F358676

General Info

Members Datasets Scaffolds Average Seq Length
247 177 201 317

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1000036|JGI25160J50197_100003667
Length 326
Sequence MDTTLLAFAVLGFVAVVLLIEGVYLYWNSHHGPVVKRMDARIRAMSAGGHVSGEQMSILKQRLLSESPTFTRMLMRMPRVHRLDLYLQQSGLTWSVGRFVGYTVALGFAGLVFGASAMHLPFAIALAVAGAAALLPIVYLRGKRAKRIVQLERQLPDAADLIARALRAGHSFPAALGMVGDELPNPLGGEFRIAFDEINYGVSMSDALMNLVSRVPVDDVRYFVIAVLIQREAGGNLAEILGNIAGIIRERLKLLGKVRVLSAEGRMSAWILGLLPFAVIAALSVLNPDYCKVFWEDPTGQKIAGIAMAMMFFGILWLRRTVRIRV

Samples

Sample ID Description Type Environment
1 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
6 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
7 2519103095 Burkholderia sp. KJ006 Isolate Nodule
8 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
9 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
10 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
14 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
15 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
16 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
17 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
18 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
19 2818991452 Burkholderia cepacia 561 Isolate Unclassified
20 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
21 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
22 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
23 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
24 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
25 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
26 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
27 2904564687 Burkholderia sp. 571 Isolate Unclassified
28 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
29 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
30 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
31 2928163908 Burkholderia sp. 567 Isolate Unclassified
32 2928170801 Burkholderia sp. 572 Isolate Unclassified
33 2928536128 Burkholderia sola 565 Isolate Unclassified
34 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
38 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
105 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
167 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
168 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
169 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
170 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
171 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
172 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
173 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
174 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
175 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
176 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
177 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.97
Metatranscriptomes 0.4
Isolates 18.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.19
Nodule 4.05
Rhizoplane 7.69
Rhizosphere 58.7
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10035215 3300003322 Bacteria 1966
2 JGI25160J50197_1000036 3300003354 Bacteria 166820
3 Ga0055532_1000168 3300003758 Bacteria 55564
4 Ga0055532_1000323 3300003758 Bacteria 27078
5 Ga0055532_1000587 3300003758 Bacteria 14873
6 Ga0055527_1000085 3300003760 Bacteria 73489
7 Ga0055527_1000478 3300003760 Bacteria 14822
8 Ga0055535_1000134 3300003761 Bacteria 78815
9 Ga0055535_1000154 3300003761 Bacteria 73489
10 Ga0055542_1000178 3300003762 Bacteria 78815
11 Ga0055542_1003138 3300003762 Bacteria 4702
12 Ga0055529_1000203 3300003763 Bacteria 78815
13 Ga0055526_1000086 3300003771 Bacteria 86198
14 Ga0055537_1000154 3300003773 Bacteria 51753
15 Ga0055524_1002219 3300003775 Bacteria 10184
16 Ga0055534_1000306 3300003784 Bacteria 32977
17 Ga0055528_1000134 3300003790 Bacteria 60071
18 Ga0058692_1008670 3300003856 Bacteria 2613
19 Ga0065165_1000686 3300005262 Bacteria 48410
20 Ga0070658_10004401 3300005327 Bacteria 11481
21 Ga0070658_10036736 3300005327 Bacteria 3948
22 Ga0070682_100012645 3300005337 Bacteria 4842
23 Ga0070660_100000763 3300005339 Bacteria 21361
24 Ga0070659_100000385 3300005366 Bacteria 33506
25 Ga0070663_100001273 3300005455 Bacteria 13816
26 Ga0068855_100004406 3300005563 Bacteria 17207
27 Ga0068855_100052093 3300005563 Bacteria 4819
28 Ga0068856_100196738 3300005614 Bacteria 2030
29 Ga0068852_100632960 3300005616 Bacteria 1076
30 Ga0105250_10032758 3300009092 Bacteria 2087
31 Ga0105240_10000553 3300009093 Bacteria 69247
32 Ga0105240_10016599 3300009093 Bacteria 9963
33 Ga0105240_10416312 3300009093 Bacteria 1511
34 Ga0105237_10106501 3300009545 Bacteria 2796
35 Ga0105238_10015695 3300009551 Bacteria 7668
36 Ga0105239_10010248 3300010375 Bacteria 10495
37 Ga0105239_10017183 3300010375 Bacteria 7997
38 Ga0157373_10299757 3300013100 Bacteria 1141
39 Ga0157371_10027569 3300013102 Bacteria 4119
40 Ga0157370_10001376 3300013104 Bacteria 30075
41 Ga0157370_10017484 3300013104 Bacteria 7235
42 Ga0157370_10079188 3300013104 Bacteria 3095
43 Ga0157370_10222637 3300013104 Bacteria 1747
44 Ga0157369_10000084 3300013105 Bacteria 130587
45 Ga0157369_10000093 3300013105 Bacteria 122566
46 Ga0182008_10049431 3300014497 Bacteria 2088
47 Ga0182007_10004501 3300015262 Bacteria 6298
48 Ga0182005_1006956 3300015265 Bacteria 3422
49 Ga0224712_10000398 3300022467 Bacteria 8522
50 Ga0209566_100750 3300025225 Bacteria 17807
51 Ga0209672_100040 3300025228 Bacteria 278858
52 Ga0209672_100044 3300025228 Bacteria 270292
53 Ga0209672_100622 3300025228 Bacteria 18394
54 Ga0209147_100039 3300025229 Bacteria 311101
55 Ga0209147_100048 3300025229 Bacteria 278858
56 Ga0209147_100076 3300025229 Bacteria 207570
57 Ga0209258_100062 3300025242 Bacteria 311101
58 Ga0209258_100070 3300025242 Bacteria 278858
59 Ga0209148_1000075 3300025254 Bacteria 311101
60 Ga0209148_1000311 3300025254 Bacteria 69457
61 Ga0209759_1000052 3300025256 Bacteria 213964
62 Ga0209759_1015187 3300025256 Bacteria 1997
63 Ga0209565_1000057 3300025263 Bacteria 196908
64 Ga0209565_1009578 3300025263 Bacteria 2450
65 Ga0209455_1000067 3300025272 Bacteria 311101
66 Ga0209455_1000463 3300025272 Bacteria 30690
67 Ga0209673_1000051 3300025273 Bacteria 282161
68 Ga0209673_1000865 3300025273 Bacteria 39305
69 Ga0209675_1000027 3300025291 Bacteria 282175
70 Ga0209564_1000094 3300025295 Bacteria 243176
71 Ga0209564_1006190 3300025295 Bacteria 6549
72 Ga0209564_1007924 3300025295 Bacteria 5357
73 Ga0209256_1000139 3300025299 Bacteria 155515
74 Ga0207426_1000014 3300025302 Bacteria 649413
75 Ga0207696_1020889 3300025711 Bacteria 2103
76 Ga0207705_10002902 3300025909 Bacteria 13109
77 Ga0207695_10112228 3300025913 Bacteria 2704
78 Ga0207695_10547698 3300025913 Bacteria 1038
79 Ga0207671_10038449 3300025914 Bacteria 3547
80 Ga0207690_10000016 3300025932 Bacteria 256657
81 Ga0207667_10006243 3300025949 Bacteria 14464
82 Ga0207667_10006583 3300025949 Bacteria 14049
83 Ga0207678_10001314 3300026067 Bacteria 22989
84 Ga0207702_10173787 3300026078 Bacteria 1978
85 Ga0207698_10007010 3300026142 Bacteria 7059
86 Ga0209371_1000211 3300027312 Bacteria 81758
87 Ga0265338_10000057 3300028800 Bacteria 200477
88 Ga0268256_1000878 3300030500 Bacteria 20843
89 Ga0316182_1030780 3300030745 Bacteria 1549
90 Ga0265332_10030362 3300031238 Bacteria 2361
91 Ga0395899_0000023 3300037312 Bacteria 367159
92 Ga0395899_0042367 3300037312 Bacteria 3399
93 Ga0395900_0000019 3300037418 Bacteria 357240
94 Ga0395900_0000182 3300037418 Bacteria 100777
95 Ga0395900_0080149 3300037418 Bacteria 3355
96 Ga0395898_0000016 3300037466 Bacteria 435585
97 Ga0395898_0001476 3300037466 Bacteria 32826
98 Ga0395898_0003387 3300037466 Bacteria 17858
99 Ga0395905_0000009 3300037471 Bacteria 488729
100 Ga0395905_0126593 3300037471 Bacteria 2402
101 Ga0395901_0000004 3300038443 Bacteria 657361
102 Ga0395901_0000040 3300038443 Bacteria 204677
103 Ga0395901_0092278 3300038443 Bacteria 3170
104 Ga0436361_0969076 3300039447 Bacteria 5894
105 Ga0466969_0000381 3300044656 Bacteria 24387
106 Ga0466969_0001760 3300044656 Bacteria 11555
107 Ga0466969_0017689 3300044656 Bacteria 3720
108 Ga0466973_0022236 3300044659 Bacteria 6071
109 Ga0466982_0070422 3300044672 Bacteria 2159
110 Ga0466965_0002766 3300044683 Bacteria 7536
111 Ga0466966_0000172 3300044684 Bacteria 42586
112 Ga0466966_0002166 3300044684 Bacteria 12748
113 Ga0466966_0011634 3300044684 Bacteria 5833
114 Ga0466966_0017648 3300044684 Bacteria 4713
115 Ga0466966_0032609 3300044684 Bacteria 3375
116 Ga0466961_0000169 3300044693 Bacteria 44408
117 Ga0466961_0000469 3300044693 Bacteria 25576
118 Ga0466961_0000848 3300044693 Bacteria 19115
119 Ga0466961_0032317 3300044693 Bacteria 3362
120 Ga0466961_0070111 3300044693 Bacteria 2225
121 Ga0466963_0013367 3300044694 Bacteria 5040
122 Ga0466971_0001259 3300044719 Bacteria 10549
123 Ga0466971_0155062 3300044719 Bacteria 1070
124 Ga0466970_0039723 3300044765 Bacteria 2498
125 Ga0466957_0012197 3300044842 Bacteria 4973
126 Ga0466957_0012414 3300044842 Bacteria 4930
127 Ga0466957_0017486 3300044842 Bacteria 4200
128 Ga0466960_0019994 3300044901 Bacteria 2959
129 Ga0466959_0004770 3300045049 Bacteria 9140
130 Ga0466959_0008179 3300045049 Bacteria 7381
131 Ga0466958_0012956 3300045836 Bacteria 4736
132 Ga0466958_0033796 3300045836 Bacteria 3048
133 Ga0466958_0285676 3300045836 Unclassified 1058
134 Ga0495603_0006823 3300046455 Bacteria 6848
135 Ga0495650_0013150 3300046471 Bacteria 4397
136 Ga0495580_0000484 3300046472 Bacteria 33248
137 Ga0495580_0003187 3300046472 Bacteria 14052
138 Ga0495580_0021614 3300046472 Bacteria 4744
139 Ga0495664_0036611 3300046477 Bacteria 2893
140 Ga0495583_0007781 3300046506 Bacteria 6661
141 Ga0495606_0033663 3300046507 Bacteria 3531
142 Ga0495616_0030333 3300046513 Bacteria 2843
143 Ga0495618_0142255 3300046514 Bacteria 1534
144 Ga0495620_0034902 3300046515 Bacteria 2268
145 Ga0495628_0181320 3300046516 Bacteria 1593
146 Ga0495628_0317625 3300046516 Bacteria 1150
147 Ga0495630_0006595 3300046517 Bacteria 8272
148 Ga0495648_0029432 3300046524 Bacteria 3645
149 Ga0495648_0045950 3300046524 Bacteria 2711
150 Ga0495665_0003025 3300046531 Bacteria 9086
151 Ga0495665_0063100 3300046531 Bacteria 1956
152 Ga0495611_0013855 3300046648 Bacteria 3439
153 Ga0495625_0019626 3300046660 Bacteria 5236
154 Ga0495599_0138089 3300046678 Bacteria 1512
155 Ga0495624_0002482 3300046690 Bacteria 13990
156 Ga0495671_0016686 3300046692 Bacteria 3917
157 Ga0495671_0033419 3300046692 Bacteria 2620
158 Ga0495674_0002565 3300047319 Bacteria 17706
159 Ga0495674_0002885 3300047319 Bacteria 16727
160 Ga0495674_0020389 3300047319 Bacteria 6138
161 Ga0495672_0085418 3300047320 Bacteria 1748
162 Ga0495683_0000823 3300047323 Bacteria 22092
163 Ga0495683_0010093 3300047323 Bacteria 5004
164 Ga0495679_000009 3300047446 Bacteria 343637
165 Ga0495673_0015956 3300047469 Bacteria 3853
166 Ga0495593_0043171 3300047673 Bacteria 2417
167 Ga0495602_0079275 3300048088 Bacteria 2770
168 Ga0495626_0013740 3300048091 Bacteria 4200
169 Ga0495626_0043381 3300048091 Bacteria 2110
170 Ga0496100_0000124 3300048903 Bacteria 43738
171 Ga0496100_0022586 3300048903 Bacteria 3807
172 Ga0496101_0000147 3300048904 Bacteria 60811
173 Ga0496101_0064036 3300048904 Bacteria 2678
174 Ga0496102_0000057 3300048905 Bacteria 171634
175 Ga0496103_0000142 3300048906 Bacteria 75004
176 Ga0496104_0064459 3300048907 Bacteria 3475
177 Ga0496104_0113741 3300048907 Bacteria 2595
178 Ga0496105_0016071 3300048908 Bacteria 5971
179 Ga0496105_0310403 3300048908 Bacteria 1266
180 Ga0496106_0189104 3300048909 Bacteria 1636
181 Ga0496107_0215653 3300048910 Bacteria 1427
182 Ga0496112_0327244 3300048915 Bacteria 1476
183 Ga0496113_0098392 3300048916 Bacteria 2264
184 Ga0496115_0103632 3300048918 Bacteria 2334
185 Ga0496116_0066161 3300048919 Bacteria 2314
186 Ga0496117_0000118 3300048920 Bacteria 173803
187 Ga0496118_0000068 3300048921 Bacteria 204242
188 Ga0496119_0031136 3300048922 Bacteria 3584
189 Ga0496121_0008238 3300048924 Bacteria 12341
190 Ga0496121_0014889 3300048924 Bacteria 8201
191 Ga0496121_0015113 3300048924 Bacteria 8122
192 Ga0496121_0137097 3300048924 Bacteria 1821
193 Ga0496122_0064267 3300048925 Bacteria 2671
194 Ga0496123_0064238 3300048926 Bacteria 2340
195 Ga0496124_0132145 3300048927 Bacteria 1982
196 Ga0496126_0074239 3300048929 Bacteria 3021
197 Ga0495678_011167 3300049459 Bacteria 4316
198 Ga0495682_0011669 3300049460 Bacteria 3378
199 Ga0495682_0074470 3300049460 Bacteria 1221
200 Ga0501249_017992 3300049679 Bacteria 1525
201 Ga0466962_0000561 3300061719 Bacteria 16334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0033663 Ga0495606_0033663_22_813 207
2 3300046516 Ga0495628_0317625 Ga0495628_0317625_281_1108 219
3 3300045836 Ga0466958_0285676 Ga0466958_0285676_169_1014 225
4 3300048916 Ga0496113_0098392 Ga0496113_0098392_1401_2249 226
5 3300003771 Ga0055526_1000086 Ga0055526_100008652 232
6 3300003773 Ga0055537_1000154 Ga0055537_10001543 232
7 3300003775 Ga0055524_1002219 Ga0055524_10022193 232
8 3300003784 Ga0055534_1000306 Ga0055534_100030632 232
9 3300003790 Ga0055528_1000134 Ga0055528_100013443 232
10 3300025263 Ga0209565_1000057 Ga0209565_1000057133 232
11 3300025273 Ga0209673_1000051 Ga0209673_1000051155 232
12 3300025291 Ga0209675_1000027 Ga0209675_1000027155 232
13 3300025295 Ga0209564_1000094 Ga0209564_1000094132 232
14 3300025299 Ga0209256_1000139 Ga0209256_1000139132 232
15 3300047323 Ga0495683_0010093 Ga0495683_0010093_14_880 232
16 3300005327 Ga0070658_10004401 Ga0070658_100044019 240
17 3300005563 Ga0068855_100004406 Ga0068855_10000440617 240
18 3300013104 Ga0157370_10001376 Ga0157370_1000137613 240
19 3300025909 Ga0207705_10002902 Ga0207705_100029029 240
20 3300025949 Ga0207667_10006583 Ga0207667_100065833 240
21 3300025913 Ga0207695_10112228 Ga0207695_101122283 243
22 3300015265 Ga0182005_1006956 Ga0182005_10069562 246
23 3300048907 Ga0496104_0113741 Ga0496104_0113741_35_1012 246
24 3300003758 Ga0055532_1000168 Ga0055532_100016826 249
25 3300003760 Ga0055527_1000085 Ga0055527_100008555 249
26 3300003761 Ga0055535_1000154 Ga0055535_100015455 249
27 3300003762 Ga0055542_1003138 Ga0055542_10031383 249
28 3300005327 Ga0070658_10036736 Ga0070658_100367363 249
29 3300025228 Ga0209672_100040 Ga0209672_100040180 249
30 3300025229 Ga0209147_100048 Ga0209147_100048180 249
31 3300025242 Ga0209258_100070 Ga0209258_100070180 249
32 3300025254 Ga0209148_1000311 Ga0209148_100031117 249
33 3300025256 Ga0209759_1015187 Ga0209759_10151872 249
34 3300025272 Ga0209455_1000463 Ga0209455_100046324 249
35 3300005616 Ga0068852_100632960 Ga0068852_1006329601 250
36 3300026142 Ga0207698_10007010 Ga0207698_100070103 250
37 3300005339 Ga0070660_100000763 Ga0070660_1000007639 251
38 3300005366 Ga0070659_100000385 Ga0070659_10000038522 251
39 3300005455 Ga0070663_100001273 Ga0070663_1000012737 251
40 3300005563 Ga0068855_100052093 Ga0068855_1000520934 251
41 3300005614 Ga0068856_100196738 Ga0068856_1001967382 251
42 3300009092 Ga0105250_10032758 Ga0105250_100327581 251
43 3300009093 Ga0105240_10016599 Ga0105240_1001659910 251
44 3300009545 Ga0105237_10106501 Ga0105237_101065012 251
45 3300009551 Ga0105238_10015695 Ga0105238_100156958 251
46 3300010375 Ga0105239_10017183 Ga0105239_100171832 251
47 3300013100 Ga0157373_10299757 Ga0157373_102997571 251
48 3300013104 Ga0157370_10017484 Ga0157370_100174846 251
49 3300025711 Ga0207696_1020889 Ga0207696_10208892 251
50 3300025914 Ga0207671_10038449 Ga0207671_100384494 251
51 3300025932 Ga0207690_10000016 Ga0207690_10000016137 251
52 3300025949 Ga0207667_10006243 Ga0207667_100062438 251
53 3300026067 Ga0207678_10001314 Ga0207678_1000131420 251
54 3300026078 Ga0207702_10173787 Ga0207702_101737872 251
55 3300044693 Ga0466961_0000469 Ga0466961_0000469_8570_9547 251
56 3300048904 Ga0496101_0064036 Ga0496101_0064036_1281_2258 251
57 3300048915 Ga0496112_0327244 Ga0496112_0327244_112_1089 251
58 3300048925 Ga0496122_0064267 Ga0496122_0064267_1642_2619 251
59 3300048926 Ga0496123_0064238 Ga0496123_0064238_739_1716 251
60 3300009093 Ga0105240_10416312 Ga0105240_104163122 252
61 3300010375 Ga0105239_10010248 Ga0105239_100102489 252
62 3300025225 Ga0209566_100750 Ga0209566_1007502 252
63 3300025913 Ga0207695_10547698 Ga0207695_105476981 252
64 3300044656 Ga0466969_0000381 Ga0466969_0000381_10383_11360 252
65 3300044659 Ga0466973_0022236 Ga0466973_0022236_1751_2728 252
66 3300044765 Ga0466970_0039723 Ga0466970_0039723_1042_2019 252
67 3300045049 Ga0466959_0008179 Ga0466959_0008179_3580_4557 252
68 3300045836 Ga0466958_0012956 Ga0466958_0012956_833_1810 252
69 3300048924 Ga0496121_0008238 Ga0496121_0008238_1903_2880 252
70 3300013104 Ga0157370_10079188 Ga0157370_100791883 253
71 3300013105 Ga0157369_10000093 Ga0157369_1000009381 253
72 3300022467 Ga0224712_10000398 Ga0224712_100003982 253
73 iso_pu_bacteria 2857357740 2857365839 262
74 3300030745 Ga0316182_1030780 Ga0316182_10307802 265
75 3300049679 Ga0501249_017992 Ga0501249_017992_68_1036 265
76 iso_pu_bacteria 2510917013 2511091839 265
77 iso_pu_bacteria 2510917015 2511104341 265
78 iso_pu_bacteria 2513237083 2513561634 265
79 iso_pu_bacteria 2515154123 2515687732 265
80 iso_pu_bacteria 2515154189 2516017743 265
81 iso_pu_bacteria 2519103095 2519463162 265
82 iso_pu_bacteria 2582581311 2585293509 265
83 iso_pu_bacteria 2599185239 2599738002 265
84 iso_pu_bacteria 2599185240 2599745960 265
85 iso_pu_bacteria 2599185355 2600207781 265
86 iso_pu_bacteria 2600255067 2600811555 265
87 iso_pu_bacteria 2675903129 2676744094 265
88 iso_pu_bacteria 2816332253 2817263456 265
89 iso_pu_bacteria 2816332256 2817276832 265
90 iso_pu_bacteria 2816332286 2817452945 265
91 iso_pu_bacteria 2818991452 2819631851 265
92 iso_pu_bacteria 2842324504 2842331032 265
93 iso_pu_bacteria 2842348783 2842355371 265
94 iso_pu_bacteria 2842454564 2842455953 265
95 iso_pu_bacteria 2863421361 2863422877 265
96 iso_pu_bacteria 2870068957 2870075647 265
97 iso_pu_bacteria 2883087390 2883093866 265
98 iso_pu_bacteria 2904564687 2904566524 265
99 iso_pu_bacteria 2904571731 2904573569 265
100 iso_pu_bacteria 2928157003 2928162267 265
101 iso_pu_bacteria 2928163908 2928166312 265
102 iso_pu_bacteria 2928170801 2928173714 265
103 iso_pu_bacteria 2928536128 2928539593 265
104 iso_pu_bacteria 2981990288 2981995596 265
105 iso_pu_bacteria 641736154 642417802 265
106 iso_pu_bacteria 642555113 642615706 265
107 iso_pu_bacteria 8003955200 8003958489 265
108 iso_pu_bacteria 8018845410 8018847577 265
109 iso_pu_bacteria 8020807995 8020811223 265
110 iso_pu_bacteria 8020938398 8020940416 265
111 iso_pu_bacteria 8020945358 8020946570 265
112 iso_pu_bacteria 8020953355 8020955205 265
113 iso_pu_bacteria 8021120328 8021125115 265
114 iso_pu_bacteria 8040167225 8040170049 265
115 iso_pu_bacteria 8040173305 8040176660 265
116 3300047323 Ga0495683_0000823 Ga0495683_0000823_7442_8410 266
117 3300048907 Ga0496104_0064459 Ga0496104_0064459_1781_2749 266
118 3300048908 Ga0496105_0310403 Ga0496105_0310403_233_1201 266
119 3300049460 Ga0495682_0011669 Ga0495682_0011669_591_1559 266
120 iso_pu_bacteria 2513237166 2514049574 266
121 iso_pu_bacteria 2562617112 2563057642 266
122 iso_pu_bacteria 2711768613 2713473660 266
123 iso_pu_bacteria 2921643360 2921649617 266
124 iso_pu_bacteria 642555112 642597046 266
125 3300003758 Ga0055532_1000323 Ga0055532_100032312 269
126 3300003758 Ga0055532_1000587 Ga0055532_10005872 269
127 3300003760 Ga0055527_1000478 Ga0055527_100047815 269
128 3300003761 Ga0055535_1000134 Ga0055535_100013412 269
129 3300003762 Ga0055542_1000178 Ga0055542_100017812 269
130 3300003763 Ga0055529_1000203 Ga0055529_100020312 269
131 3300003856 Ga0058692_1008670 Ga0058692_10086702 269
132 3300005337 Ga0070682_100012645 Ga0070682_1000126452 269
133 3300009093 Ga0105240_10000553 Ga0105240_1000055344 269
134 3300013102 Ga0157371_10027569 Ga0157371_100275692 269
135 3300013104 Ga0157370_10222637 Ga0157370_102226372 269
136 3300013105 Ga0157369_10000084 Ga0157369_1000008428 269
137 3300014497 Ga0182008_10049431 Ga0182008_100494312 269
138 3300015262 Ga0182007_10004501 Ga0182007_100045012 269
139 3300025228 Ga0209672_100044 Ga0209672_100044177 269
140 3300025228 Ga0209672_100622 Ga0209672_10062214 269
141 3300025229 Ga0209147_100039 Ga0209147_100039177 269
142 3300025229 Ga0209147_100076 Ga0209147_100076105 269
143 3300025242 Ga0209258_100062 Ga0209258_100062177 269
144 3300025254 Ga0209148_1000075 Ga0209148_1000075177 269
145 3300025256 Ga0209759_1000052 Ga0209759_100005259 269
146 3300025263 Ga0209565_1009578 Ga0209565_10095782 269
147 3300025272 Ga0209455_1000067 Ga0209455_1000067177 269
148 3300025273 Ga0209673_1000865 Ga0209673_100086523 269
149 3300025295 Ga0209564_1007924 Ga0209564_10079245 269
150 3300027312 Ga0209371_1000211 Ga0209371_100021168 269
151 3300028800 Ga0265338_10000057 Ga0265338_10000057166 269
152 3300030500 Ga0268256_1000878 Ga0268256_100087822 269
153 3300031238 Ga0265332_10030362 Ga0265332_100303622 269
154 3300037312 Ga0395899_0000023 Ga0395899_0000023_143441_144418 269
155 3300037312 Ga0395899_0042367 Ga0395899_0042367_1301_2278 269
156 3300037418 Ga0395900_0000019 Ga0395900_0000019_222742_223719 269
157 3300037418 Ga0395900_0000182 Ga0395900_0000182_74624_75601 269
158 3300037418 Ga0395900_0080149 Ga0395900_0080149_923_1900 269
159 3300037466 Ga0395898_0000016 Ga0395898_0000016_217891_218868 269
160 3300037466 Ga0395898_0001476 Ga0395898_0001476_16199_17176 269
161 3300037466 Ga0395898_0003387 Ga0395898_0003387_13204_14181 269
162 3300038443 Ga0395901_0000004 Ga0395901_0000004_585689_586666 269
163 3300038443 Ga0395901_0000040 Ga0395901_0000040_88733_89710 269
164 3300038443 Ga0395901_0092278 Ga0395901_0092278_482_1459 269
165 3300039447 Ga0436361_0969076 Ga0436361_0969076_1666_2643 269
166 3300044656 Ga0466969_0001760 Ga0466969_0001760_6238_7215 269
167 3300044656 Ga0466969_0017689 Ga0466969_0017689_2530_3507 269
168 3300044672 Ga0466982_0070422 Ga0466982_0070422_855_1832 269
169 3300044683 Ga0466965_0002766 Ga0466965_0002766_3987_4964 269
170 3300044684 Ga0466966_0000172 Ga0466966_0000172_32931_33908 269
171 3300044684 Ga0466966_0002166 Ga0466966_0002166_1057_2034 269
172 3300044684 Ga0466966_0011634 Ga0466966_0011634_1763_2740 269
173 3300044684 Ga0466966_0017648 Ga0466966_0017648_2521_3498 269
174 3300044684 Ga0466966_0032609 Ga0466966_0032609_642_1619 269
175 3300044693 Ga0466961_0000169 Ga0466961_0000169_7514_8491 269
176 3300044693 Ga0466961_0000848 Ga0466961_0000848_6853_7830 269
177 3300044693 Ga0466961_0032317 Ga0466961_0032317_707_1684 269
178 3300044693 Ga0466961_0070111 Ga0466961_0070111_187_1164 269
179 3300044694 Ga0466963_0013367 Ga0466963_0013367_4032_5009 269
180 3300044719 Ga0466971_0001259 Ga0466971_0001259_1682_2659 269
181 3300044719 Ga0466971_0155062 Ga0466971_0155062_58_1035 269
182 3300044842 Ga0466957_0012197 Ga0466957_0012197_3638_4615 269
183 3300044842 Ga0466957_0012414 Ga0466957_0012414_2170_3147 269
184 3300044842 Ga0466957_0017486 Ga0466957_0017486_3122_4099 269
185 3300044901 Ga0466960_0019994 Ga0466960_0019994_769_1746 269
186 3300045049 Ga0466959_0004770 Ga0466959_0004770_5022_5999 269
187 3300045836 Ga0466958_0033796 Ga0466958_0033796_1253_2230 269
188 3300046471 Ga0495650_0013150 Ga0495650_0013150_2360_3337 269
189 3300046472 Ga0495580_0000484 Ga0495580_0000484_4386_5363 269
190 3300046472 Ga0495580_0003187 Ga0495580_0003187_9363_10340 269
191 3300046472 Ga0495580_0021614 Ga0495580_0021614_2721_3698 269
192 3300046477 Ga0495664_0036611 Ga0495664_0036611_411_1388 269
193 3300046506 Ga0495583_0007781 Ga0495583_0007781_4676_5653 269
194 3300046514 Ga0495618_0142255 Ga0495618_0142255_279_1256 269
195 3300046515 Ga0495620_0034902 Ga0495620_0034902_888_1865 269
196 3300046516 Ga0495628_0181320 Ga0495628_0181320_295_1272 269
197 3300046517 Ga0495630_0006595 Ga0495630_0006595_6148_7125 269
198 3300046524 Ga0495648_0029432 Ga0495648_0029432_2169_3146 269
199 3300046531 Ga0495665_0003025 Ga0495665_0003025_2846_3823 269
200 3300046648 Ga0495611_0013855 Ga0495611_0013855_743_1720 269
201 3300046660 Ga0495625_0019626 Ga0495625_0019626_2617_3594 269
202 3300046678 Ga0495599_0138089 Ga0495599_0138089_110_1087 269
203 3300046690 Ga0495624_0002482 Ga0495624_0002482_7699_8676 269
204 3300046692 Ga0495671_0033419 Ga0495671_0033419_136_1113 269
205 3300047319 Ga0495674_0002565 Ga0495674_0002565_10439_11416 269
206 3300047319 Ga0495674_0020389 Ga0495674_0020389_1917_2894 269
207 3300047320 Ga0495672_0085418 Ga0495672_0085418_149_1126 269
208 3300047446 Ga0495679_000009 Ga0495679_000009_130575_131552 269
209 3300047469 Ga0495673_0015956 Ga0495673_0015956_2169_3146 269
210 3300047673 Ga0495593_0043171 Ga0495593_0043171_142_1119 269
211 3300048088 Ga0495602_0079275 Ga0495602_0079275_574_1551 269
212 3300048091 Ga0495626_0013740 Ga0495626_0013740_2934_3911 269
213 3300048924 Ga0496121_0015113 Ga0496121_0015113_3666_4643 269
214 3300049459 Ga0495678_011167 Ga0495678_011167_2570_3547 269
215 3300049460 Ga0495682_0074470 Ga0495682_0074470_108_1085 269
216 3300061719 Ga0466962_0000561 Ga0466962_0000561_10715_11692 269
217 3300003322 rootL2_10035215 rootL2_100352151 270
218 3300003354 JGI25160J50197_1000036 JGI25160J50197_100003667 270
219 3300005262 Ga0065165_1000686 Ga0065165_100068619 270
220 3300025295 Ga0209564_1006190 Ga0209564_10061905 270
221 3300025302 Ga0207426_1000014 Ga0207426_1000014347 270
222 3300037471 Ga0395905_0000009 Ga0395905_0000009_282468_283448 270
223 3300037471 Ga0395905_0126593 Ga0395905_0126593_1277_2257 270
224 3300046455 Ga0495603_0006823 Ga0495603_0006823_1420_2400 270
225 3300046513 Ga0495616_0030333 Ga0495616_0030333_1127_2107 270
226 3300046524 Ga0495648_0045950 Ga0495648_0045950_890_1870 270
227 3300046531 Ga0495665_0063100 Ga0495665_0063100_302_1282 270
228 3300046692 Ga0495671_0016686 Ga0495671_0016686_782_1762 270
229 3300047319 Ga0495674_0002885 Ga0495674_0002885_3099_4079 270
230 3300048091 Ga0495626_0043381 Ga0495626_0043381_477_1457 270
231 3300048903 Ga0496100_0000124 Ga0496100_0000124_8127_9107 270
232 3300048903 Ga0496100_0022586 Ga0496100_0022586_577_1557 270
233 3300048904 Ga0496101_0000147 Ga0496101_0000147_4228_5208 270
234 3300048905 Ga0496102_0000057 Ga0496102_0000057_83223_84203 270
235 3300048906 Ga0496103_0000142 Ga0496103_0000142_66678_67658 270
236 3300048908 Ga0496105_0016071 Ga0496105_0016071_3682_4662 270
237 3300048909 Ga0496106_0189104 Ga0496106_0189104_217_1197 270
238 3300048910 Ga0496107_0215653 Ga0496107_0215653_229_1209 270
239 3300048918 Ga0496115_0103632 Ga0496115_0103632_592_1572 270
240 3300048919 Ga0496116_0066161 Ga0496116_0066161_567_1547 270
241 3300048920 Ga0496117_0000118 Ga0496117_0000118_83732_84712 270
242 3300048921 Ga0496118_0000068 Ga0496118_0000068_83204_84184 270
243 3300048922 Ga0496119_0031136 Ga0496119_0031136_522_1502 270
244 3300048924 Ga0496121_0014889 Ga0496121_0014889_4269_5249 270
245 3300048924 Ga0496121_0137097 Ga0496121_0137097_348_1328 270
246 3300048927 Ga0496124_0132145 Ga0496124_0132145_452_1432 270
247 3300048929 Ga0496126_0074239 Ga0496126_0074239_692_1672 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

158

285

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.5861 153 265
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.5422 153 261
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.5266 153 265
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.5168 153 266
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.507 156 266
ID Description Score Start End Superfamily
af_Q54D80_1_349_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9998 102 135 3.40.1190.20
af_Q9VW84_5_299_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9434 103 133 3.40.1190.20
af_Q9VTI3_11_311_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9297 103 133 3.40.1190.20
af_Q9VW82_33_356_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8464 94 135 3.40.1190.20
af_Q76PC3_7_147_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.6886 95 146 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A7Y0N425-F1-model_v4 Pilus assembly protein TadB 0.8848 88 227 GO:0016020
AF-A0A7Y0N425-F1-model_v4 Pilus assembly protein TadB 0.8678 88 227 GO:0016020
AF-A0A7C5RRF3-F1-model_v4 Secretion system protein 0.7942 66 263 GO:0005886
AF-A0A1W9PSY3-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.7787 70 256 GO:0005886
AF-A0A1V5I2G5-F1-model_v4 deleted 0.7771 87 259

Feature Viewer

pLDDT pTM Quality
69.72 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map