F358571

General Info

Members Datasets Scaffolds Average Seq Length
246 181 492 458

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0001188|Ga0500637_0001188_881_2353
Length 474
Sequence LVLRHHAQAYKVVLMPDLIRIRTWLVLVVPDLARRSSSSVRLDDGRGPLSAEQSKTILDGLQSRSKETNIFDRHLALEEAIVGSPLTTGNQVLLLQDGPATYRAMFAAIMAAKDHINMETYILDDDEVGQRFAQALIDKQQQGVQVNLIRDSVGTLNTPIAFFQRLTDSGIKVLEFNPINPLLARNEWELNQRDHRKLLIVDGRTAFLGGINISSVYSGGSLRKSARDKPKDDSNNVSKDGVEATLAWRDTDLQLRGPVVAEFQKLFLATWEAQKGEPLRGGKYFPPIAPAGDQVVRAIGSSPDEPYSLIYATLLSAIGSAETSVHLTNAYFVPDPQLLAALEAAAQRGVDVTLILPSKTDSWLVFNAGRRYYKELLQAGVKIYERRGAILHSKTALIDGVWATVGSTNLDWRSFLHNHELNAVVLGAEFGSQVQTMFDKDLAASDQITLAQWQRRPLQMRIKELFARAWEYWL

Samples

Sample ID Description Type Environment
1 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
133 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
136 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
140 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
172 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
173 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
174 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
175 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
176 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
177 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
178 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
179 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
180 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
181 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.57
Nodule 0
Rhizoplane 3.25
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500637_0001188 3300053178 Bacteria 10845
2 JGI25162J39368_1000344 3300002737 Bacteria 40143
3 JGI25163J39215_1000856 3300002771 Bacteria 7262
4 JGI25164J39214_1000253 3300002772 Bacteria 40203
5 JGI25164J39214_1000255 3300002772 Bacteria 40111
6 JGI25165J46597_1000463 3300003214 Bacteria 40143
7 Ga0055536_1000015 3300003781 Bacteria 237585
8 Ga0055530_10000003 3300003791 Bacteria 237585
9 Ga0055540_1000601 3300003792 Bacteria 25880
10 Ga0065714_10006715 3300005288 Bacteria 3362
11 Ga0065714_10074240 3300005288 Bacteria 3065
12 Ga0070676_10018780 3300005328 Bacteria 3836
13 Ga0070683_100120390 3300005329 Bacteria 2479
14 Ga0070670_100008254 3300005331 Bacteria 8867
15 Ga0070677_10003699 3300005333 Bacteria 4945
16 Ga0068869_100088807 3300005334 Bacteria 2320
17 Ga0070666_10020653 3300005335 Bacteria 4259
18 Ga0070666_10023374 3300005335 Bacteria 4024
19 Ga0068868_100005822 3300005338 Bacteria 8689
20 Ga0070689_100019226 3300005340 Bacteria 5048
21 Ga0070687_100008780 3300005343 Bacteria 4294
22 Ga0070675_100032066 3300005354 Bacteria 4250
23 Ga0070671_100008521 3300005355 Bacteria 8219
24 Ga0070673_100001139 3300005364 Bacteria 15278
25 Ga0070673_100015857 3300005364 Bacteria 5307
26 Ga0070667_100002650 3300005367 Bacteria 15501
27 Ga0070678_100025914 3300005456 Bacteria 3955
28 Ga0070678_100034062 3300005456 Bacteria 3543
29 Ga0070662_100016624 3300005457 Bacteria 4943
30 Ga0068867_100046619 3300005459 Bacteria 3184
31 Ga0068867_100058027 3300005459 Bacteria 2868
32 Ga0068867_100061164 3300005459 Bacteria 2795
33 Ga0070685_10018406 3300005466 Bacteria 3756
34 Ga0070672_100006869 3300005543 Bacteria 7690
35 Ga0070665_100034036 3300005548 Bacteria 5124
36 Ga0070665_100041196 3300005548 Bacteria 4641
37 Ga0070704_100005228 3300005549 Bacteria 7556
38 Ga0070704_100021440 3300005549 Bacteria 4188
39 Ga0070664_100015800 3300005564 Bacteria 6179
40 Ga0068854_100002003 3300005578 Bacteria 12480
41 Ga0070702_100085772 3300005615 Bacteria 1897
42 Ga0068852_100021073 3300005616 Bacteria 5194
43 Ga0068852_100081543 3300005616 Bacteria 2872
44 Ga0068859_100104061 3300005617 Bacteria 2897
45 Ga0068864_100231141 3300005618 Bacteria 1710
46 Ga0068861_100020613 3300005719 Bacteria 4725
47 Ga0068863_100149238 3300005841 Bacteria 2236
48 Ga0068858_100029970 3300005842 Bacteria 5053
49 Ga0068860_100122654 3300005843 Bacteria 2489
50 Ga0075362_10008578 3300006177 Bacteria 3916
51 Ga0075367_10030780 3300006178 Bacteria 3079
52 Ga0075366_10018574 3300006195 Bacteria 4016
53 Ga0097621_100032242 3300006237 Bacteria 4164
54 Ga0068871_100004732 3300006358 Bacteria 9525
55 Ga0068871_100063098 3300006358 Bacteria 3029
56 Ga0075428_100000573 3300006844 Bacteria 37528
57 Ga0075428_100008541 3300006844 Bacteria 11361
58 Ga0075430_100143333 3300006846 Bacteria 1990
59 Ga0075431_100029007 3300006847 Bacteria 5692
60 Ga0075429_100008793 3300006880 Bacteria 8781
61 Ga0075429_100046035 3300006880 Bacteria 3796
62 Ga0075429_100107329 3300006880 Bacteria 2440
63 Ga0097620_100104061 3300006931 Bacteria 2897
64 Ga0075435_100081448 3300007076 Bacteria 2659
65 Ga0111539_10001940 3300009094 Bacteria 27569
66 Ga0111539_10007563 3300009094 Bacteria 13891
67 Ga0111539_10015666 3300009094 Bacteria 9423
68 Ga0111539_10046511 3300009094 Bacteria 5190
69 Ga0105245_10038439 3300009098 Bacteria 4258
70 Ga0114129_10159321 3300009147 Bacteria 3085
71 Ga0105243_10019559 3300009148 Bacteria 5134
72 Ga0105242_10033200 3300009176 Bacteria 4131
73 Ga0105248_10036945 3300009177 Bacteria 5463
74 Ga0105249_10104330 3300009553 Bacteria 2671
75 Ga0157378_10008642 3300013297 Bacteria 8863
76 Ga0163162_10256842 3300013306 Bacteria 1879
77 Ga0157375_10007321 3300013308 Bacteria 9660
78 Ga0163163_10258105 3300014325 Bacteria 1794
79 Ga0157380_10023203 3300014326 Bacteria 4679
80 Ga0157377_10045585 3300014745 Bacteria 2450
81 Ga0157379_10022991 3300014968 Bacteria 5526
82 Ga0157376_10009184 3300014969 Bacteria 7171
83 Ga0157376_10064894 3300014969 Bacteria 3081
84 Ga0182005_1001290 3300015265 Bacteria 10299
85 Ga0209760_100162 3300025207 Bacteria 40192
86 Ga0207427_100114 3300025231 Bacteria 104357
87 Ga0209437_100219 3300025233 Bacteria 104357
88 Ga0209233_1000012 3300025261 Bacteria 1019519
89 Ga0209676_1000017 3300025292 Bacteria 643409
90 Ga0209050_1000076 3300025298 Bacteria 285628
91 Ga0209051_1000050 3300025303 Bacteria 284349
92 Ga0207697_10005612 3300025315 Bacteria 5804
93 Ga0207682_10000554 3300025893 Bacteria 17214
94 Ga0207642_10011205 3300025899 Bacteria 3189
95 Ga0207688_10000278 3300025901 Bacteria 23334
96 Ga0207680_10074819 3300025903 Bacteria 2110
97 Ga0207645_10003253 3300025907 Bacteria 12410
98 Ga0207643_10013255 3300025908 Bacteria 4462
99 Ga0207662_10003472 3300025918 Bacteria 8119
100 Ga0207662_10082771 3300025918 Bacteria 1961
101 Ga0207650_10035808 3300025925 Bacteria 3607
102 Ga0207687_10032236 3300025927 Bacteria 3548
103 Ga0207706_10029309 3300025933 Bacteria 4914
104 Ga0207686_10006811 3300025934 Bacteria 6153
105 Ga0207709_10048024 3300025935 Bacteria 2599
106 Ga0207691_10003617 3300025940 Bacteria 15002
107 Ga0207711_10070401 3300025941 Bacteria 3033
108 Ga0207689_10054350 3300025942 Bacteria 3298
109 Ga0207661_10068827 3300025944 Bacteria 2884
110 Ga0207651_10003197 3300025960 Bacteria 8003
111 Ga0207651_10012178 3300025960 Bacteria 4853
112 Ga0207668_10110405 3300025972 Bacteria 2062
113 Ga0207640_10024517 3300025981 Bacteria 3640
114 Ga0207658_10017244 3300025986 Bacteria 4975
115 Ga0207658_10029007 3300025986 Bacteria 3902
116 Ga0207677_10030098 3300026023 Bacteria 3460
117 Ga0207703_10261479 3300026035 Bacteria 1564
118 Ga0207708_10002965 3300026075 Bacteria 12511
119 Ga0207641_10055592 3300026088 Bacteria 3361
120 Ga0207648_10002576 3300026089 Bacteria 19415
121 Ga0207648_10075134 3300026089 Bacteria 2946
122 Ga0207676_10119669 3300026095 Bacteria 2218
123 Ga0207674_10205962 3300026116 Bacteria 1916
124 Ga0207675_100030804 3300026118 Bacteria 4997
125 Ga0207683_10013777 3300026121 Bacteria 6895
126 Ga0207698_10008920 3300026142 Bacteria 6358
127 Ga0207698_10087025 3300026142 Bacteria 2543
128 Ga0209995_1004974 3300027471 Bacteria 2133
129 Ga0209999_1005771 3300027543 Bacteria 2227
130 Ga0209966_1000052 3300027695 Bacteria 50827
131 Ga0209974_10000673 3300027876 Bacteria 11595
132 Ga0209974_10020480 3300027876 Bacteria 2192
133 Ga0207428_10015552 3300027907 Bacteria 6577
134 Ga0207428_10027073 3300027907 Bacteria 4775
135 Ga0268265_10047451 3300028380 Bacteria 3218
136 Ga0307517_10001724 3300028786 Bacteria 36027
137 Ga0307517_10045428 3300028786 Bacteria 4613
138 Ga0307517_10067681 3300028786 Bacteria 3265
139 Ga0307515_10000022 3300028794 Bacteria 404064
140 Ga0307515_10000043 3300028794 Bacteria 304612
141 Ga0307515_10010925 3300028794 Bacteria 17317
142 Ga0307515_10025433 3300028794 Bacteria 10245
143 Ga0307512_10013884 3300030522 Bacteria 7526
144 Ga0265331_10000030 3300031250 Bacteria 215032
145 Ga0265327_10000072 3300031251 Bacteria 215055
146 Ga0265327_10000681 3300031251 Bacteria 54587
147 Ga0307513_10031669 3300031456 Bacteria 5984
148 Ga0307513_10046997 3300031456 Bacteria 4699
149 Ga0307509_10144180 3300031507 Bacteria 2310
150 Ga0307508_10000007 3300031616 Bacteria 268359
151 Ga0307514_10045696 3300031649 Bacteria 3425
152 Ga0307516_10006932 3300031730 Bacteria 13155
153 Ga0307516_10020007 3300031730 Bacteria 6921
154 Ga0373925_0008525 3300037068 Bacteria 7470
155 Ga0395900_0029640 3300037418 Bacteria 5614
156 Ga0395901_0091330 3300038443 Bacteria 3187
157 Ga0395901_0132224 3300038443 Bacteria 2622
158 Ga0439436_0000606 3300041404 Bacteria 9491
159 Ga0439438_000198 3300041405 Bacteria 27367
160 Ga0439438_003872 3300041405 Bacteria 5901
161 Ga0439438_007162 3300041405 Bacteria 3845
162 Ga0439447_000020 3300041407 Bacteria 58031
163 Ga0439447_000278 3300041407 Bacteria 18185
164 Ga0439447_001038 3300041407 Bacteria 10102
165 Ga0439447_004682 3300041407 Bacteria 4663
166 Ga0439447_005366 3300041407 Bacteria 4272
167 Ga0439466_0002995 3300041411 Bacteria 6591
168 Ga0439466_0003096 3300041411 Bacteria 6465
169 Ga0439466_0003362 3300041411 Bacteria 6221
170 Ga0439466_0006709 3300041411 Bacteria 4367
171 Ga0439466_0008441 3300041411 Bacteria 3883
172 Ga0439466_0025514 3300041411 Bacteria 2063
173 Ga0439466_0047471 3300041411 Bacteria 1415
174 Ga0439465_0010499 3300041413 Bacteria 2908
175 Ga0451802_0242092 3300041460 Bacteria 1818
176 Ga0451853_0352193 3300041512 Bacteria 2501
177 Ga0451853_1158759 3300041512 Bacteria 2799
178 Ga0439432_010168 3300042006 Bacteria 3267
179 Ga0439451_007466 3300042009 Bacteria 2227
180 Ga0439451_012736 3300042009 Bacteria 1698
181 Ga0439452_001167 3300042010 Bacteria 11351
182 Ga0439452_001344 3300042010 Bacteria 10253
183 Ga0439452_003661 3300042010 Bacteria 5328
184 Ga0439452_003686 3300042010 Bacteria 5303
185 Ga0439452_007687 3300042010 Bacteria 3290
186 Ga0439463_000104 3300042016 Bacteria 20389
187 Ga0450920_004899 3300042122 Bacteria 2366
188 Ga0450922_000093 3300042124 Bacteria 8591
189 Ga0450923_000893 3300042125 Bacteria 3667
190 Ga0450903_002125 3300042138 Bacteria 3557
191 Ga0450907_000001 3300042146 Bacteria 236562
192 Ga0450909_000826 3300042185 Bacteria 4202
193 Ga0439434_0000035 3300042435 Bacteria 32694
194 Ga0439434_0000376 3300042435 Bacteria 12716
195 Ga0439434_0000775 3300042435 Bacteria 9195
196 Ga0439435_0000230 3300042436 Bacteria 8032
197 Ga0439460_0009203 3300042461 Bacteria 2505
198 Ga0439460_0010892 3300042461 Bacteria 2336
199 Ga0451577_0041170 3300042876 Bacteria 4147
200 Ga0451577_0113325 3300042876 Bacteria 2427
201 Ga0439440_0002682 3300042993 Bacteria 3377
202 Ga0453684_0005381 3300044712 Bacteria 25439
203 Ga0453684_0147790 3300044712 Bacteria 2797
204 Ga0451576_0043955 3300045051 Bacteria 4711
205 Ga0451576_0233511 3300045051 Bacteria 1921
206 Ga0495630_0069885 3300046517 Bacteria 2642
207 Ga0495632_0024688 3300046519 Bacteria 3189
208 Ga0495621_0016482 3300046539 Bacteria 2373
209 Ga0495622_0003032 3300046557 Bacteria 7967
210 Ga0495625_0003544 3300046660 Bacteria 15436
211 Ga0495670_0005471 3300046691 Bacteria 6231
212 Ga0495671_0004035 3300046692 Bacteria 8865
213 Ga0495681_0005051 3300047470 Bacteria 8897
214 Ga0495686_0000739 3300047472 Bacteria 43610
215 Ga0496104_0342570 3300048907 Bacteria 1408
216 Ga0496109_0265168 3300048912 Bacteria 1618
217 Ga0496114_0162298 3300048917 Bacteria 1944
218 Ga0496114_0178594 3300048917 Bacteria 1853
219 Ga0501039_0081544 3300049575 Bacteria 2519
220 nmdc:mga0k408_20726_c1 3300050493 Bacteria 3687
221 nmdc:mga0k408_8770_c1 3300050493 Bacteria 5442
222 nmdc:mga05p37_122933_c1 3300050507 Bacteria 3188
223 nmdc:mga05p37_56217_c1 3300050507 Bacteria 4844
224 nmdc:mga09592_103502_c1 3300050508 Bacteria 2439
225 nmdc:mga09592_126185_c1 3300050508 Bacteria 2200
226 nmdc:mga09592_8621_c1 3300050508 Bacteria 8295
227 nmdc:mga06r32_16908_c1 3300050510 Bacteria 6654
228 nmdc:mga08y16_10006_c1 3300050511 Bacteria 9951
229 nmdc:mga08y16_10572_c1 3300050511 Bacteria 9686
230 nmdc:mga08y16_115668_c1 3300050511 Bacteria 2792
231 nmdc:mga0n895_27856_c1 3300050512 Bacteria 5369
232 nmdc:mga0rr50_65618_c1 3300050513 Bacteria 2750
233 Ga0500658_0040177 3300053134 Bacteria 1872
234 Ga0500559_0070077 3300053136 Bacteria 1577
235 Ga0500636_0000058 3300053177 Bacteria 53244
236 Ga0500625_010523 3300053729 Bacteria 4163
237 Ga0500587_005540 3300053739 Bacteria 1693
238 2587755515 2585428062 Bacteria 6842168
239 2597859131 2597489887 Bacteria 6666321
240 2599487448 2599185185 Bacteria 6652270
241 2599806237 2599185257 Bacteria 6492581
242 2671772700 2671180172 Bacteria 6495783
243 2808942532 2808606379 Bacteria 5022697
244 2939640008 2939636861 Bacteria 6297853
245 2984288441 2984286254 Bacteria 6702062
246 3007515023 3007511990 Bacteria 6481491
247 Ga0500637_0001188
248 JGI25162J39368_1000344
249 JGI25163J39215_1000856
250 JGI25164J39214_1000253
251 JGI25164J39214_1000255
252 JGI25165J46597_1000463
253 Ga0055536_1000015
254 Ga0055530_10000003
255 Ga0055540_1000601
256 Ga0065714_10006715
257 Ga0065714_10074240
258 Ga0070676_10018780
259 Ga0070683_100120390
260 Ga0070670_100008254
261 Ga0070677_10003699
262 Ga0068869_100088807
263 Ga0070666_10020653
264 Ga0070666_10023374
265 Ga0068868_100005822
266 Ga0070689_100019226
267 Ga0070687_100008780
268 Ga0070675_100032066
269 Ga0070671_100008521
270 Ga0070673_100001139
271 Ga0070673_100015857
272 Ga0070667_100002650
273 Ga0070678_100025914
274 Ga0070678_100034062
275 Ga0070662_100016624
276 Ga0068867_100046619
277 Ga0068867_100058027
278 Ga0068867_100061164
279 Ga0070685_10018406
280 Ga0070672_100006869
281 Ga0070665_100034036
282 Ga0070665_100041196
283 Ga0070704_100005228
284 Ga0070704_100021440
285 Ga0070664_100015800
286 Ga0068854_100002003
287 Ga0070702_100085772
288 Ga0068852_100021073
289 Ga0068852_100081543
290 Ga0068859_100104061
291 Ga0068864_100231141
292 Ga0068861_100020613
293 Ga0068863_100149238
294 Ga0068858_100029970
295 Ga0068860_100122654
296 Ga0075362_10008578
297 Ga0075367_10030780
298 Ga0075366_10018574
299 Ga0097621_100032242
300 Ga0068871_100004732
301 Ga0068871_100063098
302 Ga0075428_100000573
303 Ga0075428_100008541
304 Ga0075430_100143333
305 Ga0075431_100029007
306 Ga0075429_100008793
307 Ga0075429_100046035
308 Ga0075429_100107329
309 Ga0097620_100104061
310 Ga0075435_100081448
311 Ga0111539_10001940
312 Ga0111539_10007563
313 Ga0111539_10015666
314 Ga0111539_10046511
315 Ga0105245_10038439
316 Ga0114129_10159321
317 Ga0105243_10019559
318 Ga0105242_10033200
319 Ga0105248_10036945
320 Ga0105249_10104330
321 Ga0157378_10008642
322 Ga0163162_10256842
323 Ga0157375_10007321
324 Ga0163163_10258105
325 Ga0157380_10023203
326 Ga0157377_10045585
327 Ga0157379_10022991
328 Ga0157376_10009184
329 Ga0157376_10064894
330 Ga0182005_1001290
331 Ga0209760_100162
332 Ga0207427_100114
333 Ga0209437_100219
334 Ga0209233_1000012
335 Ga0209676_1000017
336 Ga0209050_1000076
337 Ga0209051_1000050
338 Ga0207697_10005612
339 Ga0207682_10000554
340 Ga0207642_10011205
341 Ga0207688_10000278
342 Ga0207680_10074819
343 Ga0207645_10003253
344 Ga0207643_10013255
345 Ga0207662_10003472
346 Ga0207662_10082771
347 Ga0207650_10035808
348 Ga0207687_10032236
349 Ga0207706_10029309
350 Ga0207686_10006811
351 Ga0207709_10048024
352 Ga0207691_10003617
353 Ga0207711_10070401
354 Ga0207689_10054350
355 Ga0207661_10068827
356 Ga0207651_10003197
357 Ga0207651_10012178
358 Ga0207668_10110405
359 Ga0207640_10024517
360 Ga0207658_10017244
361 Ga0207658_10029007
362 Ga0207677_10030098
363 Ga0207703_10261479
364 Ga0207708_10002965
365 Ga0207641_10055592
366 Ga0207648_10002576
367 Ga0207648_10075134
368 Ga0207676_10119669
369 Ga0207674_10205962
370 Ga0207675_100030804
371 Ga0207683_10013777
372 Ga0207698_10008920
373 Ga0207698_10087025
374 Ga0209995_1004974
375 Ga0209999_1005771
376 Ga0209966_1000052
377 Ga0209974_10000673
378 Ga0209974_10020480
379 Ga0207428_10015552
380 Ga0207428_10027073
381 Ga0268265_10047451
382 Ga0307517_10001724
383 Ga0307517_10045428
384 Ga0307517_10067681
385 Ga0307515_10000022
386 Ga0307515_10000043
387 Ga0307515_10010925
388 Ga0307515_10025433
389 Ga0307512_10013884
390 Ga0265331_10000030
391 Ga0265327_10000072
392 Ga0265327_10000681
393 Ga0307513_10031669
394 Ga0307513_10046997
395 Ga0307509_10144180
396 Ga0307508_10000007
397 Ga0307514_10045696
398 Ga0307516_10006932
399 Ga0307516_10020007
400 Ga0373925_0008525
401 Ga0395900_0029640
402 Ga0395901_0091330
403 Ga0395901_0132224
404 Ga0439436_0000606
405 Ga0439438_000198
406 Ga0439438_003872
407 Ga0439438_007162
408 Ga0439447_000020
409 Ga0439447_000278
410 Ga0439447_001038
411 Ga0439447_004682
412 Ga0439447_005366
413 Ga0439466_0002995
414 Ga0439466_0003096
415 Ga0439466_0003362
416 Ga0439466_0006709
417 Ga0439466_0008441
418 Ga0439466_0025514
419 Ga0439466_0047471
420 Ga0439465_0010499
421 Ga0451802_0242092
422 Ga0451853_0352193
423 Ga0451853_1158759
424 Ga0439432_010168
425 Ga0439451_007466
426 Ga0439451_012736
427 Ga0439452_001167
428 Ga0439452_001344
429 Ga0439452_003661
430 Ga0439452_003686
431 Ga0439452_007687
432 Ga0439463_000104
433 Ga0450920_004899
434 Ga0450922_000093
435 Ga0450923_000893
436 Ga0450903_002125
437 Ga0450907_000001
438 Ga0450909_000826
439 Ga0439434_0000035
440 Ga0439434_0000376
441 Ga0439434_0000775
442 Ga0439435_0000230
443 Ga0439460_0009203
444 Ga0439460_0010892
445 Ga0451577_0041170
446 Ga0451577_0113325
447 Ga0439440_0002682
448 Ga0453684_0005381
449 Ga0453684_0147790
450 Ga0451576_0043955
451 Ga0451576_0233511
452 Ga0495630_0069885
453 Ga0495632_0024688
454 Ga0495621_0016482
455 Ga0495622_0003032
456 Ga0495625_0003544
457 Ga0495670_0005471
458 Ga0495671_0004035
459 Ga0495681_0005051
460 Ga0495686_0000739
461 Ga0496104_0342570
462 Ga0496109_0265168
463 Ga0496114_0162298
464 Ga0496114_0178594
465 Ga0501039_0081544
466 nmdc:mga0k408_20726_c1
467 nmdc:mga0k408_8770_c1
468 nmdc:mga05p37_122933_c1
469 nmdc:mga05p37_56217_c1
470 nmdc:mga09592_103502_c1
471 nmdc:mga09592_126185_c1
472 nmdc:mga09592_8621_c1
473 nmdc:mga06r32_16908_c1
474 nmdc:mga08y16_10006_c1
475 nmdc:mga08y16_10572_c1
476 nmdc:mga08y16_115668_c1
477 nmdc:mga0n895_27856_c1
478 nmdc:mga0rr50_65618_c1
479 Ga0500658_0040177
480 Ga0500559_0070077
481 Ga0500636_0000058
482 Ga0500625_010523
483 Ga0500587_005540
484 2587755515
485 2597859131
486 2599487448
487 2599806237
488 2671772700
489 2808942532
490 2939640008
491 2984288441
492 3007515023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13091

PLDc_2

PLD-like domain

314

442

0.95

PF00614

PLDc

Phospholipase D Active site motif

190

217

0.9

PF13091

PLDc_2

PLD-like domain

105

218

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8846 283 439
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8738 283 439
4gel-assembly1.cif.gz_A crystal structure of zucchini 0.8218 301 438
6ohr-assembly3.cif.gz_C structure of compound 5 bound human phospholipase d1 catalytic domain 0.7965 86 416
6u8z-assembly1.cif.gz_A crystal structure of catalytic domain of human phospholipase d1 0.7956 83 416
ID Description Score Start End Superfamily
af_Q2FYW4_304_492_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9794 282 459 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9762 293 438 3.30.870.10
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9752 295 436 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9696 293 438 3.30.870.10
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9618 295 436 3.30.870.10
ID Description Score Start End GO Terms
AF-A0A2P7NU03-F1-model_v4 Cardiolipin synthase B 0.9808 318 464 GO:0030572
GO:0032049
AF-A0A2P7NU03-F1-model_v4 Cardiolipin synthase B 0.9678 318 464 GO:0030572
GO:0032049
AF-A0A536WF28-F1-model_v4 Cardiolipin synthase B 0.965 300 464 GO:0030572
GO:0032049
AF-A0A037YZ12-F1-model_v4 deleted 0.9623 315 464
AF-A0A6I7QFL7-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9621 287 456 GO:0030572
GO:0032049

Map