F358366

General Info

Members Datasets Scaffolds Average Seq Length
246 185 492 107

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_1336988|Ga0451837_1336988_110_499
Length 129
Sequence MRRDVFQAIADPTRRAILTLIALQAMTPNALAEHFDSSRQAVSKHIKILTECQLVKQEQTGREIYYHLNPKKMKEVSDWLEPFRQMWENRFSRLDKVLLNLKNKILITKLFHKNKIKNLYTTTKYKIQI

Samples

Sample ID Description Type Environment
1 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
160 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
161 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
165 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
166 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
180 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
184 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
185 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 0
Rhizoplane 2.85
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451837_1336988 3300041494 Bacteria 620
2 JGI25406J46586_10001486 3300003203 Bacteria 11055
3 rootH2_10001524 3300003320 Bacteria 35747
4 rootH1_10001123 3300003323 Bacteria 32582
5 Ga0055530_10067547 3300003791 Bacteria 779
6 Ga0065165_1061600 3300005262 Bacteria 1026
7 Ga0065714_10103753 3300005288 Bacteria 1597
8 Ga0065712_10348958 3300005290 Bacteria 790
9 Ga0065715_10172284 3300005293 Bacteria 1538
10 Ga0065715_10285074 3300005293 Unclassified 1077
11 Ga0065715_10329710 3300005293 Bacteria 940
12 Ga0065715_10646299 3300005293 Bacteria 681
13 Ga0065707_10571941 3300005295 Bacteria 707
14 Ga0070658_11474347 3300005327 Bacteria 590
15 Ga0070676_10284556 3300005328 Bacteria 1115
16 Ga0070683_100023558 3300005329 Bacteria 5508
17 Ga0070683_100137891 3300005329 Bacteria 2311
18 Ga0070683_100155068 3300005329 Bacteria 2172
19 Ga0070690_100286504 3300005330 Bacteria 1177
20 Ga0070670_100601693 3300005331 Bacteria 984
21 Ga0068869_100307569 3300005334 Bacteria 1282
22 Ga0070666_10213500 3300005335 Bacteria 1359
23 Ga0068868_100025136 3300005338 Bacteria 4524
24 Ga0068868_100401015 3300005338 Bacteria 1184
25 Ga0070660_101751163 3300005339 Bacteria 529
26 Ga0070691_10791104 3300005341 Bacteria 577
27 Ga0070661_100059257 3300005344 Bacteria 2807
28 Ga0070661_100216637 3300005344 Bacteria 1467
29 Ga0070669_100736710 3300005353 Bacteria 834
30 Ga0070675_100226162 3300005354 Bacteria 1631
31 Ga0070675_100234223 3300005354 Bacteria 1603
32 Ga0070675_101290544 3300005354 Bacteria 673
33 Ga0070671_100179906 3300005355 Bacteria 1790
34 Ga0070688_101496095 3300005365 Bacteria 549
35 Ga0070659_100135708 3300005366 Bacteria 2001
36 Ga0070659_101006462 3300005366 Bacteria 732
37 Ga0070667_100041992 3300005367 Bacteria 3836
38 Ga0070667_101286114 3300005367 Bacteria 685
39 Ga0070711_101239589 3300005439 Bacteria 646
40 Ga0070663_100706995 3300005455 Bacteria 857
41 Ga0070662_100710353 3300005457 Bacteria 851
42 Ga0070685_10030341 3300005466 Bacteria 3012
43 Ga0070685_10385989 3300005466 Bacteria 966
44 Ga0070685_10424454 3300005466 Bacteria 926
45 Ga0070684_100023579 3300005535 Bacteria 5151
46 Ga0070684_100138837 3300005535 Bacteria 2197
47 Ga0070684_100151909 3300005535 Bacteria 2098
48 Ga0068853_100648024 3300005539 Bacteria 1005
49 Ga0070672_100077782 3300005543 Bacteria 2654
50 Ga0070672_100457944 3300005543 Bacteria 1099
51 Ga0070686_100496555 3300005544 Bacteria 946
52 Ga0070665_100428468 3300005548 Bacteria 1332
53 Ga0068855_100933428 3300005563 Bacteria 915
54 Ga0070664_100003328 3300005564 Bacteria 12989
55 Ga0070664_100003822 3300005564 Bacteria 12156
56 Ga0068857_100160998 3300005577 Bacteria 2036
57 Ga0068856_100302974 3300005614 Bacteria 1616
58 Ga0068852_100577923 3300005616 Bacteria 1126
59 Ga0068852_100766531 3300005616 Bacteria 977
60 Ga0068852_102502300 3300005616 Bacteria 536
61 Ga0068859_100018162 3300005617 Bacteria 7068
62 Ga0068859_100180239 3300005617 Bacteria 2195
63 Ga0068859_100332277 3300005617 Bacteria 1614
64 Ga0068864_101175595 3300005618 Bacteria 765
65 Ga0068861_102681539 3300005719 Bacteria 503
66 Ga0068851_10279203 3300005834 Bacteria 955
67 Ga0068870_10791782 3300005840 Bacteria 662
68 Ga0068863_100826335 3300005841 Bacteria 925
69 Ga0068858_100152273 3300005842 Bacteria 2175
70 Ga0068860_100342957 3300005843 Bacteria 1469
71 Ga0068862_100131828 3300005844 Bacteria 2211
72 Ga0068862_100460684 3300005844 Bacteria 1200
73 Ga0081539_10000147 3300005985 Bacteria 164274
74 Ga0075370_10986578 3300006353 Bacteria 516
75 Ga0068871_101033591 3300006358 Bacteria 766
76 Ga0075434_101348724 3300006871 Unclassified 724
77 Ga0068865_100910560 3300006881 Unclassified 765
78 Ga0097620_100018163 3300006931 Bacteria 7068
79 Ga0097620_100180249 3300006931 Bacteria 2195
80 Ga0097620_100332233 3300006931 Bacteria 1614
81 Ga0075435_101314819 3300007076 Bacteria 633
82 Ga0105240_10364241 3300009093 Bacteria 1636
83 Ga0111539_11783636 3300009094 Bacteria 714
84 Ga0111539_11945912 3300009094 Bacteria 682
85 Ga0105247_10054503 3300009101 Bacteria 2467
86 Ga0105241_10239923 3300009174 Bacteria 1532
87 Ga0105241_11120771 3300009174 Bacteria 742
88 Ga0105242_10879122 3300009176 Bacteria 894
89 Ga0105248_11617429 3300009177 Bacteria 734
90 Ga0105237_10335432 3300009545 Bacteria 1516
91 Ga0105249_10069462 3300009553 Bacteria 3251
92 Ga0105246_12103842 3300011119 Bacteria 547
93 Ga0157373_10074313 3300013100 Bacteria 2398
94 Ga0157373_10883467 3300013100 Bacteria 662
95 Ga0157370_10243064 3300013104 Bacteria 1665
96 Ga0157370_11012734 3300013104 Bacteria 752
97 Ga0157369_11126343 3300013105 Bacteria 802
98 Ga0157374_10069161 3300013296 Bacteria 3324
99 Ga0157374_10122703 3300013296 Bacteria 2509
100 Ga0157374_10475628 3300013296 Bacteria 1252
101 Ga0163162_10015301 3300013306 Bacteria 7494
102 Ga0163162_10344779 3300013306 Bacteria 1622
103 Ga0163162_10359843 3300013306 Bacteria 1588
104 Ga0163162_10371069 3300013306 Bacteria 1564
105 Ga0157375_10185955 3300013308 Bacteria 2231
106 Ga0163163_10946930 3300014325 Bacteria 924
107 Ga0163163_12372785 3300014325 Bacteria 589
108 Ga0157377_10572664 3300014745 Bacteria 801
109 Ga0157379_11815901 3300014968 Bacteria 599
110 Ga0157376_11066521 3300014969 Bacteria 833
111 Ga0157376_11189936 3300014969 Bacteria 790
112 Ga0163161_10029769 3300017792 Bacteria 3881
113 Ga0163161_10509177 3300017792 Bacteria 981
114 Ga0209050_1000933 3300025298 Bacteria 38256
115 Ga0209050_1003931 3300025298 Bacteria 10510
116 Ga0207426_1121610 3300025302 Bacteria 644
117 Ga0209257_1000005 3300025304 Bacteria 1592528
118 Ga0207656_10226410 3300025321 Bacteria 910
119 Ga0207710_10187161 3300025900 Bacteria 1018
120 Ga0207680_10344753 3300025903 Bacteria 1045
121 Ga0207654_10385772 3300025911 Bacteria 971
122 Ga0207671_10238381 3300025914 Bacteria 1428
123 Ga0207657_10600425 3300025919 Bacteria 859
124 Ga0207657_10715739 3300025919 Bacteria 777
125 Ga0207649_10081679 3300025920 Bacteria 2093
126 Ga0207681_11139580 3300025923 Bacteria 655
127 Ga0207650_10429173 3300025925 Bacteria 1097
128 Ga0207650_10740746 3300025925 Bacteria 831
129 Ga0207650_10972619 3300025925 Bacteria 722
130 Ga0207659_11077675 3300025926 Bacteria 691
131 Ga0207644_10298659 3300025931 Bacteria 1297
132 Ga0207690_10092247 3300025932 Bacteria 2143
133 Ga0207706_10188110 3300025933 Bacteria 1813
134 Ga0207670_10005393 3300025936 Bacteria 7015
135 Ga0207665_10082304 3300025939 Bacteria 2218
136 Ga0207691_10046831 3300025940 Bacteria 3971
137 Ga0207711_10952016 3300025941 Bacteria 797
138 Ga0207689_10876998 3300025942 Bacteria 757
139 Ga0207661_10017541 3300025944 Bacteria 5300
140 Ga0207661_10030793 3300025944 Bacteria 4137
141 Ga0207679_10005268 3300025945 Bacteria 8106
142 Ga0207667_11969109 3300025949 Bacteria 545
143 Ga0207651_10096133 3300025960 Bacteria 2184
144 Ga0207640_10320240 3300025981 Bacteria 1234
145 Ga0207658_10156271 3300025986 Bacteria 1864
146 Ga0207677_12189857 3300026023 Bacteria 514
147 Ga0207703_10083181 3300026035 Bacteria 2673
148 Ga0207703_10272034 3300026035 Bacteria 1535
149 Ga0207678_10265132 3300026067 Bacteria 1472
150 Ga0207702_10283671 3300026078 Bacteria 1567
151 Ga0207641_10178219 3300026088 Bacteria 1945
152 Ga0207641_11165291 3300026088 Bacteria 770
153 Ga0207641_12326179 3300026088 Bacteria 535
154 Ga0207676_10268046 3300026095 Bacteria 1545
155 Ga0207674_10005957 3300026116 Bacteria 14427
156 Ga0207675_100300185 3300026118 Bacteria 1564
157 Ga0207675_101148353 3300026118 Bacteria 797
158 Ga0207698_10017343 3300026142 Bacteria 4882
159 Ga0207698_12017676 3300026142 Bacteria 591
160 Ga0268266_10368231 3300028379 Bacteria 1353
161 Ga0268264_10263547 3300028381 Bacteria 1607
162 Ga0265327_10007073 3300031251 Bacteria 8779
163 Ga0307513_10289567 3300031456 Bacteria 1410
164 Ga0307513_10433994 3300031456 Bacteria 1041
165 Ga0307408_100000524 3300031548 Bacteria 33130
166 Ga0307408_100000749 3300031548 Bacteria 26232
167 Ga0307408_100962784 3300031548 Bacteria 785
168 Ga0307413_11989831 3300031824 Unclassified 523
169 Ga0307410_10269066 3300031852 Bacteria 1332
170 Ga0307410_11208894 3300031852 Bacteria 659
171 Ga0307406_10535702 3300031901 Bacteria 955
172 Ga0307412_10000978 3300031911 Bacteria 16332
173 Ga0307412_10890364 3300031911 Bacteria 779
174 Ga0307409_100223854 3300031995 Bacteria 1700
175 Ga0307416_103628349 3300032002 Bacteria 517
176 Ga0307414_10021144 3300032004 Bacteria 4075
177 Ga0307414_10237838 3300032004 Unclassified 1506
178 Ga0307414_10257669 3300032004 Bacteria 1454
179 Ga0307411_11538559 3300032005 Bacteria 612
180 Ga0307411_11571430 3300032005 Unclassified 606
181 Ga0307415_100562238 3300032126 Bacteria 1008
182 Ga0307415_100834554 3300032126 Bacteria 844
183 Ga0373933_0307052 3300035724 Bacteria 1028
184 Ga0395900_0525709 3300037418 Bacteria 1130
185 Ga0395905_0001159 3300037471 Bacteria 32949
186 Ga0395905_0004326 3300037471 Bacteria 14800
187 Ga0395905_1146172 3300037471 Bacteria 681
188 Ga0395901_0250878 3300038443 Bacteria 1844
189 Ga0451798_0565736 3300041458 Bacteria 607
190 Ga0451800_1253212 3300041459 Bacteria 551
191 Ga0451837_0498402 3300041494 Bacteria 725
192 Ga0451839_1094680 3300041496 Bacteria 602
193 Ga0439431_0000239 3300041997 Bacteria 11153
194 Ga0439433_0074034 3300041999 Bacteria 823
195 Ga0439445_0013679 3300042004 Bacteria 1966
196 Ga0439449_0343696 3300042007 Bacteria 565
197 Ga0439457_039168 3300042014 Bacteria 1055
198 Ga0439462_0100014 3300042015 Bacteria 799
199 Ga0451577_0029297 3300042876 Bacteria 4975
200 Ga0466965_0351143 3300044683 Bacteria 808
201 Ga0453684_0998344 3300044712 Bacteria 890
202 Ga0466960_0095830 3300044901 Bacteria 1520
203 Ga0451576_1786713 3300045051 Bacteria 636
204 Ga0451576_2421060 3300045051 Bacteria 537
205 Ga0466967_0214520 3300045976 Unclassified 1827
206 Ga0495638_0000050 3300046460 Bacteria 206131
207 Ga0495639_0324737 3300046475 Unclassified 770
208 Ga0495663_0000039 3300046525 Bacteria 68141
209 Ga0495656_0250734 3300046615 Bacteria 894
210 Ga0495668_0002132 3300046616 Bacteria 17045
211 Ga0495600_0305063 3300046809 Bacteria 1004
212 Ga0495636_0000001 3300047318 Bacteria 149950
213 Ga0496104_1757079 3300048907 Bacteria 522
214 Ga0496105_0396642 3300048908 Bacteria 1096
215 Ga0496111_0255984 3300048914 Bacteria 1299
216 Ga0496112_1092789 3300048915 Bacteria 716
217 Ga0496113_0863417 3300048916 Bacteria 717
218 Ga0501300_001681 3300049523 Bacteria 3316
219 Ga0501199_050144 3300049650 Bacteria 562
220 Ga0501209_240917 3300049656 Unclassified 564
221 Ga0501217_005691 3300049661 Bacteria 2618
222 Ga0501235_153560 3300049669 Bacteria 598
223 Ga0501238_004946 3300049671 Bacteria 1678
224 Ga0501247_008233 3300049677 Bacteria 1214
225 Ga0501247_064233 3300049677 Bacteria 569
226 Ga0501253_040588 3300049683 Bacteria 935
227 Ga0501257_020142 3300049686 Bacteria 1564
228 Ga0501225_0087915 3300049705 Bacteria 898
229 Ga0501280_030600 3300049776 Bacteria 839
230 nmdc:mga07m45_856707_c1 3300050496 Bacteria 520
231 nmdc:mga0qj67_557899_c1 3300050509 Unclassified 918
232 nmdc:mga08y16_1939523_c1 3300050511 Unclassified 539
233 Ga0500644_0049347 3300053088 Bacteria 1436
234 Ga0500646_0298256 3300053090 Bacteria 577
235 Ga0500583_0403032 3300053092 Bacteria 656
236 Ga0500651_0470347 3300053093 Bacteria 697
237 Ga0500557_031090 3300053105 Bacteria 1617
238 Ga0500642_0128812 3300053130 Bacteria 1186
239 Ga0500655_109412 3300053133 Unclassified 582
240 Ga0500588_0392312 3300053146 Bacteria 529
241 Ga0500616_0000024 3300053153 Bacteria 455811
242 Ga0500616_0169036 3300053153 Bacteria 995
243 Ga0500622_0007108 3300053156 Bacteria 6398
244 Ga0500637_0316571 3300053178 Unclassified 845
245 Ga0500611_000001 3300053727 Bacteria 385744
246 Ga0500645_053320 3300053730 Bacteria 1177
247 Ga0451837_1336988
248 JGI25406J46586_10001486
249 rootH2_10001524
250 rootH1_10001123
251 Ga0055530_10067547
252 Ga0065165_1061600
253 Ga0065714_10103753
254 Ga0065712_10348958
255 Ga0065715_10172284
256 Ga0065715_10285074
257 Ga0065715_10329710
258 Ga0065715_10646299
259 Ga0065707_10571941
260 Ga0070658_11474347
261 Ga0070676_10284556
262 Ga0070683_100023558
263 Ga0070683_100137891
264 Ga0070683_100155068
265 Ga0070690_100286504
266 Ga0070670_100601693
267 Ga0068869_100307569
268 Ga0070666_10213500
269 Ga0068868_100025136
270 Ga0068868_100401015
271 Ga0070660_101751163
272 Ga0070691_10791104
273 Ga0070661_100059257
274 Ga0070661_100216637
275 Ga0070669_100736710
276 Ga0070675_100226162
277 Ga0070675_100234223
278 Ga0070675_101290544
279 Ga0070671_100179906
280 Ga0070688_101496095
281 Ga0070659_100135708
282 Ga0070659_101006462
283 Ga0070667_100041992
284 Ga0070667_101286114
285 Ga0070711_101239589
286 Ga0070663_100706995
287 Ga0070662_100710353
288 Ga0070685_10030341
289 Ga0070685_10385989
290 Ga0070685_10424454
291 Ga0070684_100023579
292 Ga0070684_100138837
293 Ga0070684_100151909
294 Ga0068853_100648024
295 Ga0070672_100077782
296 Ga0070672_100457944
297 Ga0070686_100496555
298 Ga0070665_100428468
299 Ga0068855_100933428
300 Ga0070664_100003328
301 Ga0070664_100003822
302 Ga0068857_100160998
303 Ga0068856_100302974
304 Ga0068852_100577923
305 Ga0068852_100766531
306 Ga0068852_102502300
307 Ga0068859_100018162
308 Ga0068859_100180239
309 Ga0068859_100332277
310 Ga0068864_101175595
311 Ga0068861_102681539
312 Ga0068851_10279203
313 Ga0068870_10791782
314 Ga0068863_100826335
315 Ga0068858_100152273
316 Ga0068860_100342957
317 Ga0068862_100131828
318 Ga0068862_100460684
319 Ga0081539_10000147
320 Ga0075370_10986578
321 Ga0068871_101033591
322 Ga0075434_101348724
323 Ga0068865_100910560
324 Ga0097620_100018163
325 Ga0097620_100180249
326 Ga0097620_100332233
327 Ga0075435_101314819
328 Ga0105240_10364241
329 Ga0111539_11783636
330 Ga0111539_11945912
331 Ga0105247_10054503
332 Ga0105241_10239923
333 Ga0105241_11120771
334 Ga0105242_10879122
335 Ga0105248_11617429
336 Ga0105237_10335432
337 Ga0105249_10069462
338 Ga0105246_12103842
339 Ga0157373_10074313
340 Ga0157373_10883467
341 Ga0157370_10243064
342 Ga0157370_11012734
343 Ga0157369_11126343
344 Ga0157374_10069161
345 Ga0157374_10122703
346 Ga0157374_10475628
347 Ga0163162_10015301
348 Ga0163162_10344779
349 Ga0163162_10359843
350 Ga0163162_10371069
351 Ga0157375_10185955
352 Ga0163163_10946930
353 Ga0163163_12372785
354 Ga0157377_10572664
355 Ga0157379_11815901
356 Ga0157376_11066521
357 Ga0157376_11189936
358 Ga0163161_10029769
359 Ga0163161_10509177
360 Ga0209050_1000933
361 Ga0209050_1003931
362 Ga0207426_1121610
363 Ga0209257_1000005
364 Ga0207656_10226410
365 Ga0207710_10187161
366 Ga0207680_10344753
367 Ga0207654_10385772
368 Ga0207671_10238381
369 Ga0207657_10600425
370 Ga0207657_10715739
371 Ga0207649_10081679
372 Ga0207681_11139580
373 Ga0207650_10429173
374 Ga0207650_10740746
375 Ga0207650_10972619
376 Ga0207659_11077675
377 Ga0207644_10298659
378 Ga0207690_10092247
379 Ga0207706_10188110
380 Ga0207670_10005393
381 Ga0207665_10082304
382 Ga0207691_10046831
383 Ga0207711_10952016
384 Ga0207689_10876998
385 Ga0207661_10017541
386 Ga0207661_10030793
387 Ga0207679_10005268
388 Ga0207667_11969109
389 Ga0207651_10096133
390 Ga0207640_10320240
391 Ga0207658_10156271
392 Ga0207677_12189857
393 Ga0207703_10083181
394 Ga0207703_10272034
395 Ga0207678_10265132
396 Ga0207702_10283671
397 Ga0207641_10178219
398 Ga0207641_11165291
399 Ga0207641_12326179
400 Ga0207676_10268046
401 Ga0207674_10005957
402 Ga0207675_100300185
403 Ga0207675_101148353
404 Ga0207698_10017343
405 Ga0207698_12017676
406 Ga0268266_10368231
407 Ga0268264_10263547
408 Ga0265327_10007073
409 Ga0307513_10289567
410 Ga0307513_10433994
411 Ga0307408_100000524
412 Ga0307408_100000749
413 Ga0307408_100962784
414 Ga0307413_11989831
415 Ga0307410_10269066
416 Ga0307410_11208894
417 Ga0307406_10535702
418 Ga0307412_10000978
419 Ga0307412_10890364
420 Ga0307409_100223854
421 Ga0307416_103628349
422 Ga0307414_10021144
423 Ga0307414_10237838
424 Ga0307414_10257669
425 Ga0307411_11538559
426 Ga0307411_11571430
427 Ga0307415_100562238
428 Ga0307415_100834554
429 Ga0373933_0307052
430 Ga0395900_0525709
431 Ga0395905_0001159
432 Ga0395905_0004326
433 Ga0395905_1146172
434 Ga0395901_0250878
435 Ga0451798_0565736
436 Ga0451800_1253212
437 Ga0451837_0498402
438 Ga0451839_1094680
439 Ga0439431_0000239
440 Ga0439433_0074034
441 Ga0439445_0013679
442 Ga0439449_0343696
443 Ga0439457_039168
444 Ga0439462_0100014
445 Ga0451577_0029297
446 Ga0466965_0351143
447 Ga0453684_0998344
448 Ga0466960_0095830
449 Ga0451576_1786713
450 Ga0451576_2421060
451 Ga0466967_0214520
452 Ga0495638_0000050
453 Ga0495639_0324737
454 Ga0495663_0000039
455 Ga0495656_0250734
456 Ga0495668_0002132
457 Ga0495600_0305063
458 Ga0495636_0000001
459 Ga0496104_1757079
460 Ga0496105_0396642
461 Ga0496111_0255984
462 Ga0496112_1092789
463 Ga0496113_0863417
464 Ga0501300_001681
465 Ga0501199_050144
466 Ga0501209_240917
467 Ga0501217_005691
468 Ga0501235_153560
469 Ga0501238_004946
470 Ga0501247_008233
471 Ga0501247_064233
472 Ga0501253_040588
473 Ga0501257_020142
474 Ga0501225_0087915
475 Ga0501280_030600
476 nmdc:mga07m45_856707_c1
477 nmdc:mga0qj67_557899_c1
478 nmdc:mga08y16_1939523_c1
479 Ga0500644_0049347
480 Ga0500646_0298256
481 Ga0500583_0403032
482 Ga0500651_0470347
483 Ga0500557_031090
484 Ga0500642_0128812
485 Ga0500655_109412
486 Ga0500588_0392312
487 Ga0500616_0000024
488 Ga0500616_0169036
489 Ga0500622_0007108
490 Ga0500637_0316571
491 Ga0500611_000001
492 Ga0500645_053320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

11

57

0.98

PF12840

HTH_20

Helix-turn-helix domain

9

58

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r22-assembly1.cif.gz_B crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form 0.9858 8 70
1r1v-assembly2.cif.gz_B crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the zn2-form 0.9554 7 70
3tgn-assembly1.cif.gz_A crystal structure of the zinc-dependent marr family transcriptional regulator adcr in the zn(ii)-bound state 0.9535 15 72
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9504 8 72
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9496 6 79
ID Description Score Start End Superfamily
1r22B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9858 8 70 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9665 8 83 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 13 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9586 13 69 1.10.10.10
af_P9WMI9_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 9 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6N4EDV7-F1-model_v4 deleted 0.9987 1 78
AF-A0A7C3Q9F5-F1-model_v4 ArsR family transcriptional regulator 0.9909 8 71 GO:0003700
AF-A0A2V7KUH5-F1-model_v4 HTH arsR-type domain-containing protein 0.9887 8 81 GO:0003700
AF-A0A3D3XYX8-F1-model_v4 deleted 0.9879 8 83
AF-A0A6H1WBF7-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9878 8 71 GO:0003700

Map