F358185

General Info

Members Datasets Scaffolds Average Seq Length
246 146 492 138

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11211238|Ga0157375_112112381
Length 163
Sequence LNATLGLLVEGVHYDGKGPSYDDRRRFMNWTLEVVWVPVSDVDHAKAFYAEQLGFNVDHDTQVSEGNRIGQLTPPGSGCSIVIGEGTIAPEMPPGSLKGLQLVVPDIHAAHAQLGERGVEVGEIQVMGENPRPQPDPLDNVGFVFFSDPDGNGWAVQQISARG

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
108 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 2643221692 Nocardia sp. Root136 Isolate Unclassified
141 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
142 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
143 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
144 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
145 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
146 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 4.88
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_11211238 3300013308 Bacteria 886
2 JGI25406J46586_10060723 3300003203 Bacteria 1222
3 rootH2_10188805 3300003320 Bacteria 2050
4 JGI25407J50210_10026513 3300003373 Bacteria 1503
5 JGI25407J50210_10062515 3300003373 Bacteria 934
6 JGI25405J52794_10048383 3300003911 Bacteria 908
7 Ga0070682_101998899 3300005337 Bacteria 510
8 Ga0068868_101192009 3300005338 Bacteria 704
9 Ga0070668_100005361 3300005347 Bacteria 9520
10 Ga0070669_100882327 3300005353 Bacteria 763
11 Ga0070675_100987217 3300005354 Bacteria 773
12 Ga0070674_100131762 3300005356 Bacteria 1865
13 Ga0070674_101355942 3300005356 Bacteria 636
14 Ga0070667_100523779 3300005367 Bacteria 1088
15 Ga0070709_10146174 3300005434 Bacteria 1629
16 Ga0070711_100642483 3300005439 Bacteria 889
17 Ga0070700_100242142 3300005441 Bacteria 1289
18 Ga0070700_100763426 3300005441 Bacteria 775
19 Ga0070678_100405552 3300005456 Bacteria 1185
20 Ga0070662_100952114 3300005457 Bacteria 734
21 Ga0070685_10375780 3300005466 Bacteria 978
22 Ga0070684_100203623 3300005535 Bacteria 1803
23 Ga0068853_101167420 3300005539 Bacteria 743
24 Ga0070665_101431008 3300005548 Bacteria 700
25 Ga0070665_101479663 3300005548 Bacteria 688
26 Ga0070665_102339118 3300005548 Bacteria 537
27 Ga0070664_100546309 3300005564 Bacteria 1071
28 Ga0068852_101296195 3300005616 Bacteria 750
29 Ga0068859_102378327 3300005617 Bacteria 584
30 Ga0068864_101083552 3300005618 Bacteria 797
31 Ga0068861_100289457 3300005719 Bacteria 1414
32 Ga0068861_101964108 3300005719 Bacteria 583
33 Ga0068870_10540871 3300005840 Bacteria 783
34 Ga0068870_10578929 3300005840 Bacteria 760
35 Ga0068863_100123528 3300005841 Bacteria 2470
36 Ga0068858_100104876 3300005842 Bacteria 2638
37 Ga0068860_101283825 3300005843 Bacteria 753
38 Ga0068862_100276046 3300005844 Bacteria 1539
39 Ga0081455_10000056 3300005937 Bacteria 120354
40 Ga0081538_10003116 3300005981 Bacteria 15775
41 Ga0081538_10011766 3300005981 Bacteria 7062
42 Ga0081538_10031535 3300005981 Bacteria 3572
43 Ga0081538_10033107 3300005981 Bacteria 3447
44 Ga0081539_10000173 3300005985 Bacteria 151356
45 Ga0081539_10001399 3300005985 Bacteria 41546
46 Ga0081539_10004070 3300005985 Bacteria 16718
47 Ga0081539_10010360 3300005985 Bacteria 7586
48 Ga0081539_10403577 3300005985 Bacteria 568
49 Ga0097621_101282473 3300006237 Bacteria 691
50 Ga0068871_101372329 3300006358 Bacteria 666
51 Ga0075428_100183926 3300006844 Bacteria 2261
52 Ga0075428_100335922 3300006844 Bacteria 1623
53 Ga0075428_102012538 3300006844 Bacteria 599
54 Ga0075428_102136170 3300006844 Bacteria 579
55 Ga0075430_100850013 3300006846 Bacteria 752
56 Ga0075430_101070628 3300006846 Bacteria 664
57 Ga0075431_100472033 3300006847 Bacteria 1248
58 Ga0075431_100487623 3300006847 Bacteria 1225
59 Ga0075433_10018897 3300006852 Bacteria 5736
60 Ga0075433_10769844 3300006852 Bacteria 842
61 Ga0075434_100276838 3300006871 Bacteria 1697
62 Ga0075434_100722830 3300006871 Bacteria 1013
63 Ga0075434_101622257 3300006871 Bacteria 655
64 Ga0075429_100092955 3300006880 Bacteria 2630
65 Ga0075429_100457719 3300006880 Bacteria 1118
66 Ga0075429_100672389 3300006880 Bacteria 907
67 Ga0075429_100877766 3300006880 Bacteria 785
68 Ga0097620_102377910 3300006931 Bacteria 584
69 Ga0111539_10166931 3300009094 Bacteria 2573
70 Ga0111539_10170897 3300009094 Bacteria 2539
71 Ga0111539_10267682 3300009094 Bacteria 1989
72 Ga0111539_11514390 3300009094 Bacteria 778
73 Ga0111539_12120287 3300009094 Bacteria 652
74 Ga0111539_12646089 3300009094 Bacteria 582
75 Ga0105247_10432665 3300009101 Bacteria 945
76 Ga0114129_10022055 3300009147 Bacteria 9037
77 Ga0114129_10129569 3300009147 Bacteria 3467
78 Ga0114129_10479945 3300009147 Bacteria 1627
79 Ga0114129_10493262 3300009147 Bacteria 1601
80 Ga0114129_11171349 3300009147 Bacteria 959
81 Ga0114129_11208999 3300009147 Bacteria 941
82 Ga0114129_11460111 3300009147 Bacteria 842
83 Ga0114129_11763636 3300009147 Bacteria 754
84 Ga0105243_10118911 3300009148 Bacteria 2224
85 Ga0105243_12355744 3300009148 Bacteria 570
86 Ga0105248_10013661 3300009177 Bacteria 8939
87 Ga0105248_11120899 3300009177 Bacteria 889
88 Ga0105238_10721006 3300009551 Bacteria 1010
89 Ga0105030_106436 3300009987 Bacteria 998
90 Ga0105246_10536317 3300011119 Bacteria 1000
91 Ga0163162_10414312 3300013306 Bacteria 1479
92 Ga0163162_13181947 3300013306 Bacteria 527
93 Ga0157375_10856961 3300013308 Bacteria 1055
94 Ga0163163_10250712 3300014325 Bacteria 1821
95 Ga0163163_11080463 3300014325 Bacteria 865
96 Ga0163163_11087706 3300014325 Bacteria 862
97 Ga0157380_10234284 3300014326 Bacteria 1651
98 Ga0157379_10103362 3300014968 Bacteria 2557
99 Ga0207699_10399904 3300025906 Bacteria 978
100 Ga0207707_10982944 3300025912 Bacteria 693
101 Ga0207657_10836075 3300025919 Bacteria 711
102 Ga0207649_10621097 3300025920 Bacteria 833
103 Ga0207669_10095082 3300025937 Bacteria 1952
104 Ga0207704_10489606 3300025938 Bacteria 989
105 Ga0207704_10787082 3300025938 Bacteria 793
106 Ga0207711_10039744 3300025941 Bacteria 4001
107 Ga0207661_11174060 3300025944 Bacteria 707
108 Ga0207668_10199663 3300025972 Bacteria 1591
109 Ga0207668_11769781 3300025972 Bacteria 558
110 Ga0207677_11053976 3300026023 Bacteria 739
111 Ga0207678_10361631 3300026067 Bacteria 1252
112 Ga0207678_10975744 3300026067 Bacteria 750
113 Ga0207708_10012924 3300026075 Bacteria 6225
114 Ga0207641_10327381 3300026088 Bacteria 1454
115 Ga0207676_10304507 3300026095 Bacteria 1456
116 Ga0207674_10207149 3300026116 Bacteria 1910
117 Ga0207675_102396451 3300026118 Bacteria 540
118 Ga0207683_10742148 3300026121 Bacteria 911
119 Ga0207428_10062273 3300027907 Bacteria 2951
120 Ga0268265_10083418 3300028380 Bacteria 2531
121 Ga0307515_10000167 3300028794 Bacteria 160820
122 Ga0307515_10001347 3300028794 Bacteria 55605
123 Ga0307515_10094137 3300028794 Bacteria 3704
124 Ga0307513_10139564 3300031456 Bacteria 2352
125 Ga0307513_10350557 3300031456 Bacteria 1224
126 Ga0307513_10687533 3300031456 Bacteria 729
127 Ga0307513_10857457 3300031456 Bacteria 615
128 Ga0307509_10240632 3300031507 Bacteria 1603
129 Ga0307509_10321379 3300031507 Bacteria 1284
130 Ga0307509_10343888 3300031507 Bacteria 1218
131 Ga0307408_100089470 3300031548 Bacteria 2321
132 Ga0307516_10000451 3300031730 Bacteria 54345
133 Ga0307516_10000550 3300031730 Bacteria 50318
134 Ga0307516_10014582 3300031730 Bacteria 8307
135 Ga0307516_10039772 3300031730 Bacteria 4685
136 Ga0307516_10111639 3300031730 Bacteria 2535
137 Ga0307516_10364374 3300031730 Bacteria 1109
138 Ga0307405_10126810 3300031731 Bacteria 1756
139 Ga0307405_11187014 3300031731 Bacteria 659
140 Ga0307413_11109309 3300031824 Bacteria 684
141 Ga0307413_11372640 3300031824 Bacteria 621
142 Ga0307410_10452535 3300031852 Bacteria 1048
143 Ga0326468_10000150 3300031889 Bacteria 6707
144 Ga0307406_10080727 3300031901 Bacteria 2160
145 Ga0307406_10847225 3300031901 Bacteria 775
146 Ga0307406_11773362 3300031901 Bacteria 548
147 Ga0307407_10049579 3300031903 Bacteria 2397
148 Ga0307407_10144045 3300031903 Bacteria 1541
149 Ga0307412_10488137 3300031911 Bacteria 1023
150 Ga0307409_100026308 3300031995 Bacteria 4100
151 Ga0307409_100210258 3300031995 Bacteria 1748
152 Ga0307409_100626606 3300031995 Bacteria 1066
153 Ga0307416_100022554 3300032002 Bacteria 4547
154 Ga0307416_100159455 3300032002 Bacteria 2083
155 Ga0307416_100957117 3300032002 Bacteria 958
156 Ga0307416_101139366 3300032002 Bacteria 885
157 Ga0307416_103425788 3300032002 Bacteria 531
158 Ga0307414_10955673 3300032004 Bacteria 787
159 Ga0307415_100017305 3300032126 Bacteria 4320
160 Ga0307415_100240470 3300032126 Bacteria 1464
161 Ga0307415_100470656 3300032126 Bacteria 1091
162 Ga0373951_0000023 3300035091 Bacteria 61297
163 Ga0373927_0548685 3300035695 Bacteria 764
164 Ga0395899_0100328 3300037312 Bacteria 2091
165 Ga0395899_0235870 3300037312 Bacteria 1261
166 Ga0395900_0031060 3300037418 Bacteria 5487
167 Ga0395900_0058264 3300037418 Bacteria 3976
168 Ga0395900_0271778 3300037418 Bacteria 1689
169 Ga0395900_0588346 3300037418 Bacteria 1054
170 Ga0395898_0017026 3300037466 Bacteria 7423
171 Ga0395898_0129438 3300037466 Bacteria 2418
172 Ga0395898_0209527 3300037466 Bacteria 1859
173 Ga0395898_0734025 3300037466 Bacteria 929
174 Ga0395905_0037565 3300037471 Bacteria 4546
175 Ga0395905_0187965 3300037471 Bacteria 1938
176 Ga0395905_0205251 3300037471 Bacteria 1847
177 Ga0395905_0356898 3300037471 Bacteria 1354
178 Ga0395901_0015488 3300038443 Bacteria 7764
179 Ga0395901_0017430 3300038443 Bacteria 7331
180 Ga0395901_0024441 3300038443 Bacteria 6201
181 Ga0395901_0030771 3300038443 Bacteria 5530
182 Ga0451791_0000461 3300041451 Bacteria 648
183 Ga0451797_0654581 3300041453 Bacteria 1058
184 Ga0451795_1037688 3300041456 Bacteria 693
185 Ga0451807_2214942 3300041486 Bacteria 614
186 Ga0451833_0364164 3300041491 Bacteria 824
187 Ga0451835_0710351 3300041492 Bacteria 561
188 Ga0451853_2603535 3300041512 Bacteria 4331
189 Ga0451853_2881391 3300041512 Bacteria 539
190 Ga0439448_0018916 3300042005 Bacteria 2116
191 Ga0439450_039193 3300042008 Bacteria 1094
192 Ga0439455_0013454 3300042012 Bacteria 1853
193 Ga0450890_090490 3300042127 Bacteria 507
194 Ga0439459_0014241 3300042438 Bacteria 1443
195 Ga0439440_0113018 3300042993 Bacteria 749
196 Ga0466972_0012704 3300044658 Bacteria 4228
197 Ga0466965_0225570 3300044683 Bacteria 999
198 Ga0466966_0978953 3300044684 Bacteria 510
199 Ga0466964_0444821 3300044706 Bacteria 686
200 Ga0466970_0192611 3300044765 Bacteria 1133
201 Ga0466970_0252456 3300044765 Bacteria 988
202 Ga0466960_0152945 3300044901 Bacteria 1234
203 Ga0466959_0461908 3300045049 Bacteria 860
204 Ga0466967_2518971 3300045976 Bacteria 509
205 Ga0495664_0779124 3300046477 Bacteria 563
206 Ga0496104_0006114 3300048907 Bacteria 10567
207 Ga0496108_0016207 3300048911 Bacteria 6078
208 Ga0496109_0018665 3300048912 Bacteria 6095
209 Ga0496111_0171025 3300048914 Bacteria 1614
210 Ga0496112_1272224 3300048915 Bacteria 651
211 Ga0496113_0037181 3300048916 Bacteria 3570
212 Ga0496114_0019145 3300048917 Bacteria 5547
213 Ga0496114_1293366 3300048917 Bacteria 616
214 Ga0501036_0756930 3300049572 Bacteria 801
215 Ga0501074_0513308 3300049590 Bacteria 849
216 nmdc:mga03n38_507279_c1 3300050490 Bacteria 678
217 nmdc:mga05p37_1077477_c1 3300050507 Bacteria 844
218 nmdc:mga05p37_1200300_c1 3300050507 Bacteria 784
219 nmdc:mga05p37_1813974_c1 3300050507 Bacteria 588
220 nmdc:mga05p37_38033_c1 3300050507 Bacteria 5902
221 nmdc:mga05p37_731790_c1 3300050507 Bacteria 1094
222 nmdc:mga09592_230049_c1 3300050508 Bacteria 1606
223 nmdc:mga09592_468177_c1 3300050508 Bacteria 1087
224 nmdc:mga09592_615006_c1 3300050508 Bacteria 930
225 nmdc:mga0qj67_102787_c1 3300050509 Bacteria 2304
226 nmdc:mga0qj67_128733_c1 3300050509 Bacteria 2049
227 nmdc:mga06r32_239327_c1 3300050510 Bacteria 1803
228 nmdc:mga08y16_260212_c1 3300050511 Bacteria 1792
229 nmdc:mga08y16_26496_c1 3300050511 Bacteria 6112
230 nmdc:mga08y16_410180_c1 3300050511 Bacteria 1385
231 nmdc:mga0n895_1420467_c1 3300050512 Bacteria 662
232 nmdc:mga0n895_1784254_c1 3300050512 Bacteria 576
233 nmdc:mga0n895_304044_c1 3300050512 Bacteria 1617
234 nmdc:mga0a205_548684_c1 3300050515 Bacteria 1011
235 nmdc:mga0a205_99590_c1 3300050515 Bacteria 2805
236 Ga0500578_0767142 3300053086 Bacteria 513
237 Ga0500579_197463 3300053143 Bacteria 752
238 Ga0501084_1597018 3300054114 Bacteria 545
239 Ga0501084_1728147 3300054114 Bacteria 523
240 2644514322 2643221692 Bacteria 7282860
241 2832007654 2832004796 Bacteria 6538017
242 2866070134 2866065130 Bacteria 6518152
243 2929221415 2929219909 Bacteria 6984360
244 2996226760 2996221748 Bacteria 6799777
245 8003878086 8003870546 Bacteria 7396674
246 8055071843 8055066027 Bacteria 9479577
247 Ga0157375_11211238
248 JGI25406J46586_10060723
249 rootH2_10188805
250 JGI25407J50210_10026513
251 JGI25407J50210_10062515
252 JGI25405J52794_10048383
253 Ga0070682_101998899
254 Ga0068868_101192009
255 Ga0070668_100005361
256 Ga0070669_100882327
257 Ga0070675_100987217
258 Ga0070674_100131762
259 Ga0070674_101355942
260 Ga0070667_100523779
261 Ga0070709_10146174
262 Ga0070711_100642483
263 Ga0070700_100242142
264 Ga0070700_100763426
265 Ga0070678_100405552
266 Ga0070662_100952114
267 Ga0070685_10375780
268 Ga0070684_100203623
269 Ga0068853_101167420
270 Ga0070665_101431008
271 Ga0070665_101479663
272 Ga0070665_102339118
273 Ga0070664_100546309
274 Ga0068852_101296195
275 Ga0068859_102378327
276 Ga0068864_101083552
277 Ga0068861_100289457
278 Ga0068861_101964108
279 Ga0068870_10540871
280 Ga0068870_10578929
281 Ga0068863_100123528
282 Ga0068858_100104876
283 Ga0068860_101283825
284 Ga0068862_100276046
285 Ga0081455_10000056
286 Ga0081538_10003116
287 Ga0081538_10011766
288 Ga0081538_10031535
289 Ga0081538_10033107
290 Ga0081539_10000173
291 Ga0081539_10001399
292 Ga0081539_10004070
293 Ga0081539_10010360
294 Ga0081539_10403577
295 Ga0097621_101282473
296 Ga0068871_101372329
297 Ga0075428_100183926
298 Ga0075428_100335922
299 Ga0075428_102012538
300 Ga0075428_102136170
301 Ga0075430_100850013
302 Ga0075430_101070628
303 Ga0075431_100472033
304 Ga0075431_100487623
305 Ga0075433_10018897
306 Ga0075433_10769844
307 Ga0075434_100276838
308 Ga0075434_100722830
309 Ga0075434_101622257
310 Ga0075429_100092955
311 Ga0075429_100457719
312 Ga0075429_100672389
313 Ga0075429_100877766
314 Ga0097620_102377910
315 Ga0111539_10166931
316 Ga0111539_10170897
317 Ga0111539_10267682
318 Ga0111539_11514390
319 Ga0111539_12120287
320 Ga0111539_12646089
321 Ga0105247_10432665
322 Ga0114129_10022055
323 Ga0114129_10129569
324 Ga0114129_10479945
325 Ga0114129_10493262
326 Ga0114129_11171349
327 Ga0114129_11208999
328 Ga0114129_11460111
329 Ga0114129_11763636
330 Ga0105243_10118911
331 Ga0105243_12355744
332 Ga0105248_10013661
333 Ga0105248_11120899
334 Ga0105238_10721006
335 Ga0105030_106436
336 Ga0105246_10536317
337 Ga0163162_10414312
338 Ga0163162_13181947
339 Ga0157375_10856961
340 Ga0163163_10250712
341 Ga0163163_11080463
342 Ga0163163_11087706
343 Ga0157380_10234284
344 Ga0157379_10103362
345 Ga0207699_10399904
346 Ga0207707_10982944
347 Ga0207657_10836075
348 Ga0207649_10621097
349 Ga0207669_10095082
350 Ga0207704_10489606
351 Ga0207704_10787082
352 Ga0207711_10039744
353 Ga0207661_11174060
354 Ga0207668_10199663
355 Ga0207668_11769781
356 Ga0207677_11053976
357 Ga0207678_10361631
358 Ga0207678_10975744
359 Ga0207708_10012924
360 Ga0207641_10327381
361 Ga0207676_10304507
362 Ga0207674_10207149
363 Ga0207675_102396451
364 Ga0207683_10742148
365 Ga0207428_10062273
366 Ga0268265_10083418
367 Ga0307515_10000167
368 Ga0307515_10001347
369 Ga0307515_10094137
370 Ga0307513_10139564
371 Ga0307513_10350557
372 Ga0307513_10687533
373 Ga0307513_10857457
374 Ga0307509_10240632
375 Ga0307509_10321379
376 Ga0307509_10343888
377 Ga0307408_100089470
378 Ga0307516_10000451
379 Ga0307516_10000550
380 Ga0307516_10014582
381 Ga0307516_10039772
382 Ga0307516_10111639
383 Ga0307516_10364374
384 Ga0307405_10126810
385 Ga0307405_11187014
386 Ga0307413_11109309
387 Ga0307413_11372640
388 Ga0307410_10452535
389 Ga0326468_10000150
390 Ga0307406_10080727
391 Ga0307406_10847225
392 Ga0307406_11773362
393 Ga0307407_10049579
394 Ga0307407_10144045
395 Ga0307412_10488137
396 Ga0307409_100026308
397 Ga0307409_100210258
398 Ga0307409_100626606
399 Ga0307416_100022554
400 Ga0307416_100159455
401 Ga0307416_100957117
402 Ga0307416_101139366
403 Ga0307416_103425788
404 Ga0307414_10955673
405 Ga0307415_100017305
406 Ga0307415_100240470
407 Ga0307415_100470656
408 Ga0373951_0000023
409 Ga0373927_0548685
410 Ga0395899_0100328
411 Ga0395899_0235870
412 Ga0395900_0031060
413 Ga0395900_0058264
414 Ga0395900_0271778
415 Ga0395900_0588346
416 Ga0395898_0017026
417 Ga0395898_0129438
418 Ga0395898_0209527
419 Ga0395898_0734025
420 Ga0395905_0037565
421 Ga0395905_0187965
422 Ga0395905_0205251
423 Ga0395905_0356898
424 Ga0395901_0015488
425 Ga0395901_0017430
426 Ga0395901_0024441
427 Ga0395901_0030771
428 Ga0451791_0000461
429 Ga0451797_0654581
430 Ga0451795_1037688
431 Ga0451807_2214942
432 Ga0451833_0364164
433 Ga0451835_0710351
434 Ga0451853_2603535
435 Ga0451853_2881391
436 Ga0439448_0018916
437 Ga0439450_039193
438 Ga0439455_0013454
439 Ga0450890_090490
440 Ga0439459_0014241
441 Ga0439440_0113018
442 Ga0466972_0012704
443 Ga0466965_0225570
444 Ga0466966_0978953
445 Ga0466964_0444821
446 Ga0466970_0192611
447 Ga0466970_0252456
448 Ga0466960_0152945
449 Ga0466959_0461908
450 Ga0466967_2518971
451 Ga0495664_0779124
452 Ga0496104_0006114
453 Ga0496108_0016207
454 Ga0496109_0018665
455 Ga0496111_0171025
456 Ga0496112_1272224
457 Ga0496113_0037181
458 Ga0496114_0019145
459 Ga0496114_1293366
460 Ga0501036_0756930
461 Ga0501074_0513308
462 nmdc:mga03n38_507279_c1
463 nmdc:mga05p37_1077477_c1
464 nmdc:mga05p37_1200300_c1
465 nmdc:mga05p37_1813974_c1
466 nmdc:mga05p37_38033_c1
467 nmdc:mga05p37_731790_c1
468 nmdc:mga09592_230049_c1
469 nmdc:mga09592_468177_c1
470 nmdc:mga09592_615006_c1
471 nmdc:mga0qj67_102787_c1
472 nmdc:mga0qj67_128733_c1
473 nmdc:mga06r32_239327_c1
474 nmdc:mga08y16_260212_c1
475 nmdc:mga08y16_26496_c1
476 nmdc:mga08y16_410180_c1
477 nmdc:mga0n895_1420467_c1
478 nmdc:mga0n895_1784254_c1
479 nmdc:mga0n895_304044_c1
480 nmdc:mga0a205_548684_c1
481 nmdc:mga0a205_99590_c1
482 Ga0500578_0767142
483 Ga0500579_197463
484 Ga0501084_1597018
485 Ga0501084_1728147
486 2644514322
487 2832007654
488 2866070134
489 2929221415
490 2996226760
491 8003878086
492 8055071843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

156

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8357 2 132
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8262 4 130
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8195 4 130
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8099 2 132
5uhj-assembly2.cif.gz_B-3 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8088 2 128
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8225 1 59 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.819 4 130 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8138 4 130 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8132 4 128 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8123 4 130 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A810M7Q6-F1-model_v4 deleted 0.997 1 135
AF-A0A285L949-F1-model_v4 VOC domain-containing protein 0.9967 1 135
AF-A0A810M7Q6-F1-model_v4 deleted 0.9897 1 135
AF-A0A285L949-F1-model_v4 VOC domain-containing protein 0.9894 1 135
AF-A0A6V8JXJ9-F1-model_v4 VOC domain-containing protein 0.9847 1 135

Map