F357285

General Info

Members Datasets Scaffolds Average Seq Length
245 142 490 645

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10032492|Ga0105240_100324922
Length 679
Sequence VFSFTFAFINESFVIMFTRWRIPKTIQWIIKLLIIYLCIFTAFRIATVICFKPAGLSVFELIPSFILGVQYDLRWIAIVLLPIACLSLFPKFSPFYSERSKKAWTFYLAFVTLILLFFFGADFGHFAYVSTRLNASALNFAEDAGISFEMLWQSYPMVWILAGLAGAVIMMAWMFRRMHVSVEEQNVNMHKFSYRKRWHGVIIILLAWFVFGFMSLKPLKWSDAFKMNDNFKSYLALNPFQNFVTTLRFRKPVFNLEKSKEYYPVISDFLQLDKSNAQTNGYERTINPVSHSLESQPNIVLVICESFSMYKSSMSGNPLNSTPYFNDLCKQGIFFDRCFSPTFGTARGVFAILSGIPDVQLSKFSTRNEQSLNQYTIVNGFEGYNKYYFLGGNSDFNNXKGFISNINNVNIYDQAKSSAPPLNVWGISDKNLFLEADKVMKAETKPFFTIIQTSDNHRPYSIPKEDDDFKVPVYNDDSLKRYGFESQDEFAAFCYTDYCYKKFIETAKQSPYFNNTIFVFVGDHGVEGNADAMYPQAWTEQRLSDEHIPLLFYAPALLSPQKRNETVSQIDILPTIAGMIHQPYTNKTLGRDLLNLKNKEDAAFIIHHDEGKIGVVSDDYFYSKNLWINKEELVPIKQGLPALTVSQEDSVRQHLSELTSAFYETARWMLVNNHRTSGQ

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
132 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
142 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0
Rhizosphere 98.78
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10032492 3300009093 Bacteria 6756
2 JGI24751J29686_10001771 3300002459 Bacteria 4435
3 Ga0065712_10003540 3300005290 Bacteria 6528
4 Ga0065712_10011327 3300005290 Bacteria 2241
5 Ga0065707_10101656 3300005295 Bacteria 2853
6 Ga0070658_10029945 3300005327 Bacteria 4374
7 Ga0070676_10002678 3300005328 Bacteria 9172
8 Ga0070676_10034817 3300005328 Bacteria 2893
9 Ga0070683_100011034 3300005329 Bacteria 7788
10 Ga0070670_100010892 3300005331 Bacteria 7768
11 Ga0070670_100054793 3300005331 Bacteria 3423
12 Ga0070670_100054859 3300005331 Bacteria 3422
13 Ga0068869_100018546 3300005334 Bacteria 4737
14 Ga0068869_100026642 3300005334 Bacteria 4025
15 Ga0068869_100090860 3300005334 Unclassified 2296
16 Ga0070680_100018467 3300005336 Bacteria 5509
17 Ga0070682_100000037 3300005337 Bacteria 147526
18 Ga0070682_100020426 3300005337 Bacteria 3896
19 Ga0068868_100084877 3300005338 Unclassified 2543
20 Ga0070660_100001860 3300005339 Bacteria 14529
21 Ga0070689_100034688 3300005340 Bacteria 3850
22 Ga0070661_100003179 3300005344 Bacteria 11317
23 Ga0070669_100087622 3300005353 Bacteria 2328
24 Ga0070671_100045080 3300005355 Unclassified 3665
25 Ga0070673_100014263 3300005364 Bacteria 5527
26 Ga0070659_100001835 3300005366 Bacteria 15262
27 Ga0070659_100011974 3300005366 Bacteria 6420
28 Ga0070667_100102614 3300005367 Bacteria 2472
29 Ga0070701_10028873 3300005438 Bacteria 2729
30 Ga0070700_100054143 3300005441 Unclassified 2506
31 Ga0070663_100009735 3300005455 Bacteria 5966
32 Ga0070681_10008347 3300005458 Bacteria 10146
33 Ga0068867_100023841 3300005459 Bacteria 4384
34 Ga0068867_100066424 3300005459 Unclassified 2686
35 Ga0070698_100002867 3300005471 Bacteria 18986
36 Ga0070698_100022946 3300005471 Bacteria 6525
37 Ga0070679_100000900 3300005530 Bacteria 25788
38 Ga0070679_100023796 3300005530 Bacteria 6001
39 Ga0070679_100040662 3300005530 Bacteria 4626
40 Ga0070684_100000285 3300005535 Bacteria 35210
41 Ga0070684_100024767 3300005535 Bacteria 5037
42 Ga0068853_100012967 3300005539 Bacteria 6794
43 Ga0070665_100155674 3300005548 Bacteria 2287
44 Ga0068855_100005133 3300005563 Bacteria 15967
45 Ga0068855_100020474 3300005563 Bacteria 7931
46 Ga0068855_100045289 3300005563 Bacteria 5203
47 Ga0070664_100000423 3300005564 Bacteria 31649
48 Ga0070664_100005324 3300005564 Bacteria 10325
49 Ga0070664_100005995 3300005564 Bacteria 9824
50 Ga0068857_100041238 3300005577 Bacteria 4094
51 Ga0068857_100048938 3300005577 Bacteria 3750
52 Ga0068852_100004922 3300005616 Bacteria 9482
53 Ga0068852_100008816 3300005616 Bacteria 7462
54 Ga0068852_100034987 3300005616 Bacteria 4184
55 Ga0068852_100098112 3300005616 Bacteria 2638
56 Ga0068859_100002106 3300005617 Bacteria 20262
57 Ga0068859_100014251 3300005617 Bacteria 7974
58 Ga0068859_100023300 3300005617 Bacteria 6213
59 Ga0068864_100004933 3300005618 Bacteria 10935
60 Ga0068864_100042724 3300005618 Bacteria 3879
61 Ga0068864_100084980 3300005618 Bacteria 2781
62 Ga0068861_100007849 3300005719 Bacteria 7339
63 Ga0068861_100021762 3300005719 Bacteria 4611
64 Ga0068861_100105022 3300005719 Unclassified 2255
65 Ga0068863_100067910 3300005841 Unclassified 3372
66 Ga0068860_100003089 3300005843 Bacteria 17225
67 Ga0068860_100045872 3300005843 Unclassified 4168
68 Ga0068860_100126296 3300005843 Bacteria 2452
69 Ga0068862_100009932 3300005844 Bacteria 7862
70 Ga0081539_10021147 3300005985 Unclassified 4358
71 Ga0097621_100010400 3300006237 Bacteria 6808
72 Ga0075428_100017249 3300006844 Bacteria 7978
73 Ga0075430_100012180 3300006846 Bacteria 7323
74 Ga0075429_100010519 3300006880 Bacteria 8001
75 Ga0068865_100007064 3300006881 Bacteria 6894
76 Ga0097620_100002106 3300006931 Bacteria 20262
77 Ga0097620_100014251 3300006931 Bacteria 7974
78 Ga0097620_100023300 3300006931 Bacteria 6213
79 Ga0114129_10167241 3300009147 Bacteria 3000
80 Ga0105241_10010107 3300009174 Bacteria 6928
81 Ga0105242_10006546 3300009176 Bacteria 8968
82 Ga0105242_10031430 3300009176 Bacteria 4240
83 Ga0105249_10002398 3300009553 Bacteria 16284
84 Ga0105249_10011245 3300009553 Bacteria 7857
85 Ga0105249_10013878 3300009553 Bacteria 7121
86 Ga0105249_10019740 3300009553 Bacteria 6017
87 Ga0157373_10001465 3300013100 Bacteria 18035
88 Ga0157371_10001959 3300013102 Bacteria 20458
89 Ga0157371_10005870 3300013102 Bacteria 10260
90 Ga0157371_10010983 3300013102 Bacteria 7018
91 Ga0157371_10019654 3300013102 Bacteria 4977
92 Ga0157371_10034629 3300013102 Bacteria 3621
93 Ga0157371_10072045 3300013102 Bacteria 2447
94 Ga0157370_10005734 3300013104 Bacteria 13885
95 Ga0157370_10042831 3300013104 Bacteria 4360
96 Ga0157369_10008343 3300013105 Bacteria 11879
97 Ga0157369_10117989 3300013105 Bacteria 2817
98 Ga0157374_10017763 3300013296 Bacteria 6268
99 Ga0157378_10026913 3300013297 Bacteria 5072
100 Ga0163162_10009773 3300013306 Bacteria 9339
101 Ga0163162_10023195 3300013306 Bacteria 6122
102 Ga0163162_10107046 3300013306 Unclassified 2891
103 Ga0157372_10015982 3300013307 Bacteria 8050
104 Ga0157372_10034575 3300013307 Bacteria 5557
105 Ga0157372_10054634 3300013307 Bacteria 4456
106 Ga0157372_10091773 3300013307 Bacteria 3454
107 Ga0157372_10140130 3300013307 Bacteria 2786
108 Ga0157372_10182345 3300013307 Bacteria 2430
109 Ga0157375_10023872 3300013308 Bacteria 5649
110 Ga0157375_10095955 3300013308 Bacteria 3037
111 Ga0163163_10014656 3300014325 Bacteria 7209
112 Ga0163163_10021454 3300014325 Bacteria 6095
113 Ga0157380_10006579 3300014326 Bacteria 8195
114 Ga0157376_10016620 3300014969 Bacteria 5592
115 Ga0157376_10077840 3300014969 Bacteria 2837
116 Ga0163161_10005549 3300017792 Bacteria 8739
117 Ga0207647_10000054 3300025904 Bacteria 86704
118 Ga0207647_10015681 3300025904 Bacteria 5189
119 Ga0207647_10025807 3300025904 Bacteria 3853
120 Ga0207645_10000622 3300025907 Bacteria 29378
121 Ga0207645_10027193 3300025907 Bacteria 3695
122 Ga0207645_10045635 3300025907 Unclassified 2800
123 Ga0207705_10001328 3300025909 Bacteria 19794
124 Ga0207705_10064214 3300025909 Bacteria 2653
125 Ga0207707_10017326 3300025912 Bacteria 6280
126 Ga0207695_10010674 3300025913 Bacteria 11220
127 Ga0207657_10004643 3300025919 Bacteria 14508
128 Ga0207649_10029088 3300025920 Bacteria 3260
129 Ga0207652_10000165 3300025921 Bacteria 71341
130 Ga0207652_10001600 3300025921 Bacteria 19940
131 Ga0207652_10031681 3300025921 Bacteria 4442
132 Ga0207650_10003750 3300025925 Bacteria 10393
133 Ga0207650_10059836 3300025925 Bacteria 2841
134 Ga0207659_10029969 3300025926 Bacteria 3712
135 Ga0207690_10002163 3300025932 Bacteria 12011
136 Ga0207690_10016728 3300025932 Bacteria 4468
137 Ga0207706_10013177 3300025933 Bacteria 7524
138 Ga0207686_10003640 3300025934 Bacteria 8256
139 Ga0207670_10007197 3300025936 Bacteria 6199
140 Ga0207670_10012036 3300025936 Bacteria 5043
141 Ga0207670_10036210 3300025936 Bacteria 3207
142 Ga0207691_10091592 3300025940 Bacteria 2724
143 Ga0207689_10003051 3300025942 Bacteria 15431
144 Ga0207689_10003193 3300025942 Bacteria 15030
145 Ga0207689_10007269 3300025942 Bacteria 9722
146 Ga0207689_10022034 3300025942 Bacteria 5358
147 Ga0207689_10029138 3300025942 Bacteria 4613
148 Ga0207689_10033211 3300025942 Bacteria 4288
149 Ga0207689_10052690 3300025942 Bacteria 3352
150 Ga0207689_10063917 3300025942 Bacteria 3028
151 Ga0207689_10131723 3300025942 Unclassified 2058
152 Ga0207661_10001045 3300025944 Bacteria 18375
153 Ga0207661_10014994 3300025944 Bacteria 5691
154 Ga0207661_10102560 3300025944 Bacteria 2406
155 Ga0207679_10000550 3300025945 Bacteria 25168
156 Ga0207679_10003059 3300025945 Bacteria 10358
157 Ga0207667_10000222 3300025949 Bacteria 79873
158 Ga0207667_10074466 3300025949 Unclassified 3527
159 Ga0207712_10011304 3300025961 Bacteria 5683
160 Ga0207712_10018409 3300025961 Bacteria 4549
161 Ga0207712_10050064 3300025961 Unclassified 2915
162 Ga0207640_10012083 3300025981 Bacteria 4908
163 Ga0207677_10027773 3300026023 Bacteria 3570
164 Ga0207703_10037135 3300026035 Bacteria 3881
165 Ga0207678_10008738 3300026067 Bacteria 8916
166 Ga0207678_10057838 3300026067 Unclassified 3337
167 Ga0207678_10080611 3300026067 Bacteria 2786
168 Ga0207708_10075458 3300026075 Unclassified 2585
169 Ga0207702_10038824 3300026078 Bacteria 3988
170 Ga0207641_10001301 3300026088 Bacteria 24754
171 Ga0207648_10004019 3300026089 Bacteria 15269
172 Ga0207648_10008405 3300026089 Bacteria 9998
173 Ga0207648_10029090 3300026089 Bacteria 4899
174 Ga0207676_10019670 3300026095 Bacteria 4930
175 Ga0207676_10037494 3300026095 Bacteria 3695
176 Ga0207674_10014945 3300026116 Bacteria 8554
177 Ga0207674_10045939 3300026116 Bacteria 4488
178 Ga0207674_10050244 3300026116 Bacteria 4261
179 Ga0207675_100002834 3300026118 Bacteria 17059
180 Ga0207675_100010167 3300026118 Bacteria 8819
181 Ga0207675_100015261 3300026118 Bacteria 7167
182 Ga0207675_100099528 3300026118 Unclassified 2738
183 Ga0207683_10010555 3300026121 Bacteria 7880
184 Ga0207698_10021246 3300026142 Bacteria 4484
185 Ga0207698_10049427 3300026142 Bacteria 3201
186 Ga0268264_10007782 3300028381 Bacteria 8923
187 Ga0268264_10036657 3300028381 Bacteria 4041
188 Ga0268264_10053063 3300028381 Bacteria 3382
189 Ga0268264_10111804 3300028381 Bacteria 2394
190 Ga0307515_10000001 3300028794 Bacteria 4259510
191 Ga0265327_10000248 3300031251 Bacteria 107284
192 Ga0395899_0019230 3300037312 Bacteria 5191
193 Ga0395899_0021641 3300037312 Bacteria 4876
194 Ga0395900_0035375 3300037418 Bacteria 5144
195 Ga0395900_0047179 3300037418 Bacteria 4435
196 Ga0395898_0028051 3300037466 Bacteria 5645
197 Ga0395898_0210116 3300037466 Bacteria 1856
198 Ga0395905_0005485 3300037471 Bacteria 12942
199 Ga0395905_0027545 3300037471 Bacteria 5359
200 Ga0395901_0013165 3300038443 Bacteria 8399
201 Ga0395901_0025573 3300038443 Bacteria 6060
202 Ga0395901_0032928 3300038443 Bacteria 5347
203 Ga0395901_0128649 3300038443 Bacteria 2662
204 Ga0395901_0146381 3300038443 Bacteria 2482
205 Ga0453684_0077023 3300044712 Unclassified 4184
206 Ga0466959_0080071 3300045049 Bacteria 2355
207 Ga0495608_0029254 3300046511 Bacteria 3739
208 Ga0495587_0039051 3300046536 Bacteria 2844
209 Ga0495668_0002295 3300046616 Bacteria 16070
210 Ga0495657_0060820 3300046675 Bacteria 2501
211 Ga0495672_0006383 3300047320 Bacteria 9154
212 Ga0495672_0018193 3300047320 Bacteria 4676
213 Ga0495672_0039599 3300047320 Bacteria 2865
214 Ga0495676_0034642 3300047321 Bacteria 4234
215 Ga0495686_0032043 3300047472 Unclassified 3404
216 Ga0501031_0003763 3300049568 Bacteria 9756
217 Ga0501032_0001664 3300049569 Bacteria 17653
218 Ga0501034_0000115 3300049571 Bacteria 146825
219 Ga0501034_0116807 3300049571 Bacteria 2656
220 Ga0501036_0005912 3300049572 Bacteria 9917
221 Ga0501037_0020654 3300049573 Bacteria 4862
222 Ga0501038_0013824 3300049574 Bacteria 7355
223 Ga0501039_0109222 3300049575 Bacteria 2162
224 Ga0501043_0005743 3300049579 Bacteria 9997
225 Ga0501046_0001260 3300049580 Bacteria 24521
226 Ga0501047_0005383 3300049581 Bacteria 12029
227 Ga0501048_0002959 3300049582 Bacteria 12971
228 Ga0501067_0047269 3300049583 Bacteria 2387
229 Ga0501070_0013053 3300049586 Bacteria 7001
230 Ga0501072_0022114 3300049588 Bacteria 4933
231 Ga0501073_0004554 3300049589 Bacteria 10421
232 Ga0501074_0002020 3300049590 Bacteria 13986
233 Ga0501223_000971 3300049663 Bacteria 6756
234 Ga0501259_000850 3300049688 Bacteria 5016
235 Ga0501225_0008717 3300049705 Bacteria 2903
236 Ga0501080_0005252 3300049742 Bacteria 11539
237 Ga0501083_0032730 3300049744 Bacteria 3564
238 Ga0501083_0070869 3300049744 Unclassified 2318
239 Ga0501266_000486 3300049763 Bacteria 5240
240 Ga0501044_0043779 3300049823 Bacteria 4649
241 nmdc:mga09592_32583_c1 3300050508 Bacteria 4345
242 nmdc:mga0qj67_39436_c1 3300050509 Bacteria 3709
243 nmdc:mga08y16_26624_c1 3300050511 Bacteria 6095
244 Ga0500611_000006 3300053727 Bacteria 226069
245 2819589689 2818991444 Bacteria 6968812
246 Ga0105240_10032492
247 JGI24751J29686_10001771
248 Ga0065712_10003540
249 Ga0065712_10011327
250 Ga0065707_10101656
251 Ga0070658_10029945
252 Ga0070676_10002678
253 Ga0070676_10034817
254 Ga0070683_100011034
255 Ga0070670_100010892
256 Ga0070670_100054793
257 Ga0070670_100054859
258 Ga0068869_100018546
259 Ga0068869_100026642
260 Ga0068869_100090860
261 Ga0070680_100018467
262 Ga0070682_100000037
263 Ga0070682_100020426
264 Ga0068868_100084877
265 Ga0070660_100001860
266 Ga0070689_100034688
267 Ga0070661_100003179
268 Ga0070669_100087622
269 Ga0070671_100045080
270 Ga0070673_100014263
271 Ga0070659_100001835
272 Ga0070659_100011974
273 Ga0070667_100102614
274 Ga0070701_10028873
275 Ga0070700_100054143
276 Ga0070663_100009735
277 Ga0070681_10008347
278 Ga0068867_100023841
279 Ga0068867_100066424
280 Ga0070698_100002867
281 Ga0070698_100022946
282 Ga0070679_100000900
283 Ga0070679_100023796
284 Ga0070679_100040662
285 Ga0070684_100000285
286 Ga0070684_100024767
287 Ga0068853_100012967
288 Ga0070665_100155674
289 Ga0068855_100005133
290 Ga0068855_100020474
291 Ga0068855_100045289
292 Ga0070664_100000423
293 Ga0070664_100005324
294 Ga0070664_100005995
295 Ga0068857_100041238
296 Ga0068857_100048938
297 Ga0068852_100004922
298 Ga0068852_100008816
299 Ga0068852_100034987
300 Ga0068852_100098112
301 Ga0068859_100002106
302 Ga0068859_100014251
303 Ga0068859_100023300
304 Ga0068864_100004933
305 Ga0068864_100042724
306 Ga0068864_100084980
307 Ga0068861_100007849
308 Ga0068861_100021762
309 Ga0068861_100105022
310 Ga0068863_100067910
311 Ga0068860_100003089
312 Ga0068860_100045872
313 Ga0068860_100126296
314 Ga0068862_100009932
315 Ga0081539_10021147
316 Ga0097621_100010400
317 Ga0075428_100017249
318 Ga0075430_100012180
319 Ga0075429_100010519
320 Ga0068865_100007064
321 Ga0097620_100002106
322 Ga0097620_100014251
323 Ga0097620_100023300
324 Ga0114129_10167241
325 Ga0105241_10010107
326 Ga0105242_10006546
327 Ga0105242_10031430
328 Ga0105249_10002398
329 Ga0105249_10011245
330 Ga0105249_10013878
331 Ga0105249_10019740
332 Ga0157373_10001465
333 Ga0157371_10001959
334 Ga0157371_10005870
335 Ga0157371_10010983
336 Ga0157371_10019654
337 Ga0157371_10034629
338 Ga0157371_10072045
339 Ga0157370_10005734
340 Ga0157370_10042831
341 Ga0157369_10008343
342 Ga0157369_10117989
343 Ga0157374_10017763
344 Ga0157378_10026913
345 Ga0163162_10009773
346 Ga0163162_10023195
347 Ga0163162_10107046
348 Ga0157372_10015982
349 Ga0157372_10034575
350 Ga0157372_10054634
351 Ga0157372_10091773
352 Ga0157372_10140130
353 Ga0157372_10182345
354 Ga0157375_10023872
355 Ga0157375_10095955
356 Ga0163163_10014656
357 Ga0163163_10021454
358 Ga0157380_10006579
359 Ga0157376_10016620
360 Ga0157376_10077840
361 Ga0163161_10005549
362 Ga0207647_10000054
363 Ga0207647_10015681
364 Ga0207647_10025807
365 Ga0207645_10000622
366 Ga0207645_10027193
367 Ga0207645_10045635
368 Ga0207705_10001328
369 Ga0207705_10064214
370 Ga0207707_10017326
371 Ga0207695_10010674
372 Ga0207657_10004643
373 Ga0207649_10029088
374 Ga0207652_10000165
375 Ga0207652_10001600
376 Ga0207652_10031681
377 Ga0207650_10003750
378 Ga0207650_10059836
379 Ga0207659_10029969
380 Ga0207690_10002163
381 Ga0207690_10016728
382 Ga0207706_10013177
383 Ga0207686_10003640
384 Ga0207670_10007197
385 Ga0207670_10012036
386 Ga0207670_10036210
387 Ga0207691_10091592
388 Ga0207689_10003051
389 Ga0207689_10003193
390 Ga0207689_10007269
391 Ga0207689_10022034
392 Ga0207689_10029138
393 Ga0207689_10033211
394 Ga0207689_10052690
395 Ga0207689_10063917
396 Ga0207689_10131723
397 Ga0207661_10001045
398 Ga0207661_10014994
399 Ga0207661_10102560
400 Ga0207679_10000550
401 Ga0207679_10003059
402 Ga0207667_10000222
403 Ga0207667_10074466
404 Ga0207712_10011304
405 Ga0207712_10018409
406 Ga0207712_10050064
407 Ga0207640_10012083
408 Ga0207677_10027773
409 Ga0207703_10037135
410 Ga0207678_10008738
411 Ga0207678_10057838
412 Ga0207678_10080611
413 Ga0207708_10075458
414 Ga0207702_10038824
415 Ga0207641_10001301
416 Ga0207648_10004019
417 Ga0207648_10008405
418 Ga0207648_10029090
419 Ga0207676_10019670
420 Ga0207676_10037494
421 Ga0207674_10014945
422 Ga0207674_10045939
423 Ga0207674_10050244
424 Ga0207675_100002834
425 Ga0207675_100010167
426 Ga0207675_100015261
427 Ga0207675_100099528
428 Ga0207683_10010555
429 Ga0207698_10021246
430 Ga0207698_10049427
431 Ga0268264_10007782
432 Ga0268264_10036657
433 Ga0268264_10053063
434 Ga0268264_10111804
435 Ga0307515_10000001
436 Ga0265327_10000248
437 Ga0395899_0019230
438 Ga0395899_0021641
439 Ga0395900_0035375
440 Ga0395900_0047179
441 Ga0395898_0028051
442 Ga0395898_0210116
443 Ga0395905_0005485
444 Ga0395905_0027545
445 Ga0395901_0013165
446 Ga0395901_0025573
447 Ga0395901_0032928
448 Ga0395901_0128649
449 Ga0395901_0146381
450 Ga0453684_0077023
451 Ga0466959_0080071
452 Ga0495608_0029254
453 Ga0495587_0039051
454 Ga0495668_0002295
455 Ga0495657_0060820
456 Ga0495672_0006383
457 Ga0495672_0018193
458 Ga0495672_0039599
459 Ga0495676_0034642
460 Ga0495686_0032043
461 Ga0501031_0003763
462 Ga0501032_0001664
463 Ga0501034_0000115
464 Ga0501034_0116807
465 Ga0501036_0005912
466 Ga0501037_0020654
467 Ga0501038_0013824
468 Ga0501039_0109222
469 Ga0501043_0005743
470 Ga0501046_0001260
471 Ga0501047_0005383
472 Ga0501048_0002959
473 Ga0501067_0047269
474 Ga0501070_0013053
475 Ga0501072_0022114
476 Ga0501073_0004554
477 Ga0501074_0002020
478 Ga0501223_000971
479 Ga0501259_000850
480 Ga0501225_0008717
481 Ga0501080_0005252
482 Ga0501083_0032730
483 Ga0501083_0070869
484 Ga0501266_000486
485 Ga0501044_0043779
486 nmdc:mga09592_32583_c1
487 nmdc:mga0qj67_39436_c1
488 nmdc:mga08y16_26624_c1
489 Ga0500611_000006
490 2819589689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

297

581

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxq-assembly2.cif.gz_B the crystal structure of a protein in the alkaline phosphatase superfamily from vibrio parahaemolyticus to 1.95a 0.8248 212 630
3lxq-assembly2.cif.gz_B the crystal structure of a protein in the alkaline phosphatase superfamily from vibrio parahaemolyticus to 1.95a 0.8097 212 630
4uop-assembly1.cif.gz_A crystal structure of the lipoteichoic acid synthase ltap from listeria monocytogenes 0.776 218 628
4uop-assembly1.cif.gz_A crystal structure of the lipoteichoic acid synthase ltap from listeria monocytogenes 0.7654 218 628
6psm-assembly3.cif.gz_D crystal structure of pss1_19b c77s in complex with kappa-neocarrabiose 0.7542 252 619
ID Description Score Start End Superfamily
3lxqA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8576 241 540 3.40.720.10
5jouA01 Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) 0.8482 555 591 2.60.40.1760
3lxqA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8432 241 540 3.40.720.10
af_Q86BY9_16_264_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8391 557 591 2.130.10.10
af_O82373_99_355_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8198 559 591 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A3C1NLE5-F1-model_v4 Sulfatase N-terminal domain-containing protein 0.9806 335 630 GO:0005886
AF-A0A537KIU9-F1-model_v4 Sulfatase N-terminal domain-containing protein 0.9746 462 629 GO:0005886
AF-A0A3C1NLE5-F1-model_v4 Sulfatase N-terminal domain-containing protein 0.9552 335 630 GO:0005886
AF-A0A537KIU9-F1-model_v4 Sulfatase N-terminal domain-containing protein 0.9523 462 629 GO:0005886
AF-A0A7C4YC96-F1-model_v4 LTA synthase family protein 0.9513 224 630 GO:0005886

Map