F358176

General Info

Members Datasets Scaffolds Average Seq Length
246 185 492 250

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10281400|Ga0157372_102814003
Length 285
Sequence LLALRHAFALSCRNPALHGVPTGKRSHFASRESVEDNMRSVLMLLYGAVCYLIFFLAFLYAIAFVGGFAVPLTVDYGRADGDLVRAVVIDLIVLGIFALQHSGMARRGFKRWLTGWLPEPIERSTYVLLSSAALILIFWQWRPLPGVIWDVGTGWAMFGWLVVLTGTFVINHFDLFGLRQVWLAARGTVYTPPEFKDSLYYRIVRHPLMLGFIIAFWAIPRMTAGHLLFTLMTTGYVLIAVRFFEERDLLASHGDSYRQYRRQVPMICPWPRPKRPEKSATGVPG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
101 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
179 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
180 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
181 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
182 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
183 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
184 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
185 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0.41
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0.81
Rhizoplane 7.72
Rhizosphere 84.55
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10281400 3300013307 Bacteria 1934
2 JGI24741J21665_1002338 3300001915 Bacteria 4969
3 rootH1_10205884 3300003323 Bacteria 1845
4 Ga0065707_10009668 3300005295 Bacteria 2806
5 Ga0065707_10084544 3300005295 Bacteria 7078
6 Ga0065707_10101779 3300005295 Bacteria 2845
7 Ga0070658_10207465 3300005327 Bacteria 1655
8 Ga0070690_100120013 3300005330 Bacteria 1764
9 Ga0070680_100040926 3300005336 Bacteria 3756
10 Ga0070691_10132012 3300005341 Bacteria 1266
11 Ga0070687_100314528 3300005343 Bacteria 998
12 Ga0070661_100319686 3300005344 Bacteria 1212
13 Ga0070668_100028172 3300005347 Bacteria 4265
14 Ga0070675_100306292 3300005354 Bacteria 1401
15 Ga0070673_100732748 3300005364 Unclassified 909
16 Ga0070667_100886277 3300005367 Unclassified 830
17 Ga0070714_100002359 3300005435 Bacteria 13888
18 Ga0070714_100650383 3300005435 Bacteria 1015
19 Ga0070713_100244286 3300005436 Bacteria 1636
20 Ga0070710_10001295 3300005437 Bacteria 11839
21 Ga0070701_10045234 3300005438 Bacteria 2258
22 Ga0070711_100000196 3300005439 Bacteria 31936
23 Ga0070705_100210453 3300005440 Unclassified 1340
24 Ga0070663_100292038 3300005455 Unclassified 1302
25 Ga0070681_10176799 3300005458 Bacteria 2057
26 Ga0070685_10134918 3300005466 Bacteria 1547
27 Ga0070685_10172965 3300005466 Bacteria 1385
28 Ga0070706_100357709 3300005467 Unclassified 1361
29 Ga0070707_100006781 3300005468 Bacteria 10603
30 Ga0070707_100395555 3300005468 Unclassified 1342
31 Ga0070698_100002492 3300005471 Bacteria 20291
32 Ga0070679_100188401 3300005530 Bacteria 2033
33 Ga0070679_100600408 3300005530 Bacteria 1044
34 Ga0070684_100762137 3300005535 Bacteria 904
35 Ga0070697_100000378 3300005536 Bacteria 34880
36 Ga0070697_100000460 3300005536 Bacteria 31178
37 Ga0070672_100243860 3300005543 Bacteria 1512
38 Ga0070686_100000171 3300005544 Bacteria 45415
39 Ga0070686_100000175 3300005544 Bacteria 45160
40 Ga0070686_100032620 3300005544 Bacteria 3194
41 Ga0070695_100206723 3300005545 Bacteria 1406
42 Ga0070695_100372705 3300005545 Unclassified 1075
43 Ga0070696_100024357 3300005546 Bacteria 4113
44 Ga0070693_100003644 3300005547 Bacteria 7199
45 Ga0070665_100004599 3300005548 Bacteria 14439
46 Ga0070704_100225875 3300005549 Unclassified 1524
47 Ga0068859_100001210 3300005617 Bacteria 26324
48 Ga0068859_100003934 3300005617 Bacteria 15174
49 Ga0068851_10028397 3300005834 Bacteria 2764
50 Ga0068863_100007168 3300005841 Bacteria 10936
51 Ga0068860_100133181 3300005843 Bacteria 2386
52 Ga0068860_100246845 3300005843 Unclassified 1737
53 Ga0068862_100000111 3300005844 Bacteria 97515
54 Ga0068862_100020929 3300005844 Bacteria 5465
55 Ga0068862_100048312 3300005844 Bacteria 3632
56 Ga0068862_100290373 3300005844 Bacteria 1501
57 Ga0070716_100002515 3300006173 Bacteria 8488
58 Ga0070712_100052653 3300006175 Bacteria 2839
59 Ga0070712_100060286 3300006175 Bacteria 2675
60 Ga0070712_100141437 3300006175 Bacteria 1837
61 Ga0068871_100273315 3300006358 Bacteria 1476
62 Ga0075428_100055152 3300006844 Bacteria 4355
63 Ga0075428_100132392 3300006844 Bacteria 2712
64 Ga0075434_100049132 3300006871 Unclassified 4188
65 Ga0075434_100050755 3300006871 Bacteria 4121
66 Ga0097620_100001210 3300006931 Bacteria 26324
67 Ga0097620_100003933 3300006931 Bacteria 15174
68 Ga0099794_10112513 3300007265 Unclassified 1365
69 Ga0099795_10009806 3300007788 Bacteria 2794
70 Ga0105240_10017243 3300009093 Bacteria 9740
71 Ga0105240_10320996 3300009093 Bacteria 1765
72 Ga0111539_10025792 3300009094 Bacteria 7198
73 Ga0111539_10092714 3300009094 Bacteria 3549
74 Ga0114129_10004397 3300009147 Bacteria 19875
75 Ga0105241_10281388 3300009174 Unclassified 1421
76 Ga0105241_10304443 3300009174 Bacteria 1369
77 Ga0105242_10038041 3300009176 Bacteria 3867
78 Ga0105242_10113834 3300009176 Bacteria 2311
79 Ga0105242_10176894 3300009176 Bacteria 1880
80 Ga0105248_10002901 3300009177 Bacteria 19023
81 Ga0105248_10017910 3300009177 Bacteria 7815
82 Ga0105248_10291915 3300009177 Bacteria 1836
83 Ga0105237_10026002 3300009545 Bacteria 5984
84 Ga0105249_10859937 3300009553 Bacteria 973
85 Ga0099796_10030824 3300010159 Bacteria 1743
86 Ga0157370_10021488 3300013104 Bacteria 6430
87 Ga0157370_10022933 3300013104 Bacteria 6204
88 Ga0157370_10116590 3300013104 Bacteria 2495
89 Ga0157370_10212850 3300013104 Bacteria 1791
90 Ga0163162_10307379 3300013306 Bacteria 1718
91 Ga0157372_10141194 3300013307 Bacteria 2775
92 Ga0157375_10115047 3300013308 Bacteria 2793
93 Ga0157375_10357172 3300013308 Bacteria 1627
94 Ga0163163_11086614 3300014325 Bacteria 863
95 Ga0157380_10228767 3300014326 Bacteria 1669
96 Ga0157380_10675176 3300014326 Bacteria 1034
97 Ga0157379_10605331 3300014968 Bacteria 1023
98 Ga0213873_10007720 3300021358 Bacteria 2166
99 Ga0213876_10013322 3300021384 Bacteria 4370
100 Ga0213876_10050324 3300021384 Bacteria 2201
101 Ga0224712_10166308 3300022467 Bacteria 987
102 Ga0209026_1005170 3300025250 Bacteria 3584
103 Ga0207656_10016076 3300025321 Bacteria 2907
104 Ga0207692_10000279 3300025898 Bacteria 17525
105 Ga0207710_10013428 3300025900 Bacteria 3446
106 Ga0207699_10006351 3300025906 Bacteria 5715
107 Ga0207643_10212969 3300025908 Bacteria 1180
108 Ga0207684_10331076 3300025910 Unclassified 1312
109 Ga0207707_10073864 3300025912 Bacteria 2974
110 Ga0207695_10347842 3300025913 Bacteria 1370
111 Ga0207693_10007610 3300025915 Bacteria 8899
112 Ga0207693_10111254 3300025915 Bacteria 2148
113 Ga0207660_10052979 3300025917 Bacteria 2890
114 Ga0207646_10003776 3300025922 Bacteria 16868
115 Ga0207659_10134124 3300025926 Bacteria 1915
116 Ga0207700_10184930 3300025928 Bacteria 1747
117 Ga0207644_10040969 3300025931 Bacteria 3275
118 Ga0207686_10070082 3300025934 Bacteria 2252
119 Ga0207704_10273627 3300025938 Bacteria 1280
120 Ga0207665_10006559 3300025939 Bacteria 7716
121 Ga0207665_10209165 3300025939 Bacteria 1424
122 Ga0207711_10001488 3300025941 Bacteria 21817
123 Ga0207711_10006255 3300025941 Bacteria 10044
124 Ga0207711_10016014 3300025941 Bacteria 6221
125 Ga0207679_10144485 3300025945 Bacteria 1928
126 Ga0207667_10374535 3300025949 Bacteria 1451
127 Ga0207651_10673733 3300025960 Unclassified 909
128 Ga0207712_10004551 3300025961 Bacteria 8750
129 Ga0207712_10033813 3300025961 Bacteria 3459
130 Ga0207668_10535466 3300025972 Bacteria 1012
131 Ga0207658_10689376 3300025986 Unclassified 923
132 Ga0207703_10428511 3300026035 Bacteria 1232
133 Ga0207641_10011594 3300026088 Bacteria 7235
134 Ga0207674_10310344 3300026116 Bacteria 1527
135 Ga0207428_10053716 3300027907 Bacteria 3212
136 Ga0268266_10006922 3300028379 Bacteria 10318
137 Ga0268265_10000122 3300028380 Bacteria 97524
138 Ga0307513_10157569 3300031456 Bacteria 2168
139 Ga0307513_10315392 3300031456 Bacteria 1324
140 Ga0373929_0054090 3300035085 Bacteria 924
141 Ga0373939_0040617 3300035114 Bacteria 1398
142 Ga0373941_0100526 3300035115 Bacteria 1006
143 Ga0373943_0126127 3300035170 Bacteria 1365
144 Ga0373955_0331910 3300035172 Bacteria 920
145 Ga0373931_0027629 3300035691 Bacteria 2898
146 Ga0373935_0045125 3300035692 Bacteria 2780
147 Ga0373925_0027906 3300037068 Bacteria 4133
148 Ga0373925_0219564 3300037068 Bacteria 1517
149 Ga0395900_0005287 3300037418 Bacteria 13533
150 Ga0436365_0368292 3300039437 Bacteria 20050
151 Ga0436362_0740322 3300039453 Bacteria 5362
152 Ga0450908_021990 3300042184 Bacteria 1118
153 Ga0439435_0000567 3300042436 Bacteria 5973
154 Ga0466963_0226414 3300044694 Bacteria 1310
155 Ga0466968_0002347 3300044735 Bacteria 6920
156 Ga0495641_0043423 3300046461 Bacteria 2079
157 Ga0495651_0126689 3300046462 Bacteria 1869
158 Ga0495583_0002212 3300046506 Bacteria 17211
159 Ga0495618_0008560 3300046514 Bacteria 6178
160 Ga0495620_0005813 3300046515 Bacteria 6848
161 Ga0495630_0049702 3300046517 Bacteria 3138
162 Ga0495652_0022470 3300046529 Bacteria 5597
163 Ga0495654_0001643 3300046530 Bacteria 15140
164 Ga0495640_0055800 3300046533 Bacteria 2702
165 Ga0495640_0067599 3300046533 Bacteria 2406
166 Ga0495640_0091946 3300046533 Bacteria 2002
167 Ga0495587_0057779 3300046536 Bacteria 2280
168 Ga0495668_0052597 3300046616 Bacteria 2253
169 Ga0495635_0217080 3300046663 Unclassified 1294
170 Ga0495657_0057722 3300046675 Bacteria 2580
171 Ga0495649_0152423 3300046694 Bacteria 1214
172 Ga0495674_0025064 3300047319 Bacteria 5474
173 Ga0495680_0025572 3300047322 Bacteria 4883
174 Ga0495675_0255713 3300047444 Bacteria 1051
175 Ga0495684_0012792 3300047471 Bacteria 6475
176 Ga0495602_0011266 3300048088 Bacteria 9248
177 Ga0496101_0093573 3300048904 Bacteria 2239
178 Ga0496102_0064605 3300048905 Bacteria 3352
179 Ga0496102_0539625 3300048905 Bacteria 1089
180 Ga0496103_0049824 3300048906 Bacteria 2590
181 Ga0496104_0023547 3300048907 Bacteria 5662
182 Ga0496104_0075778 3300048907 Bacteria 3203
183 Ga0496104_0377118 3300048907 Bacteria 1331
184 Ga0496105_0241785 3300048908 Bacteria 1465
185 Ga0496105_0355642 3300048908 Bacteria 1169
186 Ga0496106_0054426 3300048909 Bacteria 3023
187 Ga0496107_0228955 3300048910 Bacteria 1383
188 Ga0496108_0368587 3300048911 Bacteria 1254
189 Ga0496109_0467273 3300048912 Bacteria 1191
190 Ga0496110_0221760 3300048913 Bacteria 1719
191 Ga0496112_0143416 3300048915 Bacteria 2357
192 Ga0496114_0011924 3300048917 Bacteria 6955
193 Ga0496115_0115170 3300048918 Bacteria 2210
194 Ga0496115_0123245 3300048918 Bacteria 2134
195 Ga0496115_0215187 3300048918 Bacteria 1586
196 Ga0496121_0136552 3300048924 Bacteria 1826
197 Ga0496126_0340889 3300048929 Bacteria 1228
198 Ga0501033_0132366 3300049570 Bacteria 1806
199 Ga0501034_0131114 3300049571 Bacteria 2490
200 Ga0501034_0501829 3300049571 Bacteria 1127
201 Ga0501037_0040838 3300049573 Bacteria 3413
202 Ga0501038_0037476 3300049574 Bacteria 4251
203 Ga0501041_0138623 3300049577 Bacteria 1516
204 Ga0501042_0207337 3300049578 Bacteria 1413
205 Ga0501043_0122389 3300049579 Bacteria 2041
206 Ga0501043_0380766 3300049579 Bacteria 1068
207 Ga0501047_0011525 3300049581 Bacteria 8369
208 Ga0501069_0004327 3300049585 Bacteria 7336
209 Ga0501070_0017750 3300049586 Bacteria 5975
210 Ga0501070_0229896 3300049586 Bacteria 1520
211 Ga0501073_0042539 3300049589 Bacteria 3206
212 Ga0501074_0002438 3300049590 Bacteria 12974
213 Ga0501074_0029046 3300049590 Bacteria 4005
214 Ga0501074_0045696 3300049590 Bacteria 3167
215 Ga0501075_0173320 3300049591 Bacteria 1646
216 Ga0501076_0008639 3300049592 Bacteria 7475
217 Ga0501080_0005703 3300049742 Bacteria 11138
218 Ga0501080_0007364 3300049742 Bacteria 9930
219 Ga0501035_0053498 3300049822 Bacteria 3610
220 Ga0501035_0078400 3300049822 Bacteria 2918
221 Ga0501044_0005421 3300049823 Bacteria 14168
222 Ga0501044_0050891 3300049823 Bacteria 4273
223 nmdc:mga06z11_259035_c1 3300050494 Bacteria 1026
224 nmdc:mga05p37_2691_c1 3300050507 Bacteria 20669
225 nmdc:mga0qj67_103094_c1 3300050509 Bacteria 2301
226 nmdc:mga08y16_296554_c1 3300050511 Bacteria 1667
227 nmdc:mga0n895_28678_c1 3300050512 Bacteria 5298
228 nmdc:mga0n895_37397_c1 3300050512 Unclassified 4695
229 nmdc:mga08x19_194680_c1 3300050514 Bacteria 1388
230 Ga0495601_0020426 3300053077 Bacteria 4045
231 Ga0495612_0005114 3300053078 Bacteria 5423
232 Ga0500595_004124 3300053119 Bacteria 6590
233 Ga0500595_006834 3300053119 Bacteria 4801
234 Ga0500595_008307 3300053119 Bacteria 4249
235 Ga0500595_034250 3300053119 Bacteria 1681
236 Ga0500559_0009694 3300053136 Bacteria 4158
237 Ga0500645_044492 3300053730 Bacteria 1306
238 Ga0501084_0405702 3300054114 Bacteria 1152
239 2545678928 2545555834 Bacteria 8130841
240 2808980344 2808606385 Bacteria 6711065
241 2808996065 2808606388 Bacteria 6706662
242 2852613941 2852612431 Bacteria 6885235
243 2852668322 2852667396 Bacteria 6885555
244 2889309755 2889306138 Bacteria 6358934
245 2902814110 2902810491 Bacteria 6794147
246 641646514 641522639 Bacteria 7737025
247 Ga0157372_10281400
248 JGI24741J21665_1002338
249 rootH1_10205884
250 Ga0065707_10009668
251 Ga0065707_10084544
252 Ga0065707_10101779
253 Ga0070658_10207465
254 Ga0070690_100120013
255 Ga0070680_100040926
256 Ga0070691_10132012
257 Ga0070687_100314528
258 Ga0070661_100319686
259 Ga0070668_100028172
260 Ga0070675_100306292
261 Ga0070673_100732748
262 Ga0070667_100886277
263 Ga0070714_100002359
264 Ga0070714_100650383
265 Ga0070713_100244286
266 Ga0070710_10001295
267 Ga0070701_10045234
268 Ga0070711_100000196
269 Ga0070705_100210453
270 Ga0070663_100292038
271 Ga0070681_10176799
272 Ga0070685_10134918
273 Ga0070685_10172965
274 Ga0070706_100357709
275 Ga0070707_100006781
276 Ga0070707_100395555
277 Ga0070698_100002492
278 Ga0070679_100188401
279 Ga0070679_100600408
280 Ga0070684_100762137
281 Ga0070697_100000378
282 Ga0070697_100000460
283 Ga0070672_100243860
284 Ga0070686_100000171
285 Ga0070686_100000175
286 Ga0070686_100032620
287 Ga0070695_100206723
288 Ga0070695_100372705
289 Ga0070696_100024357
290 Ga0070693_100003644
291 Ga0070665_100004599
292 Ga0070704_100225875
293 Ga0068859_100001210
294 Ga0068859_100003934
295 Ga0068851_10028397
296 Ga0068863_100007168
297 Ga0068860_100133181
298 Ga0068860_100246845
299 Ga0068862_100000111
300 Ga0068862_100020929
301 Ga0068862_100048312
302 Ga0068862_100290373
303 Ga0070716_100002515
304 Ga0070712_100052653
305 Ga0070712_100060286
306 Ga0070712_100141437
307 Ga0068871_100273315
308 Ga0075428_100055152
309 Ga0075428_100132392
310 Ga0075434_100049132
311 Ga0075434_100050755
312 Ga0097620_100001210
313 Ga0097620_100003933
314 Ga0099794_10112513
315 Ga0099795_10009806
316 Ga0105240_10017243
317 Ga0105240_10320996
318 Ga0111539_10025792
319 Ga0111539_10092714
320 Ga0114129_10004397
321 Ga0105241_10281388
322 Ga0105241_10304443
323 Ga0105242_10038041
324 Ga0105242_10113834
325 Ga0105242_10176894
326 Ga0105248_10002901
327 Ga0105248_10017910
328 Ga0105248_10291915
329 Ga0105237_10026002
330 Ga0105249_10859937
331 Ga0099796_10030824
332 Ga0157370_10021488
333 Ga0157370_10022933
334 Ga0157370_10116590
335 Ga0157370_10212850
336 Ga0163162_10307379
337 Ga0157372_10141194
338 Ga0157375_10115047
339 Ga0157375_10357172
340 Ga0163163_11086614
341 Ga0157380_10228767
342 Ga0157380_10675176
343 Ga0157379_10605331
344 Ga0213873_10007720
345 Ga0213876_10013322
346 Ga0213876_10050324
347 Ga0224712_10166308
348 Ga0209026_1005170
349 Ga0207656_10016076
350 Ga0207692_10000279
351 Ga0207710_10013428
352 Ga0207699_10006351
353 Ga0207643_10212969
354 Ga0207684_10331076
355 Ga0207707_10073864
356 Ga0207695_10347842
357 Ga0207693_10007610
358 Ga0207693_10111254
359 Ga0207660_10052979
360 Ga0207646_10003776
361 Ga0207659_10134124
362 Ga0207700_10184930
363 Ga0207644_10040969
364 Ga0207686_10070082
365 Ga0207704_10273627
366 Ga0207665_10006559
367 Ga0207665_10209165
368 Ga0207711_10001488
369 Ga0207711_10006255
370 Ga0207711_10016014
371 Ga0207679_10144485
372 Ga0207667_10374535
373 Ga0207651_10673733
374 Ga0207712_10004551
375 Ga0207712_10033813
376 Ga0207668_10535466
377 Ga0207658_10689376
378 Ga0207703_10428511
379 Ga0207641_10011594
380 Ga0207674_10310344
381 Ga0207428_10053716
382 Ga0268266_10006922
383 Ga0268265_10000122
384 Ga0307513_10157569
385 Ga0307513_10315392
386 Ga0373929_0054090
387 Ga0373939_0040617
388 Ga0373941_0100526
389 Ga0373943_0126127
390 Ga0373955_0331910
391 Ga0373931_0027629
392 Ga0373935_0045125
393 Ga0373925_0027906
394 Ga0373925_0219564
395 Ga0395900_0005287
396 Ga0436365_0368292
397 Ga0436362_0740322
398 Ga0450908_021990
399 Ga0439435_0000567
400 Ga0466963_0226414
401 Ga0466968_0002347
402 Ga0495641_0043423
403 Ga0495651_0126689
404 Ga0495583_0002212
405 Ga0495618_0008560
406 Ga0495620_0005813
407 Ga0495630_0049702
408 Ga0495652_0022470
409 Ga0495654_0001643
410 Ga0495640_0055800
411 Ga0495640_0067599
412 Ga0495640_0091946
413 Ga0495587_0057779
414 Ga0495668_0052597
415 Ga0495635_0217080
416 Ga0495657_0057722
417 Ga0495649_0152423
418 Ga0495674_0025064
419 Ga0495680_0025572
420 Ga0495675_0255713
421 Ga0495684_0012792
422 Ga0495602_0011266
423 Ga0496101_0093573
424 Ga0496102_0064605
425 Ga0496102_0539625
426 Ga0496103_0049824
427 Ga0496104_0023547
428 Ga0496104_0075778
429 Ga0496104_0377118
430 Ga0496105_0241785
431 Ga0496105_0355642
432 Ga0496106_0054426
433 Ga0496107_0228955
434 Ga0496108_0368587
435 Ga0496109_0467273
436 Ga0496110_0221760
437 Ga0496112_0143416
438 Ga0496114_0011924
439 Ga0496115_0115170
440 Ga0496115_0123245
441 Ga0496115_0215187
442 Ga0496121_0136552
443 Ga0496126_0340889
444 Ga0501033_0132366
445 Ga0501034_0131114
446 Ga0501034_0501829
447 Ga0501037_0040838
448 Ga0501038_0037476
449 Ga0501041_0138623
450 Ga0501042_0207337
451 Ga0501043_0122389
452 Ga0501043_0380766
453 Ga0501047_0011525
454 Ga0501069_0004327
455 Ga0501070_0017750
456 Ga0501070_0229896
457 Ga0501073_0042539
458 Ga0501074_0002438
459 Ga0501074_0029046
460 Ga0501074_0045696
461 Ga0501075_0173320
462 Ga0501076_0008639
463 Ga0501080_0005703
464 Ga0501080_0007364
465 Ga0501035_0053498
466 Ga0501035_0078400
467 Ga0501044_0005421
468 Ga0501044_0050891
469 nmdc:mga06z11_259035_c1
470 nmdc:mga05p37_2691_c1
471 nmdc:mga0qj67_103094_c1
472 nmdc:mga08y16_296554_c1
473 nmdc:mga0n895_28678_c1
474 nmdc:mga0n895_37397_c1
475 nmdc:mga08x19_194680_c1
476 Ga0495601_0020426
477 Ga0495612_0005114
478 Ga0500595_004124
479 Ga0500595_006834
480 Ga0500595_008307
481 Ga0500595_034250
482 Ga0500559_0009694
483 Ga0500645_044492
484 Ga0501084_0405702
485 2545678928
486 2808980344
487 2808996065
488 2852613941
489 2852668322
490 2889309755
491 2902814110
492 641646514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

91

266

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.3923 15 241
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.3659 15 241
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3451 5 240
2xm4-assembly1.cif.gz_A cytochrome c prime from alcaligenes xylosoxidans: ferrous r124e variant 0.3349 44 158
4d4n-assembly1.cif.gz_A-2 nitrosyl complex of the d121a variant of cytochrome c prime from alcaligenes xylosoxidans 0.3309 44 158
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.981 49 241 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9761 49 241 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8348 51 210 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8109 51 211 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8077 51 210 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A0E4BNP2-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9845 3 221 GO:0008168
GO:0016020
GO:0032259
AF-A0A6I6SQV3-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9843 3 241 GO:0008168
GO:0016020
GO:0032259
AF-A0A4V0I8P4-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9841 2 244 GO:0008168
GO:0016020
GO:0032259
AF-A0A1A3CI96-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.984 1 242 GO:0008168
GO:0016020
GO:0032259
AF-C6XRI9-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9828 3 240 GO:0008168
GO:0016020
GO:0032259

Map