F358213

General Info

Members Datasets Scaffolds Average Seq Length
246 176 492 364

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1000014|Ga0209025_1000014805
Length 417
Sequence MVEALRVEGCAEELSLCHAVGRVVGRRHDPCKTQEKSRRSSRDGSLSVQMKAGMMSSNTTPFLSIRQVAKNFGAFKALRDINLDIHRGEFVCFLGPSGCGKTTLLRAVAGLDLQDSGTIHMGGRDVSHASPSERDFGIVFQSYALFPNLTVADNVGYGLVNRRRSRDEISKRVSELLALVGLPEQGRKYPVQLSGGQQQRVALARALATSPELLLLDEPLSALDAKVRVRLRDEMRSLQQRLGVTTIMVTHDQEEALAMADRIVVMRDGAVEQVGSPEEIYRRPATPFVADFVGHMTFMDAIVTGPGKVRVDELDLIVANAAPFAVGTPVRLAMRPEEVRTRSIGEDTPNRFEATIGDLAFLGSYCRAHLQPTSSRATSIAADFSTNAMRDLGIVPGQVRAVAFPPEALHVFAGDGR

Samples

Sample ID Description Type Environment
1 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 2643221733 Bosea sp. Root381 Isolate Unclassified
170 2643221734 Bosea sp. Root670 Isolate Unclassified
171 2643221736 Bosea sp. Root483D1 Isolate Unclassified
172 2818991467 Bosea vestrisii 3192 Isolate Unclassified
173 2842694124 Methylopila sp. R-72369 Isolate Unclassified
174 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
175 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
176 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0.41
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 0.41
Rhizoplane 6.5
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209025_1000014 3300025294 Bacteria 865448
2 JGI25151J46595_10000079 3300003187 Bacteria 132415
3 Ga0055526_1002088 3300003771 Bacteria 13714
4 Ga0055524_1000147 3300003775 Bacteria 83426
5 Ga0065165_1000410 3300005262 Bacteria 68475
6 Ga0070676_10093243 3300005328 Bacteria 1848
7 Ga0070690_100177406 3300005330 Bacteria 1470
8 Ga0070670_100061395 3300005331 Bacteria 3227
9 Ga0070670_100250219 3300005331 Bacteria 1544
10 Ga0068869_100010578 3300005334 Bacteria 6022
11 Ga0068869_100071947 3300005334 Bacteria 2561
12 Ga0070682_100030906 3300005337 Bacteria 3236
13 Ga0068868_100037558 3300005338 Bacteria 3755
14 Ga0070687_100000725 3300005343 Bacteria 10957
15 Ga0070661_100002259 3300005344 Bacteria 13203
16 Ga0070671_100014705 3300005355 Bacteria 6324
17 Ga0070671_100082023 3300005355 Bacteria 2696
18 Ga0070674_100025847 3300005356 Bacteria 3827
19 Ga0070673_100013441 3300005364 Bacteria 5663
20 Ga0070667_100007184 3300005367 Bacteria 9255
21 Ga0070701_10020684 3300005438 Bacteria 3127
22 Ga0070711_100055263 3300005439 Bacteria 2742
23 Ga0070705_100017059 3300005440 Bacteria 3783
24 Ga0070700_100059301 3300005441 Bacteria 2408
25 Ga0070708_100013891 3300005445 Bacteria 6613
26 Ga0070708_100039821 3300005445 Bacteria 4114
27 Ga0070663_100113364 3300005455 Bacteria 2040
28 Ga0070678_100213193 3300005456 Bacteria 1601
29 Ga0070662_100079293 3300005457 Bacteria 2441
30 Ga0070706_100010327 3300005467 Bacteria 8673
31 Ga0070706_100035497 3300005467 Bacteria 4604
32 Ga0070706_100102272 3300005467 Bacteria 2663
33 Ga0070707_100133860 3300005468 Bacteria 2411
34 Ga0070698_100000110 3300005471 Bacteria 69016
35 Ga0070698_100013412 3300005471 Bacteria 8674
36 Ga0070698_100121869 3300005471 Bacteria 2566
37 Ga0070699_100030800 3300005518 Bacteria 4632
38 Ga0070699_100324565 3300005518 Bacteria 1384
39 Ga0070684_100022081 3300005535 Bacteria 5303
40 Ga0068853_100084435 3300005539 Bacteria 2782
41 Ga0070672_100068558 3300005543 Bacteria 2814
42 Ga0070672_100198746 3300005543 Bacteria 1676
43 Ga0070695_100057653 3300005545 Bacteria 2510
44 Ga0070665_100345311 3300005548 Bacteria 1493
45 Ga0070704_100092578 3300005549 Bacteria 2257
46 Ga0070664_100009401 3300005564 Bacteria 7926
47 Ga0070664_100215505 3300005564 Bacteria 1716
48 Ga0068857_100087681 3300005577 Bacteria 2784
49 Ga0068856_100179719 3300005614 Bacteria 2129
50 Ga0068852_100025047 3300005616 Bacteria 4829
51 Ga0068859_100022655 3300005617 Bacteria 6297
52 Ga0068864_100006417 3300005618 Bacteria 9642
53 Ga0068864_100025399 3300005618 Bacteria 4988
54 Ga0068864_100252139 3300005618 Bacteria 1639
55 Ga0068861_100000301 3300005719 Bacteria 27687
56 Ga0068861_100153351 3300005719 Bacteria 1893
57 Ga0068851_10006095 3300005834 Bacteria 5500
58 Ga0068851_10009359 3300005834 Bacteria 4552
59 Ga0068870_10025597 3300005840 Bacteria 2931
60 Ga0068870_10052776 3300005840 Bacteria 2157
61 Ga0068863_100036358 3300005841 Bacteria 4691
62 Ga0068863_100102573 3300005841 Bacteria 2720
63 Ga0068858_100022845 3300005842 Bacteria 5833
64 Ga0068858_100027601 3300005842 Bacteria 5273
65 Ga0068860_100028700 3300005843 Bacteria 5356
66 Ga0068860_100213234 3300005843 Bacteria 1873
67 Ga0068862_100025534 3300005844 Bacteria 4960
68 Ga0068862_100042100 3300005844 Bacteria 3889
69 Ga0097621_100221890 3300006237 Bacteria 1647
70 Ga0068865_100026721 3300006881 Bacteria 3807
71 Ga0068865_100161478 3300006881 Bacteria 1710
72 Ga0097620_100022655 3300006931 Bacteria 6297
73 Ga0105245_10039071 3300009098 Bacteria 4224
74 Ga0105247_10070624 3300009101 Bacteria 2182
75 Ga0105247_10149493 3300009101 Bacteria 1538
76 Ga0105243_10098740 3300009148 Bacteria 2419
77 Ga0105242_10032663 3300009176 Bacteria 4163
78 Ga0105248_10012962 3300009177 Bacteria 9190
79 Ga0105248_10031376 3300009177 Bacteria 5940
80 Ga0105248_10070385 3300009177 Bacteria 3928
81 Ga0105248_10131021 3300009177 Bacteria 2829
82 Ga0105248_10278918 3300009177 Bacteria 1882
83 Ga0105238_10149742 3300009551 Bacteria 2309
84 Ga0157373_10170699 3300013100 Bacteria 1530
85 Ga0157371_10001617 3300013102 Bacteria 23054
86 Ga0157374_10025480 3300013296 Bacteria 5311
87 Ga0157374_10076409 3300013296 Bacteria 3167
88 Ga0157378_10020007 3300013297 Bacteria 5885
89 Ga0157378_10056668 3300013297 Bacteria 3492
90 Ga0157378_10091582 3300013297 Bacteria 2765
91 Ga0163162_10072001 3300013306 Bacteria 3511
92 Ga0163162_10186973 3300013306 Bacteria 2198
93 Ga0157372_10118882 3300013307 Bacteria 3033
94 Ga0157372_10142301 3300013307 Bacteria 2764
95 Ga0157372_10201360 3300013307 Bacteria 2306
96 Ga0157375_10462815 3300013308 Bacteria 1433
97 Ga0163163_10088072 3300014325 Bacteria 3116
98 Ga0157377_10008367 3300014745 Bacteria 5043
99 Ga0157379_10005362 3300014968 Bacteria 11022
100 Ga0157379_10018367 3300014968 Bacteria 6165
101 Ga0157376_10132237 3300014969 Bacteria 2228
102 Ga0163161_10010292 3300017792 Bacteria 6478
103 Ga0206354_10597783 3300020081 Bacteria 1565
104 Ga0213872_10052958 3300021361 Bacteria 1841
105 Ga0209130_1000130 3300025284 Bacteria 121749
106 Ga0209675_1001117 3300025291 Bacteria 16355
107 Ga0209025_1001216 3300025294 Bacteria 35947
108 Ga0209564_1000179 3300025295 Bacteria 151032
109 Ga0209256_1000055 3300025299 Bacteria 295530
110 Ga0207697_10005246 3300025315 Bacteria 6041
111 Ga0207656_10018823 3300025321 Bacteria 2723
112 Ga0207682_10000037 3300025893 Bacteria 54103
113 Ga0207647_10044566 3300025904 Bacteria 2771
114 Ga0207699_10140493 3300025906 Bacteria 1587
115 Ga0207645_10006382 3300025907 Bacteria 8471
116 Ga0207645_10011217 3300025907 Bacteria 6128
117 Ga0207643_10000184 3300025908 Bacteria 43056
118 Ga0207643_10078473 3300025908 Bacteria 1910
119 Ga0207684_10035650 3300025910 Bacteria 4225
120 Ga0207684_10096071 3300025910 Bacteria 2529
121 Ga0207662_10083804 3300025918 Bacteria 1949
122 Ga0207657_10033696 3300025919 Bacteria 4614
123 Ga0207657_10246502 3300025919 Bacteria 1425
124 Ga0207649_10064285 3300025920 Bacteria 2319
125 Ga0207681_10147968 3300025923 Bacteria 1756
126 Ga0207681_10167850 3300025923 Bacteria 1661
127 Ga0207650_10007698 3300025925 Bacteria 7339
128 Ga0207650_10009611 3300025925 Bacteria 6613
129 Ga0207650_10052403 3300025925 Bacteria 3022
130 Ga0207687_10019704 3300025927 Bacteria 4472
131 Ga0207644_10008494 3300025931 Bacteria 6720
132 Ga0207644_10028626 3300025931 Bacteria 3859
133 Ga0207644_10362017 3300025931 Bacteria 1180
134 Ga0207706_10027287 3300025933 Bacteria 5107
135 Ga0207709_10232343 3300025935 Bacteria 1336
136 Ga0207709_10241576 3300025935 Bacteria 1314
137 Ga0207670_10006415 3300025936 Bacteria 6522
138 Ga0207704_10113566 3300025938 Bacteria 1837
139 Ga0207691_10002234 3300025940 Bacteria 18960
140 Ga0207691_10052105 3300025940 Bacteria 3739
141 Ga0207691_10166666 3300025940 Bacteria 1930
142 Ga0207711_10016837 3300025941 Bacteria 6070
143 Ga0207689_10007082 3300025942 Bacteria 9858
144 Ga0207689_10007473 3300025942 Bacteria 9580
145 Ga0207651_10016575 3300025960 Bacteria 4322
146 Ga0207658_10049467 3300025986 Bacteria 3089
147 Ga0207703_10009771 3300026035 Bacteria 7526
148 Ga0207703_10024589 3300026035 Bacteria 4738
149 Ga0207678_10034063 3300026067 Bacteria 4436
150 Ga0207708_10004184 3300026075 Bacteria 10608
151 Ga0207702_10089844 3300026078 Bacteria 2687
152 Ga0207641_10016130 3300026088 Bacteria 6118
153 Ga0207648_10012459 3300026089 Bacteria 7961
154 Ga0207648_10015925 3300026089 Bacteria 6890
155 Ga0207676_10008364 3300026095 Bacteria 7354
156 Ga0207676_10021239 3300026095 Bacteria 4763
157 Ga0207676_10344299 3300026095 Bacteria 1377
158 Ga0207674_10003123 3300026116 Bacteria 20429
159 Ga0207674_10050091 3300026116 Bacteria 4268
160 Ga0207674_10100748 3300026116 Bacteria 2870
161 Ga0207675_100000538 3300026118 Bacteria 36903
162 Ga0207675_100006614 3300026118 Bacteria 10962
163 Ga0207698_10093034 3300026142 Bacteria 2474
164 Ga0209974_10002405 3300027876 Bacteria 6782
165 Ga0268265_10017160 3300028380 Bacteria 4989
166 Ga0265330_10001082 3300031235 Bacteria 16406
167 Ga0265332_10004366 3300031238 Bacteria 6650
168 Ga0265329_10001186 3300031242 Bacteria 12780
169 Ga0265339_10106135 3300031249 Bacteria 1458
170 Ga0265331_10000350 3300031250 Bacteria 48905
171 Ga0265327_10006532 3300031251 Bacteria 9284
172 Ga0265316_10038201 3300031344 Bacteria 3870
173 Ga0307416_100048962 3300032002 Bacteria 3357
174 Ga0373943_0005238 3300035170 Bacteria 5834
175 Ga0373931_0071785 3300035691 Bacteria 1892
176 Ga0373927_0043493 3300035695 Bacteria 2908
177 Ga0373927_0046924 3300035695 Bacteria 2794
178 Ga0373947_0004914 3300035725 Bacteria 7819
179 Ga0373937_0011810 3300036401 Bacteria 7667
180 Ga0373937_0090717 3300036401 Bacteria 2830
181 Ga0373925_0014328 3300037068 Bacteria 5736
182 Ga0373925_0130887 3300037068 Bacteria 1956
183 Ga0395900_0137565 3300037418 Bacteria 2503
184 Ga0395898_0065655 3300037466 Bacteria 3518
185 Ga0395898_0149784 3300037466 Bacteria 2233
186 Ga0395901_0317087 3300038443 Bacteria 1614
187 Ga0237816_00811 3300039145 Bacteria 2580
188 Ga0436361_0925527 3300039447 Bacteria 5471
189 Ga0439466_0058417 3300041411 Bacteria 1248
190 Ga0453683_0006314 3300044673 Bacteria 8139
191 Ga0466970_0051268 3300044765 Bacteria 2202
192 Ga0451576_0320037 3300045051 Bacteria 1623
193 Ga0466967_0001897 3300045976 Bacteria 12632
194 Ga0495629_0035092 3300046459 Bacteria 3546
195 Ga0495628_0001546 3300046516 Bacteria 21065
196 Ga0495674_0007885 3300047319 Bacteria 10166
197 Ga0495672_0000658 3300047320 Bacteria 38394
198 Ga0495686_0000029 3300047472 Bacteria 369110
199 Ga0496101_0057420 3300048904 Bacteria 2815
200 Ga0496102_0011487 3300048905 Bacteria 7636
201 Ga0496102_0206698 3300048905 Bacteria 1851
202 Ga0496104_0018089 3300048907 Bacteria 6425
203 Ga0496105_0029541 3300048908 Bacteria 4487
204 Ga0496106_0000592 3300048909 Bacteria 25928
205 Ga0496106_0113646 3300048909 Bacteria 2111
206 Ga0496106_0117325 3300048909 Bacteria 2077
207 Ga0496107_0068160 3300048910 Bacteria 2582
208 Ga0496107_0142379 3300048910 Bacteria 1772
209 Ga0496108_0003376 3300048911 Bacteria 12818
210 Ga0496108_0039348 3300048911 Bacteria 3942
211 Ga0496109_0023170 3300048912 Bacteria 5508
212 Ga0496109_0050077 3300048912 Bacteria 3804
213 Ga0496111_0029452 3300048914 Bacteria 3900
214 Ga0496112_0027758 3300048915 Bacteria 5459
215 Ga0496116_0039494 3300048919 Bacteria 3263
216 Ga0496116_0084300 3300048919 Bacteria 1958
217 Ga0496118_0030774 3300048921 Bacteria 4468
218 Ga0496123_0047587 3300048926 Bacteria 2895
219 Ga0496123_0079652 3300048926 Bacteria 2000
220 Ga0496126_0093580 3300048929 Bacteria 2639
221 Ga0501036_0079128 3300049572 Bacteria 2781
222 Ga0501039_0160245 3300049575 Bacteria 1768
223 Ga0501042_0082682 3300049578 Bacteria 2302
224 Ga0501042_0162532 3300049578 Bacteria 1611
225 Ga0501067_0004199 3300049583 Bacteria 7952
226 Ga0501067_0152232 3300049583 Bacteria 1289
227 Ga0501068_0030897 3300049584 Bacteria 3180
228 Ga0501069_0058831 3300049585 Bacteria 2144
229 Ga0501069_0084235 3300049585 Bacteria 1793
230 Ga0501071_0122297 3300049587 Bacteria 1930
231 Ga0501076_0066908 3300049592 Bacteria 2869
232 Ga0501076_0158682 3300049592 Bacteria 1842
233 Ga0501077_0043677 3300049593 Bacteria 2848
234 Ga0501035_0033981 3300049822 Bacteria 4635
235 Ga0501045_0224139 3300049824 Bacteria 1399
236 nmdc:mga09592_101942_c1 3300050508 Bacteria 2459
237 Ga0500600_0113206 3300053149 Bacteria 1411
238 Ga0501084_0006766 3300054114 Bacteria 9423
239 2644729795 2643221733 Bacteria 5690728
240 2644736028 2643221734 Bacteria 5365412
241 2644746400 2643221736 Bacteria 6608466
242 2819721819 2818991467 Bacteria 5893227
243 2842695204 2842694124 Bacteria 4063419
244 2929203518 2929199973 Bacteria 7260745
245 8055910378 8055909800 Bacteria 7278581
246 8057529705 8057529695 Bacteria 6306553
247 Ga0209025_1000014
248 JGI25151J46595_10000079
249 Ga0055526_1002088
250 Ga0055524_1000147
251 Ga0065165_1000410
252 Ga0070676_10093243
253 Ga0070690_100177406
254 Ga0070670_100061395
255 Ga0070670_100250219
256 Ga0068869_100010578
257 Ga0068869_100071947
258 Ga0070682_100030906
259 Ga0068868_100037558
260 Ga0070687_100000725
261 Ga0070661_100002259
262 Ga0070671_100014705
263 Ga0070671_100082023
264 Ga0070674_100025847
265 Ga0070673_100013441
266 Ga0070667_100007184
267 Ga0070701_10020684
268 Ga0070711_100055263
269 Ga0070705_100017059
270 Ga0070700_100059301
271 Ga0070708_100013891
272 Ga0070708_100039821
273 Ga0070663_100113364
274 Ga0070678_100213193
275 Ga0070662_100079293
276 Ga0070706_100010327
277 Ga0070706_100035497
278 Ga0070706_100102272
279 Ga0070707_100133860
280 Ga0070698_100000110
281 Ga0070698_100013412
282 Ga0070698_100121869
283 Ga0070699_100030800
284 Ga0070699_100324565
285 Ga0070684_100022081
286 Ga0068853_100084435
287 Ga0070672_100068558
288 Ga0070672_100198746
289 Ga0070695_100057653
290 Ga0070665_100345311
291 Ga0070704_100092578
292 Ga0070664_100009401
293 Ga0070664_100215505
294 Ga0068857_100087681
295 Ga0068856_100179719
296 Ga0068852_100025047
297 Ga0068859_100022655
298 Ga0068864_100006417
299 Ga0068864_100025399
300 Ga0068864_100252139
301 Ga0068861_100000301
302 Ga0068861_100153351
303 Ga0068851_10006095
304 Ga0068851_10009359
305 Ga0068870_10025597
306 Ga0068870_10052776
307 Ga0068863_100036358
308 Ga0068863_100102573
309 Ga0068858_100022845
310 Ga0068858_100027601
311 Ga0068860_100028700
312 Ga0068860_100213234
313 Ga0068862_100025534
314 Ga0068862_100042100
315 Ga0097621_100221890
316 Ga0068865_100026721
317 Ga0068865_100161478
318 Ga0097620_100022655
319 Ga0105245_10039071
320 Ga0105247_10070624
321 Ga0105247_10149493
322 Ga0105243_10098740
323 Ga0105242_10032663
324 Ga0105248_10012962
325 Ga0105248_10031376
326 Ga0105248_10070385
327 Ga0105248_10131021
328 Ga0105248_10278918
329 Ga0105238_10149742
330 Ga0157373_10170699
331 Ga0157371_10001617
332 Ga0157374_10025480
333 Ga0157374_10076409
334 Ga0157378_10020007
335 Ga0157378_10056668
336 Ga0157378_10091582
337 Ga0163162_10072001
338 Ga0163162_10186973
339 Ga0157372_10118882
340 Ga0157372_10142301
341 Ga0157372_10201360
342 Ga0157375_10462815
343 Ga0163163_10088072
344 Ga0157377_10008367
345 Ga0157379_10005362
346 Ga0157379_10018367
347 Ga0157376_10132237
348 Ga0163161_10010292
349 Ga0206354_10597783
350 Ga0213872_10052958
351 Ga0209130_1000130
352 Ga0209675_1001117
353 Ga0209025_1001216
354 Ga0209564_1000179
355 Ga0209256_1000055
356 Ga0207697_10005246
357 Ga0207656_10018823
358 Ga0207682_10000037
359 Ga0207647_10044566
360 Ga0207699_10140493
361 Ga0207645_10006382
362 Ga0207645_10011217
363 Ga0207643_10000184
364 Ga0207643_10078473
365 Ga0207684_10035650
366 Ga0207684_10096071
367 Ga0207662_10083804
368 Ga0207657_10033696
369 Ga0207657_10246502
370 Ga0207649_10064285
371 Ga0207681_10147968
372 Ga0207681_10167850
373 Ga0207650_10007698
374 Ga0207650_10009611
375 Ga0207650_10052403
376 Ga0207687_10019704
377 Ga0207644_10008494
378 Ga0207644_10028626
379 Ga0207644_10362017
380 Ga0207706_10027287
381 Ga0207709_10232343
382 Ga0207709_10241576
383 Ga0207670_10006415
384 Ga0207704_10113566
385 Ga0207691_10002234
386 Ga0207691_10052105
387 Ga0207691_10166666
388 Ga0207711_10016837
389 Ga0207689_10007082
390 Ga0207689_10007473
391 Ga0207651_10016575
392 Ga0207658_10049467
393 Ga0207703_10009771
394 Ga0207703_10024589
395 Ga0207678_10034063
396 Ga0207708_10004184
397 Ga0207702_10089844
398 Ga0207641_10016130
399 Ga0207648_10012459
400 Ga0207648_10015925
401 Ga0207676_10008364
402 Ga0207676_10021239
403 Ga0207676_10344299
404 Ga0207674_10003123
405 Ga0207674_10050091
406 Ga0207674_10100748
407 Ga0207675_100000538
408 Ga0207675_100006614
409 Ga0207698_10093034
410 Ga0209974_10002405
411 Ga0268265_10017160
412 Ga0265330_10001082
413 Ga0265332_10004366
414 Ga0265329_10001186
415 Ga0265339_10106135
416 Ga0265331_10000350
417 Ga0265327_10006532
418 Ga0265316_10038201
419 Ga0307416_100048962
420 Ga0373943_0005238
421 Ga0373931_0071785
422 Ga0373927_0043493
423 Ga0373927_0046924
424 Ga0373947_0004914
425 Ga0373937_0011810
426 Ga0373937_0090717
427 Ga0373925_0014328
428 Ga0373925_0130887
429 Ga0395900_0137565
430 Ga0395898_0065655
431 Ga0395898_0149784
432 Ga0395901_0317087
433 Ga0237816_00811
434 Ga0436361_0925527
435 Ga0439466_0058417
436 Ga0453683_0006314
437 Ga0466970_0051268
438 Ga0451576_0320037
439 Ga0466967_0001897
440 Ga0495629_0035092
441 Ga0495628_0001546
442 Ga0495674_0007885
443 Ga0495672_0000658
444 Ga0495686_0000029
445 Ga0496101_0057420
446 Ga0496102_0011487
447 Ga0496102_0206698
448 Ga0496104_0018089
449 Ga0496105_0029541
450 Ga0496106_0000592
451 Ga0496106_0113646
452 Ga0496106_0117325
453 Ga0496107_0068160
454 Ga0496107_0142379
455 Ga0496108_0003376
456 Ga0496108_0039348
457 Ga0496109_0023170
458 Ga0496109_0050077
459 Ga0496111_0029452
460 Ga0496112_0027758
461 Ga0496116_0039494
462 Ga0496116_0084300
463 Ga0496118_0030774
464 Ga0496123_0047587
465 Ga0496123_0079652
466 Ga0496126_0093580
467 Ga0501036_0079128
468 Ga0501039_0160245
469 Ga0501042_0082682
470 Ga0501042_0162532
471 Ga0501067_0004199
472 Ga0501067_0152232
473 Ga0501068_0030897
474 Ga0501069_0058831
475 Ga0501069_0084235
476 Ga0501071_0122297
477 Ga0501076_0066908
478 Ga0501076_0158682
479 Ga0501077_0043677
480 Ga0501035_0033981
481 Ga0501045_0224139
482 nmdc:mga09592_101942_c1
483 Ga0500600_0113206
484 Ga0501084_0006766
485 2644729795
486 2644736028
487 2644746400
488 2819721819
489 2842695204
490 2929203518
491 8055910378
492 8057529705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

78

221

0.95

PF08402

TOBE_2

TOBE domain

332

412

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9565 9 238
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9557 8 238
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9508 7 238
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9492 6 222
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9489 9 239
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9919 6 222 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9829 6 222 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9813 9 221 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9782 9 238 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 9 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9907 9 157 GO:0005524
GO:0016887
AF-A0A4Q3MZI9-F1-model_v4 ATP-binding cassette domain-containing protein 0.9858 6 79 GO:0005524
GO:0005886
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.984 54 196 GO:0005524
GO:0016887
GO:0055052
AF-A0A656JPS2-F1-model_v4 ABC transporter 0.9831 9 157 GO:0005524
GO:0016887
AF-A0A0K8Q7F3-F1-model_v4 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 0.9823 9 122 GO:0005524
GO:0016887
GO:0055052

Map