 Ga0068865_100203940
316 Ga0075436_100269035
317 Ga0097620_100070399
318 Ga0075435_100117504
319 Ga0099794_10000407
320 Ga0099795_10000221
321 Ga0111539_10296780
322 Ga0111539_10520689
323 Ga0114129_10189580
324 Ga0105243_10224282
325 Ga0105241_10056173
326 Ga0105237_10111432
327 Ga0105249_10087455
328 Ga0099796_10000105
329 Ga0105246_10126283
330 Ga0157378_10155884
331 Ga0157375_10351606
332 Ga0163163_10154367
333 Ga0163163_10200735
334 Ga0157380_10071454
335 Ga0157376_10366687
336 Ga0163161_10003363
337 Ga0213873_10003978
338 Ga0213876_10002134
339 Ga0213875_10000120
340 Ga0209758_1000760
341 Ga0207682_10010036
342 Ga0207692_10040865
343 Ga0207710_10014639
344 Ga0207680_10113867
345 Ga0207647_10094555
346 Ga0207699_10034228
347 Ga0207699_10088263
348 Ga0207684_10205189
349 Ga0207693_10016974
350 Ga0207693_10020106
351 Ga0207663_10034403
352 Ga0207660_10036312
353 Ga0207652_10263076
354 Ga0207681_10251341
355 Ga0207650_10353497
356 Ga0207700_10066145
357 Ga0207700_10400041
358 Ga0207664_10031216
359 Ga0207664_10515914
360 Ga0207644_10133006
361 Ga0207706_10119694
362 Ga0207686_10208489
363 Ga0207669_10002829
364 Ga0207669_10322020
365 Ga0207665_10085707
366 Ga0207691_10028109
367 Ga0207679_10337361
368 Ga0207651_10136337
369 Ga0207668_10015245
370 Ga0207668_10203638
371 Ga0207658_10088731
372 Ga0207658_10217642
373 Ga0207703_10223061
374 Ga0207648_10007671
375 Ga0207676_10125548
376 Ga0207675_100041231
377 Ga0207683_10001552
378 Ga0209179_1001513
379 Ga0209588_1000297
380 Ga0209813_10000414
381 Ga0268266_10137954
382 Ga0268266_10224581
383 Ga0265760_10015791
384 Ga0265330_10035240
385 Ga0265325_10000061
386 Ga0265331_10076549
387 Ga0307415_100113443
388 Ga0395900_0023285
389 Ga0395898_0401750
390 Ga0436364_0369195
391 Ga0395901_0193471
392 Ga0395901_0229483
393 Ga0436365_0839943
394 Ga0436365_1283571
395 Ga0436360_0187474
396 Ga0436360_0597381
397 Ga0436363_0633925
398 Ga0436362_0602283
399 Ga0451576_0780124
400 Ga0495603_0163230
401 Ga0495672_0075728
402 Ga0495685_093773
403 Ga0496102_0505213
404 Ga0496104_0002964
405 Ga0496105_0014657
406 Ga0496106_0146782
407 Ga0496107_0074722
408 Ga0496108_0001389
409 Ga0496109_0006843
410 Ga0496110_0003347
411 Ga0496111_0034737
412 Ga0496112_0035180
413 Ga0496112_0365633
414 Ga0496113_0010779
415 Ga0496121_0001541
416 Ga0496126_0028134
417 Ga0496126_0040392
418 Ga0501031_0120042
419 Ga0501032_0004311
420 Ga0501032_0043186
421 Ga0501033_0156733
422 Ga0501033_0167769
423 Ga0501033_0200785
424 Ga0501034_0023873
425 Ga0501034_0144408
426 Ga0501034_0215007
427 Ga0501034_0218246
428 Ga0501034_0292405
429 Ga0501036_0165473
430 Ga0501037_0287399
431 Ga0501038_0032402
432 Ga0501039_0141279
433 Ga0501043_0065759
434 Ga0501043_0150780
435 Ga0501043_0370818
436 Ga0501046_0024950
437 Ga0501046_0248269
438 Ga0501047_0225232
439 Ga0501048_0002764
440 Ga0501067_0087334
441 Ga0501069_0002591
442 Ga0501070_0038947
443 Ga0501070_0178510
444 Ga0501070_0309977
445 Ga0501070_0389907
446 Ga0501071_0017627
447 Ga0501071_0098963
448 Ga0501073_0237581
449 Ga0501074_0014464
450 Ga0501076_0037628
451 Ga0501079_0069026
452 Ga0501080_0240299
453 Ga0501083_0091208
454 Ga0501035_0150722
455 Ga0501044_0001932
456 Ga0501044_0015931
457 Ga0501044_0077877
458 Ga0501044_0224947
459 Ga0501044_0263321
460 Ga0501044_0406609
461 nmdc:mga03683_103151_c1
462 nmdc:mga00v17_142977_c1
463 nmdc:mga00v17_214_c1
464 nmdc:mga00v17_248469_c1
465 nmdc:mga00v17_49_c1
466 nmdc:mga0yw44_37995_c1
467 nmdc:mga0k408_181481_c1
468 nmdc:mga0k408_72353_c2
469 nmdc:mga06z11_48690_c1
470 nmdc:mga06z11_735_c1
471 nmdc:mga06z11_81412_c1
472 nmdc:mga04h51_827_c1
473 nmdc:mga07m45_76821_c1
474 nmdc:mga05p37_193597_c1
475 nmdc:mga09592_375789_c1
476 nmdc:mga0qj67_18_c1
477 nmdc:mga0qj67_25556_c1
478 nmdc:mga06r32_110151_c1
479 nmdc:mga06r32_237190_c1
480 nmdc:mga08y16_339521_c1
481 nmdc:mga0n895_136126_c1
482 nmdc:mga0rr50_305308_c1
483 nmdc:mga08x19_218886_c1
484 Ga0500595_037684
485 Ga0500568_0029839
486 Ga0501084_0508199
487 2644146760
488 2644334335
489 2644545453
490 2844166029
491 2874609335
492 2889038577
493 2990269262
494 2993697395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

4

63

0.95

PF03466

LysR_substrate

LysR substrate binding domain

87

285

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9516 2 84
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9468 2 84
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9407 2 86
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9378 2 86
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9361 2 85
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9776 3 83 1.10.10.10
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 3 79 1.10.10.10
af_Q47141_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9707 2 82 1.10.10.10
af_P0ACQ4_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9702 2 82 1.10.10.10
af_Q2FVT4_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9677 2 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G0G2B6-F1-model_v4 HTH lysR-type domain-containing protein 0.8979 2 282 GO:0003677
GO:0003700
GO:0032993
AF-F9S8J1-F1-model_v4 DNA-binding transcriptional regulator OxyR 0.8767 2 278 GO:0003677
GO:0003700
GO:0032993
AF-A0A1L3ZTP2-F1-model_v4 LysR family transcriptional regulator 0.8739 1 280 GO:0003677
GO:0003700
GO:0032993
AF-A0A1H3W0V3-F1-model_v4 Transcriptional regulator, LysR family 0.8731 1 279 GO:0003677
GO:0003700
GO:0032993
AF-A0A699Y7A1-F1-model_v4 deleted 0.8731 120 263

Map