F358524

General Info

Members Datasets Scaffolds Average Seq Length
246 166 243 204

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0004652|Ga0501070_0004652_5276_6001
Length 241
Sequence VGHLACPAGASAPNPPGLEAAFVGFHRRIQGLFLELVVKLTHDLIERKTGLLIALVLLVVSVGGLVEIVPLFFQRSTTEPVAGLKPYTALQLAGRDVYVREGCYNCHSQMIRPFRAETERYGHYSVAGESVYDHPFLWGSKRTGPDLARVGGRYGDDWHRIHLLNPRDVVPESNMPAYPWLAKSAADASHIERKLEVLRTLGVPYTAEDIKGAKAELQGRTELDALIAYLQVLGTSVKAAR

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
3 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
115 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
116 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
117 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
122 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
123 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.41
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 0
Rhizoplane 2.85
Rhizosphere 83.74
Stem 0
Stem Tuber 0
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000121 3300002705 Bacteria 56667
2 JGI25154J39366_1001256 3300002738 Bacteria 9517
3 JGI25157J39369_1000015 3300002741 Bacteria 194042
4 JGI25164J39214_1003397 3300002772 Bacteria 2036
5 Ga0055539_1000051 3300003752 Bacteria 175048
6 Ga0055539_1002230 3300003752 Bacteria 3073
7 Ga0055533_1000025 3300003756 Bacteria 332208
8 Ga0055525_1000868 3300003759 Bacteria 8812
9 Ga0070658_10068784 3300005327 Bacteria 2895
10 Ga0070658_10231119 3300005327 Bacteria 1566
11 Ga0070683_100316135 3300005329 Bacteria 1486
12 Ga0070666_10179655 3300005335 Bacteria 1484
13 Ga0070666_10201072 3300005335 Bacteria 1402
14 Ga0068868_100137297 3300005338 Bacteria 2005
15 Ga0068868_100239289 3300005338 Bacteria 1524
16 Ga0070660_100102226 3300005339 Bacteria 2272
17 Ga0070687_100007686 3300005343 Bacteria 4514
18 Ga0070687_100086924 3300005343 Bacteria 1720
19 Ga0070692_10450164 3300005345 Bacteria 824
20 Ga0070675_101111439 3300005354 Bacteria 727
21 Ga0070671_100150065 3300005355 Bacteria 1968
22 Ga0070659_100078949 3300005366 Bacteria 2626
23 Ga0070667_100113792 3300005367 Bacteria 2349
24 Ga0070667_100605327 3300005367 Bacteria 1010
25 Ga0070700_100473362 3300005441 Bacteria 958
26 Ga0070694_100242902 3300005444 Bacteria 1359
27 Ga0070708_100561803 3300005445 Bacteria 1076
28 Ga0070679_100075753 3300005530 Bacteria 3354
29 Ga0070679_100387058 3300005530 Bacteria 1345
30 Ga0070684_100074355 3300005535 Bacteria 2995
31 Ga0070684_100318362 3300005535 Bacteria 1429
32 Ga0068853_100002974 3300005539 Bacteria 12917
33 Ga0068853_100148849 3300005539 Bacteria 2106
34 Ga0068853_100539803 3300005539 Bacteria 1104
35 Ga0070696_100361802 3300005546 Bacteria 1126
36 Ga0070693_100184377 3300005547 Bacteria 1346
37 Ga0070665_100480743 3300005548 Bacteria 1253
38 Ga0070704_100176470 3300005549 Bacteria 1705
39 Ga0068855_100001100 3300005563 Bacteria 33596
40 Ga0068855_100011885 3300005563 Bacteria 10526
41 Ga0068855_100070416 3300005563 Bacteria 4069
42 Ga0068857_100098106 3300005577 Bacteria 2628
43 Ga0068854_100235612 3300005578 Bacteria 1455
44 Ga0068856_100282174 3300005614 Bacteria 1677
45 Ga0068856_100298316 3300005614 Bacteria 1629
46 Ga0068852_100009798 3300005616 Bacteria 7123
47 Ga0068852_100079314 3300005616 Bacteria 2908
48 Ga0068851_10000887 3300005834 Bacteria 12923
49 Ga0068863_100458570 3300005841 Bacteria 1251
50 Ga0068858_100014006 3300005842 Bacteria 7566
51 Ga0068858_100045079 3300005842 Bacteria 4086
52 Ga0068860_100101023 3300005843 Bacteria 2752
53 Ga0068862_100011480 3300005844 Bacteria 7312
54 Ga0068862_100050309 3300005844 Bacteria 3561
55 Ga0081455_10132149 3300005937 Bacteria 1950
56 Ga0075370_10049918 3300006353 Bacteria 2373
57 Ga0075428_100307768 3300006844 Bacteria 1703
58 Ga0105240_10280612 3300009093 Bacteria 1914
59 Ga0105240_10334084 3300009093 Bacteria 1723
60 Ga0105243_10058147 3300009148 Bacteria 3081
61 Ga0105241_10007226 3300009174 Bacteria 8174
62 Ga0105242_10000690 3300009176 Bacteria 26481
63 Ga0105242_10105334 3300009176 Bacteria 2395
64 Ga0105242_10293702 3300009176 Bacteria 1481
65 Ga0105248_10085062 3300009177 Bacteria 3559
66 Ga0105248_10145449 3300009177 Bacteria 2675
67 Ga0105238_10005565 3300009551 Bacteria 12445
68 Ga0105238_10013394 3300009551 Bacteria 8278
69 Ga0105238_10168710 3300009551 Bacteria 2165
70 Ga0105249_10462590 3300009553 Bacteria 1309
71 Ga0105249_10871082 3300009553 Bacteria 967
72 Ga0105249_11104270 3300009553 Bacteria 863
73 Ga0105030_100031 3300009987 Bacteria 10823
74 Ga0157370_10170806 3300013104 Bacteria 2021
75 Ga0157369_10003692 3300013105 Bacteria 18189
76 Ga0157369_10304503 3300013105 Bacteria 1657
77 Ga0157374_10000777 3300013296 Bacteria 27941
78 Ga0157378_10015358 3300013297 Bacteria 6706
79 Ga0163162_10031441 3300013306 Bacteria 5265
80 Ga0163162_10355649 3300013306 Bacteria 1597
81 Ga0163162_10409435 3300013306 Bacteria 1489
82 Ga0157372_10002661 3300013307 Bacteria 19355
83 Ga0157372_10013541 3300013307 Bacteria 8717
84 Ga0157372_10092861 3300013307 Bacteria 3433
85 Ga0157380_10792172 3300014326 Bacteria 964
86 Ga0157379_10019642 3300014968 Bacteria 5970
87 Ga0157379_10200601 3300014968 Bacteria 1804
88 Ga0157376_10014493 3300014969 Bacteria 5920
89 Ga0213872_10022606 3300021361 Bacteria 2896
90 Ga0213872_10042218 3300021361 Bacteria 2080
91 Ga0209674_100007 3300025226 Bacteria 1077082
92 Ga0209563_100052 3300025230 Bacteria 334307
93 Ga0207427_100559 3300025231 Bacteria 18903
94 Ga0209646_1000177 3300025246 Bacteria 81778
95 Ga0209026_1000021 3300025250 Bacteria 375165
96 Ga0209677_100015 3300025253 Bacteria 532137
97 Ga0209677_100168 3300025253 Bacteria 56142
98 Ga0209759_1000025 3300025256 Bacteria 317082
99 Ga0209759_1005353 3300025256 Bacteria 4518
100 Ga0209051_1001406 3300025303 Bacteria 20679
101 Ga0207656_10037742 3300025321 Bacteria 2034
102 Ga0207710_10044233 3300025900 Bacteria 1982
103 Ga0207680_10147977 3300025903 Bacteria 1563
104 Ga0207705_10030251 3300025909 Bacteria 3863
105 Ga0207705_10083081 3300025909 Bacteria 2336
106 Ga0207705_10132905 3300025909 Bacteria 1853
107 Ga0207654_10019946 3300025911 Bacteria 3546
108 Ga0207695_10022214 3300025913 Bacteria 7214
109 Ga0207663_10575395 3300025916 Bacteria 883
110 Ga0207662_10026079 3300025918 Bacteria 3370
111 Ga0207657_10097894 3300025919 Bacteria 2438
112 Ga0207652_10015787 3300025921 Bacteria 6152
113 Ga0207694_10036788 3300025924 Bacteria 3757
114 Ga0207644_10054977 3300025931 Bacteria 2868
115 Ga0207690_10037523 3300025932 Bacteria 3146
116 Ga0207690_10175555 3300025932 Bacteria 1609
117 Ga0207686_10013001 3300025934 Bacteria 4594
118 Ga0207686_10016687 3300025934 Bacteria 4124
119 Ga0207686_10088783 3300025934 Bacteria 2036
120 Ga0207709_10037826 3300025935 Bacteria 2869
121 Ga0207704_10003716 3300025938 Bacteria 6942
122 Ga0207711_10117620 3300025941 Bacteria 2370
123 Ga0207711_10130836 3300025941 Bacteria 2250
124 Ga0207661_10035331 3300025944 Bacteria 3894
125 Ga0207667_10008602 3300025949 Bacteria 12112
126 Ga0207667_10038852 3300025949 Bacteria 5077
127 Ga0207667_10390979 3300025949 Bacteria 1416
128 Ga0207667_10719233 3300025949 Bacteria 1000
129 Ga0207712_10062121 3300025961 Bacteria 2654
130 Ga0207658_10195564 3300025986 Bacteria 1684
131 Ga0207677_10049693 3300026023 Bacteria 2832
132 Ga0207703_10008576 3300026035 Bacteria 8069
133 Ga0207703_10053892 3300026035 Bacteria 3270
134 Ga0207639_10001056 3300026041 Bacteria 18695
135 Ga0207639_10138484 3300026041 Bacteria 2025
136 Ga0207702_10058658 3300026078 Bacteria 3276
137 Ga0207702_10529860 3300026078 Bacteria 1150
138 Ga0207702_10910739 3300026078 Bacteria 871
139 Ga0207674_10134335 3300026116 Bacteria 2437
140 Ga0207698_10003147 3300026142 Bacteria 9899
141 Ga0207698_10017184 3300026142 Bacteria 4900
142 Ga0207698_10303415 3300026142 Bacteria 1487
143 Ga0209969_1002004 3300027360 Bacteria 2809
144 Ga0268266_10378842 3300028379 Bacteria 1334
145 Ga0268265_10183390 3300028380 Bacteria 1800
146 Ga0268265_10314509 3300028380 Bacteria 1415
147 Ga0268264_10096145 3300028381 Bacteria 2565
148 Ga0307408_100436015 3300031548 Bacteria 1133
149 Ga0307508_10188522 3300031616 Bacteria 1664
150 Ga0307405_10476938 3300031731 Bacteria 995
151 Ga0307413_10124222 3300031824 Bacteria 1754
152 Ga0307410_10360844 3300031852 Bacteria 1164
153 Ga0307409_100763863 3300031995 Bacteria 971
154 Ga0307411_10583999 3300032005 Bacteria 958
155 Ga0316588_1058156 3300033528 Bacteria 941
156 Ga0373946_0314023 3300035171 Bacteria 777
157 Ga0373931_0012670 3300035691 Bacteria 4089
158 Ga0373931_0036520 3300035691 Bacteria 2561
159 Ga0373931_0112246 3300035691 Bacteria 1548
160 Ga0373947_0153898 3300035725 Bacteria 1483
161 Ga0373925_0086754 3300037068 Bacteria 2388
162 Ga0400484_02551 3300038725 Bacteria 19022
163 Ga0400484_08079 3300038725 Bacteria 2650
164 Ga0400490_17438 3300038726 Bacteria 1170
165 Ga0400490_26467 3300038726 Bacteria 1838
166 Ga0400491_24859 3300038727 Bacteria 3725
167 Ga0400488_46370 3300038741 Bacteria 1814
168 Ga0400483_049650 3300039062 Bacteria 11630
169 Ga0400483_109053 3300039062 Bacteria 1532
170 Ga0400483_283963 3300039062 Bacteria 25039
171 Ga0400487_39628 3300039110 Bacteria 1246
172 Ga0436361_0399943 3300039447 Bacteria 7147
173 Ga0436361_0401003 3300039447 Bacteria 2934
174 Ga0439441_004234 3300042001 Bacteria 2161
175 Ga0439443_029145 3300042003 Bacteria 904
176 Ga0439451_009245 3300042009 Bacteria 1995
177 Ga0439444_0012559 3300042437 Bacteria 1390
178 Ga0439460_0039374 3300042461 Bacteria 1381
179 Ga0451577_0011082 3300042876 Bacteria 8560
180 Ga0451577_0029258 3300042876 Bacteria 4978
181 Ga0451577_0274850 3300042876 Bacteria 1526
182 Ga0453683_0001936 3300044673 Bacteria 16847
183 Ga0453684_0399079 3300044712 Bacteria 1540
184 Ga0451576_0010625 3300045051 Bacteria 10544
185 Ga0451576_0317597 3300045051 Bacteria 1630
186 Ga0495585_0035660 3300046492 Bacteria 2809
187 Ga0496104_0000017 3300048907 Bacteria 325877
188 Ga0496104_0017071 3300048907 Bacteria 6605
189 Ga0496104_0095803 3300048907 Bacteria 2839
190 Ga0496105_0000009 3300048908 Bacteria 325734
191 Ga0496109_0148947 3300048912 Bacteria 2190
192 Ga0496110_0220618 3300048913 Bacteria 1724
193 Ga0496111_0343584 3300048914 Bacteria 1105
194 Ga0501036_0038821 3300049572 Bacteria 4031
195 Ga0501038_0166073 3300049574 Bacteria 1790
196 Ga0501039_0026073 3300049575 Bacteria 4493
197 Ga0501040_0292314 3300049576 Bacteria 1164
198 Ga0501041_0010232 3300049577 Bacteria 5528
199 Ga0501042_0005972 3300049578 Bacteria 7885
200 Ga0501046_0246238 3300049580 Bacteria 1317
201 Ga0501046_0259760 3300049580 Bacteria 1276
202 Ga0501048_0022496 3300049582 Bacteria 4610
203 Ga0501067_0071913 3300049583 Bacteria 1916
204 Ga0501068_0015229 3300049584 Bacteria 4413
205 Ga0501068_0160242 3300049584 Bacteria 1418
206 Ga0501069_0113375 3300049585 Bacteria 1545
207 Ga0501070_0004652 3300049586 Bacteria 11754
208 Ga0501070_0277364 3300049586 Bacteria 1368
209 Ga0501071_0003384 3300049587 Bacteria 9959
210 Ga0501072_0118367 3300049588 Bacteria 2111
211 Ga0501073_0016976 3300049589 Bacteria 5271
212 Ga0501073_0023616 3300049589 Bacteria 4412
213 Ga0501074_0004908 3300049590 Bacteria 9587
214 Ga0501075_0017194 3300049591 Bacteria 5221
215 Ga0501076_0002129 3300049592 Bacteria 13587
216 Ga0501076_0051916 3300049592 Bacteria 3246
217 Ga0501076_0185178 3300049592 Bacteria 1698
218 Ga0501076_0282001 3300049592 Bacteria 1361
219 Ga0501077_0078154 3300049593 Bacteria 2097
220 Ga0501079_0010210 3300049741 Bacteria 7130
221 Ga0501079_0190920 3300049741 Bacteria 1598
222 Ga0501080_0000966 3300049742 Bacteria 23474
223 Ga0501080_0003450 3300049742 Bacteria 13954
224 Ga0501080_0004308 3300049742 Bacteria 12635
225 Ga0501081_0100242 3300049743 Bacteria 2047
226 Ga0501081_0476957 3300049743 Bacteria 928
227 Ga0501083_0078272 3300049744 Bacteria 2193
228 Ga0501083_0104687 3300049744 Bacteria 1864
229 Ga0501035_0341290 3300049822 Bacteria 1255
230 Ga0501035_0647812 3300049822 Bacteria 857
231 Ga0501035_0774915 3300049822 Bacteria 768
232 Ga0501044_0049236 3300049823 Bacteria 4350
233 Ga0501045_0001611 3300049824 Bacteria 15104
234 Ga0501045_0061952 3300049824 Bacteria 2745
235 nmdc:mga0k408_18210_c1 3300050493 Bacteria 3919
236 nmdc:mga07m45_125675_c1 3300050496 Bacteria 1483
237 Ga0501084_0004618 3300054114 Bacteria 11250
238 Ga0501084_0027732 3300054114 Bacteria 4732
239 Ga0501082_0001407 3300060353 Bacteria 21150
240 Ga0501082_0155094 3300060353 Bacteria 1989
241 Ga0530510_0004510 3300061734 Bacteria 9639
242 Ga0530510_0080253 3300061734 Bacteria 2374
243 Ga0530510_0696989 3300061734 Bacteria 774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_17438 Ga0400490_17438_526_1155 177
2 3300006844 Ga0075428_100307768 Ga0075428_1003077683 179
3 3300031824 Ga0307413_10124222 Ga0307413_101242222 179
4 iso_pu_bacteria 2547132512 2548848509 185
5 iso_pu_bacteria 2846033681 2846036198 186
6 iso_pu_bacteria 2846037992 2846039868 186
7 3300005530 Ga0070679_100387058 Ga0070679_1003870582 188
8 3300005539 Ga0068853_100002974 Ga0068853_1000029747 188
9 3300005539 Ga0068853_100539803 Ga0068853_1005398031 188
10 3300005547 Ga0070693_100184377 Ga0070693_1001843772 188
11 3300005614 Ga0068856_100282174 Ga0068856_1002821743 188
12 3300009176 Ga0105242_10293702 Ga0105242_102937022 188
13 3300013104 Ga0157370_10170806 Ga0157370_101708063 188
14 3300013105 Ga0157369_10304503 Ga0157369_103045033 188
15 3300013306 Ga0163162_10031441 Ga0163162_100314412 188
16 3300013307 Ga0157372_10013541 Ga0157372_100135417 188
17 3300014969 Ga0157376_10014493 Ga0157376_100144937 188
18 3300025934 Ga0207686_10016687 Ga0207686_100166872 188
19 3300025938 Ga0207704_10003716 Ga0207704_100037162 188
20 3300025941 Ga0207711_10117620 Ga0207711_101176202 188
21 3300026041 Ga0207639_10001056 Ga0207639_100010564 188
22 3300026078 Ga0207702_10058658 Ga0207702_100586583 188
23 3300048907 Ga0496104_0000017 Ga0496104_0000017_152103_152717 188
24 3300048908 Ga0496105_0000009 Ga0496105_0000009_278739_279353 188
25 3300049592 Ga0501076_0282001 Ga0501076_0282001_391_1005 188
26 3300049822 Ga0501035_0647812 Ga0501035_0647812_20_634 188
27 3300005354 Ga0070675_101111439 Ga0070675_1011114391 189
28 3300005441 Ga0070700_100473362 Ga0070700_1004733622 189
29 3300005841 Ga0068863_100458570 Ga0068863_1004585702 189
30 3300013306 Ga0163162_10409435 Ga0163162_104094352 189
31 3300039062 Ga0400483_109053 Ga0400483_109053_275_883 189
32 3300039110 Ga0400487_39628 Ga0400487_39628_287_895 189
33 3300005327 Ga0070658_10231119 Ga0070658_102311192 190
34 3300005329 Ga0070683_100316135 Ga0070683_1003161353 190
35 3300005335 Ga0070666_10179655 Ga0070666_101796553 190
36 3300005335 Ga0070666_10201072 Ga0070666_102010723 190
37 3300005338 Ga0068868_100239289 Ga0068868_1002392891 190
38 3300005339 Ga0070660_100102226 Ga0070660_1001022262 190
39 3300005343 Ga0070687_100007686 Ga0070687_1000076864 190
40 3300005345 Ga0070692_10450164 Ga0070692_104501641 190
41 3300005355 Ga0070671_100150065 Ga0070671_1001500653 190
42 3300005367 Ga0070667_100113792 Ga0070667_1001137922 190
43 3300005367 Ga0070667_100605327 Ga0070667_1006053271 190
44 3300005444 Ga0070694_100242902 Ga0070694_1002429022 190
45 3300005445 Ga0070708_100561803 Ga0070708_1005618032 190
46 3300005530 Ga0070679_100075753 Ga0070679_1000757532 190
47 3300005535 Ga0070684_100074355 Ga0070684_1000743554 190
48 3300005535 Ga0070684_100318362 Ga0070684_1003183623 190
49 3300005539 Ga0068853_100148849 Ga0068853_1001488491 190
50 3300005546 Ga0070696_100361802 Ga0070696_1003618022 190
51 3300005548 Ga0070665_100480743 Ga0070665_1004807432 190
52 3300005549 Ga0070704_100176470 Ga0070704_1001764702 190
53 3300005563 Ga0068855_100011885 Ga0068855_1000118854 190
54 3300005563 Ga0068855_100070416 Ga0068855_1000704164 190
55 3300005578 Ga0068854_100235612 Ga0068854_1002356123 190
56 3300005614 Ga0068856_100298316 Ga0068856_1002983162 190
57 3300005616 Ga0068852_100009798 Ga0068852_1000097983 190
58 3300005616 Ga0068852_100079314 Ga0068852_1000793142 190
59 3300005834 Ga0068851_10000887 Ga0068851_1000088713 190
60 3300005842 Ga0068858_100014006 Ga0068858_1000140069 190
61 3300005842 Ga0068858_100045079 Ga0068858_1000450792 190
62 3300005843 Ga0068860_100101023 Ga0068860_1001010232 190
63 3300009093 Ga0105240_10334084 Ga0105240_103340843 190
64 3300009174 Ga0105241_10007226 Ga0105241_100072268 190
65 3300009176 Ga0105242_10000690 Ga0105242_1000069027 190
66 3300009176 Ga0105242_10105334 Ga0105242_101053343 190
67 3300009177 Ga0105248_10085062 Ga0105248_100850624 190
68 3300009177 Ga0105248_10145449 Ga0105248_101454492 190
69 3300009551 Ga0105238_10005565 Ga0105238_100055652 190
70 3300009551 Ga0105238_10013394 Ga0105238_100133942 190
71 3300009551 Ga0105238_10168710 Ga0105238_101687102 190
72 3300009553 Ga0105249_10871082 Ga0105249_108710822 190
73 3300009987 Ga0105030_100031 Ga0105030_1000313 190
74 3300013105 Ga0157369_10003692 Ga0157369_1000369216 190
75 3300013296 Ga0157374_10000777 Ga0157374_1000077725 190
76 3300013297 Ga0157378_10015358 Ga0157378_100153584 190
77 3300013306 Ga0163162_10355649 Ga0163162_103556492 190
78 3300013307 Ga0157372_10002661 Ga0157372_1000266110 190
79 3300013307 Ga0157372_10092861 Ga0157372_100928614 190
80 3300014968 Ga0157379_10019642 Ga0157379_100196428 190
81 3300014968 Ga0157379_10200601 Ga0157379_102006013 190
82 3300025321 Ga0207656_10037742 Ga0207656_100377422 190
83 3300025900 Ga0207710_10044233 Ga0207710_100442332 190
84 3300025903 Ga0207680_10147977 Ga0207680_101479772 190
85 3300025909 Ga0207705_10030251 Ga0207705_100302512 190
86 3300025909 Ga0207705_10132905 Ga0207705_101329053 190
87 3300025911 Ga0207654_10019946 Ga0207654_100199462 190
88 3300025916 Ga0207663_10575395 Ga0207663_105753953 190
89 3300025919 Ga0207657_10097894 Ga0207657_100978943 190
90 3300025921 Ga0207652_10015787 Ga0207652_100157874 190
91 3300025924 Ga0207694_10036788 Ga0207694_100367882 190
92 3300025931 Ga0207644_10054977 Ga0207644_100549772 190
93 3300025934 Ga0207686_10013001 Ga0207686_100130014 190
94 3300025934 Ga0207686_10088783 Ga0207686_100887833 190
95 3300025941 Ga0207711_10130836 Ga0207711_101308363 190
96 3300025944 Ga0207661_10035331 Ga0207661_100353312 190
97 3300025949 Ga0207667_10038852 Ga0207667_100388527 190
98 3300025949 Ga0207667_10390979 Ga0207667_103909793 190
99 3300025986 Ga0207658_10195564 Ga0207658_101955642 190
100 3300026023 Ga0207677_10049693 Ga0207677_100496932 190
101 3300026035 Ga0207703_10008576 Ga0207703_100085765 190
102 3300026035 Ga0207703_10053892 Ga0207703_100538924 190
103 3300026041 Ga0207639_10138484 Ga0207639_101384842 190
104 3300026078 Ga0207702_10529860 Ga0207702_105298602 190
105 3300026078 Ga0207702_10910739 Ga0207702_109107392 190
106 3300026142 Ga0207698_10003147 Ga0207698_100031478 190
107 3300026142 Ga0207698_10017184 Ga0207698_100171842 190
108 3300027360 Ga0209969_1002004 Ga0209969_10020044 190
109 3300028379 Ga0268266_10378842 Ga0268266_103788421 190
110 3300028381 Ga0268264_10096145 Ga0268264_100961452 190
111 3300031548 Ga0307408_100436015 Ga0307408_1004360151 190
112 3300031995 Ga0307409_100763863 Ga0307409_1007638633 190
113 3300033528 Ga0316588_1058156 Ga0316588_10581562 190
114 3300035691 Ga0373931_0012670 Ga0373931_0012670_2120_2734 190
115 3300035691 Ga0373931_0112246 Ga0373931_0112246_357_971 190
116 3300035725 Ga0373947_0153898 Ga0373947_0153898_827_1441 190
117 3300042001 Ga0439441_004234 Ga0439441_004234_614_1228 190
118 3300042003 Ga0439443_029145 Ga0439443_029145_158_772 190
119 3300042009 Ga0439451_009245 Ga0439451_009245_243_857 190
120 3300042437 Ga0439444_0012559 Ga0439444_0012559_746_1360 190
121 3300042461 Ga0439460_0039374 Ga0439460_0039374_610_1224 190
122 3300048907 Ga0496104_0095803 Ga0496104_0095803_1774_2388 190
123 3300048913 Ga0496110_0220618 Ga0496110_0220618_848_1462 190
124 3300048914 Ga0496111_0343584 Ga0496111_0343584_399_1013 190
125 3300049572 Ga0501036_0038821 Ga0501036_0038821_2870_3490 190
126 3300049574 Ga0501038_0166073 Ga0501038_0166073_885_1505 190
127 3300049575 Ga0501039_0026073 Ga0501039_0026073_2355_2975 190
128 3300049576 Ga0501040_0292314 Ga0501040_0292314_93_713 190
129 3300049577 Ga0501041_0010232 Ga0501041_0010232_105_725 190
130 3300049578 Ga0501042_0005972 Ga0501042_0005972_567_1187 190
131 3300049580 Ga0501046_0246238 Ga0501046_0246238_470_1090 190
132 3300049580 Ga0501046_0259760 Ga0501046_0259760_476_1096 190
133 3300049582 Ga0501048_0022496 Ga0501048_0022496_1096_1716 190
134 3300049583 Ga0501067_0071913 Ga0501067_0071913_544_1242 190
135 3300049584 Ga0501068_0015229 Ga0501068_0015229_3461_4075 190
136 3300049584 Ga0501068_0160242 Ga0501068_0160242_105_803 190
137 3300049585 Ga0501069_0113375 Ga0501069_0113375_244_942 190
138 3300049586 Ga0501070_0004652 Ga0501070_0004652_5276_6001 190
139 3300049586 Ga0501070_0277364 Ga0501070_0277364_515_1135 190
140 3300049587 Ga0501071_0003384 Ga0501071_0003384_6470_7090 190
141 3300049588 Ga0501072_0118367 Ga0501072_0118367_853_1470 190
142 3300049589 Ga0501073_0016976 Ga0501073_0016976_877_1575 190
143 3300049589 Ga0501073_0023616 Ga0501073_0023616_1518_2132 190
144 3300049590 Ga0501074_0004908 Ga0501074_0004908_7541_8239 190
145 3300049591 Ga0501075_0017194 Ga0501075_0017194_3564_4184 190
146 3300049592 Ga0501076_0002129 Ga0501076_0002129_10066_10686 190
147 3300049592 Ga0501076_0051916 Ga0501076_0051916_1152_1772 190
148 3300049592 Ga0501076_0185178 Ga0501076_0185178_397_1011 190
149 3300049593 Ga0501077_0078154 Ga0501077_0078154_727_1347 190
150 3300049741 Ga0501079_0010210 Ga0501079_0010210_452_1150 190
151 3300049741 Ga0501079_0190920 Ga0501079_0190920_427_1047 190
152 3300049742 Ga0501080_0000966 Ga0501080_0000966_15943_16557 190
153 3300049742 Ga0501080_0003450 Ga0501080_0003450_12294_12914 190
154 3300049742 Ga0501080_0004308 Ga0501080_0004308_3823_4521 190
155 3300049743 Ga0501081_0100242 Ga0501081_0100242_768_1388 190
156 3300049743 Ga0501081_0476957 Ga0501081_0476957_31_651 190
157 3300049744 Ga0501083_0078272 Ga0501083_0078272_225_923 190
158 3300049744 Ga0501083_0104687 Ga0501083_0104687_624_1238 190
159 3300049822 Ga0501035_0341290 Ga0501035_0341290_98_796 190
160 3300049822 Ga0501035_0774915 Ga0501035_0774915_38_664 190
161 3300049823 Ga0501044_0049236 Ga0501044_0049236_3370_4068 190
162 3300049824 Ga0501045_0001611 Ga0501045_0001611_10191_10811 190
163 3300049824 Ga0501045_0061952 Ga0501045_0061952_71_691 190
164 3300054114 Ga0501084_0004618 Ga0501084_0004618_3080_3694 190
165 3300054114 Ga0501084_0027732 Ga0501084_0027732_1127_1747 190
166 3300060353 Ga0501082_0001407 Ga0501082_0001407_5293_5907 190
167 3300060353 Ga0501082_0155094 Ga0501082_0155094_639_1259 190
168 3300061734 Ga0530510_0004510 Ga0530510_0004510_6323_6943 190
169 3300061734 Ga0530510_0080253 Ga0530510_0080253_453_1073 190
170 3300061734 Ga0530510_0696989 Ga0530510_0696989_135_752 190
171 3300031852 Ga0307410_10360844 Ga0307410_103608443 191
172 3300035171 Ga0373946_0314023 Ga0373946_0314023_29_649 191
173 3300037068 Ga0373925_0086754 Ga0373925_0086754_276_896 191
174 3300005338 Ga0068868_100137297 Ga0068868_1001372972 192
175 3300005343 Ga0070687_100086924 Ga0070687_1000869242 192
176 3300014326 Ga0157380_10792172 Ga0157380_107921722 192
177 3300025918 Ga0207662_10026079 Ga0207662_100260792 192
178 3300031731 Ga0307405_10476938 Ga0307405_104769381 192
179 3300032005 Ga0307411_10583999 Ga0307411_105839991 192
180 3300009093 Ga0105240_10280612 Ga0105240_102806121 194
181 3300021361 Ga0213872_10022606 Ga0213872_100226064 194
182 3300021361 Ga0213872_10042218 Ga0213872_100422183 194
183 3300025256 Ga0209759_1005353 Ga0209759_10053534 194
184 3300031616 Ga0307508_10188522 Ga0307508_101885222 194
185 3300039447 Ga0436361_0399943 Ga0436361_0399943_1554_2183 194
186 3300039447 Ga0436361_0401003 Ga0436361_0401003_595_1224 194
187 3300042876 Ga0451577_0011082 Ga0451577_0011082_547_1167 195
188 3300042876 Ga0451577_0274850 Ga0451577_0274850_446_1075 195
189 3300048907 Ga0496104_0017071 Ga0496104_0017071_5791_6411 195
190 3300038725 Ga0400484_02551 Ga0400484_02551_16459_17172 196
191 3300038725 Ga0400484_08079 Ga0400484_08079_868_1581 196
192 3300038726 Ga0400490_26467 Ga0400490_26467_1102_1815 196
193 3300038727 Ga0400491_24859 Ga0400491_24859_2991_3704 196
194 3300038741 Ga0400488_46370 Ga0400488_46370_630_1343 196
195 3300039062 Ga0400483_049650 Ga0400483_049650_10367_11080 196
196 3300039062 Ga0400483_283963 Ga0400483_283963_9510_10223 196
197 3300005844 Ga0068862_100011480 Ga0068862_10001148010 197
198 3300005844 Ga0068862_100050309 Ga0068862_1000503094 197
199 3300005937 Ga0081455_10132149 Ga0081455_101321493 197
200 3300009553 Ga0105249_10462590 Ga0105249_104625902 197
201 3300009553 Ga0105249_11104270 Ga0105249_111042702 197
202 3300025961 Ga0207712_10062121 Ga0207712_100621214 197
203 3300028380 Ga0268265_10183390 Ga0268265_101833901 197
204 3300028380 Ga0268265_10314509 Ga0268265_103145092 197
205 3300042876 Ga0451577_0029258 Ga0451577_0029258_1395_2021 197
206 3300044673 Ga0453683_0001936 Ga0453683_0001936_5632_6258 197
207 3300044712 Ga0453684_0399079 Ga0453684_0399079_581_1207 197
208 3300045051 Ga0451576_0010625 Ga0451576_0010625_5222_5848 197
209 3300050493 nmdc:mga0k408_18210_c1 nmdc:mga0k408_18210_c1_2906_3532 197
210 3300045051 Ga0451576_0317597 Ga0451576_0317597_619_1248 198
211 3300046492 Ga0495585_0035660 Ga0495585_0035660_455_1084 198
212 3300048912 Ga0496109_0148947 Ga0496109_0148947_1139_1768 198
213 3300002705 JGI25156J39149_1000121 JGI25156J39149_100012123 199
214 3300002738 JGI25154J39366_1001256 JGI25154J39366_10012567 199
215 3300002741 JGI25157J39369_1000015 JGI25157J39369_100001546 199
216 3300002772 JGI25164J39214_1003397 JGI25164J39214_10033973 199
217 3300003752 Ga0055539_1000051 Ga0055539_100005178 199
218 3300003752 Ga0055539_1002230 Ga0055539_10022304 199
219 3300003756 Ga0055533_1000025 Ga0055533_1000025122 199
220 3300003759 Ga0055525_1000868 Ga0055525_10008687 199
221 3300005327 Ga0070658_10068784 Ga0070658_100687844 199
222 3300005366 Ga0070659_100078949 Ga0070659_1000789493 199
223 3300005563 Ga0068855_100001100 Ga0068855_10000110033 199
224 3300005577 Ga0068857_100098106 Ga0068857_1000981063 199
225 3300006353 Ga0075370_10049918 Ga0075370_100499183 199
226 3300009148 Ga0105243_10058147 Ga0105243_100581474 199
227 3300025226 Ga0209674_100007 Ga0209674_100007482 199
228 3300025230 Ga0209563_100052 Ga0209563_100052129 199
229 3300025231 Ga0207427_100559 Ga0207427_10055910 199
230 3300025246 Ga0209646_1000177 Ga0209646_100017762 199
231 3300025250 Ga0209026_1000021 Ga0209026_100002147 199
232 3300025253 Ga0209677_100015 Ga0209677_100015309 199
233 3300025253 Ga0209677_100168 Ga0209677_10016835 199
234 3300025256 Ga0209759_1000025 Ga0209759_100002547 199
235 3300025303 Ga0209051_1001406 Ga0209051_10014069 199
236 3300025909 Ga0207705_10083081 Ga0207705_100830812 199
237 3300025913 Ga0207695_10022214 Ga0207695_100222149 199
238 3300025932 Ga0207690_10037523 Ga0207690_100375232 199
239 3300025932 Ga0207690_10175555 Ga0207690_101755552 199
240 3300025935 Ga0207709_10037826 Ga0207709_100378262 199
241 3300025949 Ga0207667_10008602 Ga0207667_100086024 199
242 3300025949 Ga0207667_10719233 Ga0207667_107192332 199
243 3300026116 Ga0207674_10134335 Ga0207674_101343353 199
244 3300026142 Ga0207698_10303415 Ga0207698_103034152 199
245 3300035691 Ga0373931_0036520 Ga0373931_0036520_1004_1636 199
246 3300050496 nmdc:mga07m45_125675_c1 nmdc:mga07m45_125675_c1_434_1066 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02433

FixO

Cytochrome C oxidase, mono-heme subunit/FixO

42

222

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8snh-assembly1.cif.gz_F cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.7399 23 199
5djq-assembly4.cif.gz_L the structure of cbb3 cytochrome oxidase. 0.7293 15 198
6xkw-assembly1.cif.gz_o r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy 0.7129 15 198
5djq-assembly4.cif.gz_L the structure of cbb3 cytochrome oxidase. 0.6678 15 198
8snh-assembly1.cif.gz_F cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.661 23 199
ID Description Score Start End Superfamily
3mk7E02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8015 40 198 1.10.760.10
3mk7E02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7832 40 198 1.10.760.10
1n15B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.3186 37 192 1.10.760.10
af_Q7YX00_22_112_1.10.150.220 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;CPI-17 0.2973 103 181 1.10.150.220
1n15B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.2788 37 192 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7C1TLI8-F1-model_v4 Cytochrome-c oxidase, cbb3-type subunit II 0.9746 123 199 GO:0009055
GO:0020037
AF-A0A4Q3P7K5-F1-model_v4 deleted 0.9743 114 199
AF-A0A356HDG4-F1-model_v4 deleted 0.9701 118 195
AF-A0A4Q3P7K5-F1-model_v4 deleted 0.9634 114 199
AF-A0A1H7CUC5-F1-model_v4 Cytochrome c oxidase cbb3-type subunit 2 0.9329 111 198 GO:0009055
GO:0020037

Feature Viewer

pLDDT pTM Quality
67.82 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map