F356859

General Info

Members Datasets Scaffolds Average Seq Length
244 128 488 104

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0002311|Ga0501047_0002311_1143_1502
Length 119
Sequence LWDTLNLAGLRHPFPMFLARVIGSIVATKKDAAMTGHKLLLLRPLVVDEAAPDRFRPGVNTVVAVDSLGAGLDEVVLFCQGSSARQAAGMKALPVDAVVIGIVDTVDVLNRKIYPAVGR

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
81 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
86 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
126 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 1.23
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0002311 3300049581 Bacteria 18235
2 Ga0065704_10193805 3300005289 Bacteria 1177
3 Ga0065707_10088723 3300005295 Bacteria 4570
4 Ga0065707_10513886 3300005295 Bacteria 747
5 Ga0070682_100700368 3300005337 Bacteria 812
6 Ga0070682_101371217 3300005337 Unclassified 603
7 Ga0070689_100487645 3300005340 Bacteria 1054
8 Ga0070689_100717284 3300005340 Bacteria 874
9 Ga0070674_101914128 3300005356 Unclassified 539
10 Ga0070688_100207903 3300005365 Bacteria 1373
11 Ga0070713_100588444 3300005436 Bacteria 1056
12 Ga0070710_10062950 3300005437 Unclassified 2118
13 Ga0070662_101974522 3300005457 Unclassified 504
14 Ga0070681_10331608 3300005458 Bacteria 1431
15 Ga0070698_101305522 3300005471 Bacteria 676
16 Ga0070699_100053966 3300005518 Bacteria 3479
17 Ga0070679_101482263 3300005530 Unclassified 625
18 Ga0070672_101665937 3300005543 Unclassified 573
19 Ga0070686_100104087 3300005544 Bacteria 1922
20 Ga0070693_101281663 3300005547 Bacteria 566
21 Ga0070665_100474070 3300005548 Bacteria 1262
22 Ga0070704_101540079 3300005549 Unclassified 612
23 Ga0068855_100881078 3300005563 Bacteria 947
24 Ga0068856_102400132 3300005614 Bacteria 535
25 Ga0068861_102676976 3300005719 Unclassified 503
26 Ga0068863_100230137 3300005841 Bacteria 1788
27 Ga0068858_101525673 3300005842 Unclassified 659
28 Ga0068871_100948537 3300006358 Bacteria 799
29 Ga0075428_100013536 3300006844 Bacteria 9081
30 Ga0075428_100059651 3300006844 Bacteria 4177
31 Ga0075428_100750903 3300006844 Unclassified 1038
32 Ga0075428_101177202 3300006844 Bacteria 808
33 Ga0075428_101497481 3300006844 Bacteria 707
34 Ga0075431_100652418 3300006847 Bacteria 1033
35 Ga0075433_10019279 3300006852 Bacteria 5681
36 Ga0075433_11066546 3300006852 Bacteria 703
37 Ga0075434_100065260 3300006871 Bacteria 3625
38 Ga0075429_100058759 3300006880 Bacteria 3349
39 Ga0105240_10431164 3300009093 Bacteria 1479
40 Ga0105240_11695587 3300009093 Bacteria 660
41 Ga0111539_13230515 3300009094 Bacteria 525
42 Ga0105245_10406082 3300009098 Bacteria 1362
43 Ga0105245_10751933 3300009098 Bacteria 1011
44 Ga0105245_11662594 3300009098 Bacteria 690
45 Ga0114129_10006440 3300009147 Bacteria 16648
46 Ga0105248_10807037 3300009177 Bacteria 1059
47 Ga0105238_12488327 3300009551 Bacteria 554
48 Ga0105249_10719903 3300009553 Bacteria 1059
49 Ga0105249_12002236 3300009553 Bacteria 652
50 Ga0157378_11498266 3300013297 Bacteria 719
51 Ga0163162_11577510 3300013306 Bacteria 749
52 Ga0157372_12576047 3300013307 Unclassified 584
53 Ga0157375_10889462 3300013308 Bacteria 1035
54 Ga0163163_10813395 3300014325 Bacteria 998
55 Ga0163163_11341853 3300014325 Bacteria 777
56 Ga0157380_12454559 3300014326 Bacteria 587
57 Ga0157379_11306300 3300014968 Bacteria 701
58 Ga0157376_11066705 3300014969 Unclassified 833
59 Ga0207692_10082282 3300025898 Unclassified 1725
60 Ga0207707_10426443 3300025912 Bacteria 1136
61 Ga0207694_10873287 3300025924 Bacteria 760
62 Ga0207700_10392620 3300025928 Bacteria 1215
63 Ga0207691_10937223 3300025940 Bacteria 724
64 Ga0207712_10550194 3300025961 Bacteria 992
65 Ga0207703_10489962 3300026035 Bacteria 1153
66 Ga0207703_11424213 3300026035 Bacteria 667
67 Ga0207641_10333905 3300026088 Bacteria 1441
68 Ga0207683_11511233 3300026121 Bacteria 620
69 Ga0268266_10687171 3300028379 Bacteria 986
70 Ga0265337_1003163 3300028556 Bacteria 7230
71 Ga0265337_1008692 3300028556 Bacteria 3670
72 Ga0265337_1049941 3300028556 Bacteria 1180
73 Ga0265337_1095696 3300028556 Bacteria 809
74 Ga0265319_1000046 3300028563 Bacteria 101716
75 Ga0265319_1002046 3300028563 Bacteria 11346
76 Ga0265319_1003903 3300028563 Bacteria 7593
77 Ga0265319_1008946 3300028563 Bacteria 4327
78 Ga0265319_1013263 3300028563 Bacteria 3288
79 Ga0265319_1022122 3300028563 Bacteria 2323
80 Ga0265319_1101212 3300028563 Bacteria 904
81 Ga0265319_1129505 3300028563 Bacteria 785
82 Ga0265334_10005005 3300028573 Bacteria 5825
83 Ga0265334_10011648 3300028573 Bacteria 3698
84 Ga0265334_10055636 3300028573 Bacteria 1505
85 Ga0265334_10155790 3300028573 Bacteria 804
86 Ga0265334_10277323 3300028573 Bacteria 575
87 Ga0265318_10000158 3300028577 Bacteria 60618
88 Ga0265318_10000417 3300028577 Bacteria 32812
89 Ga0265318_10007782 3300028577 Bacteria 4816
90 Ga0265318_10310671 3300028577 Bacteria 575
91 Ga0265323_10000048 3300028653 Bacteria 65493
92 Ga0265323_10000224 3300028653 Bacteria 33270
93 Ga0265323_10021112 3300028653 Bacteria 2498
94 Ga0265323_10030985 3300028653 Bacteria 1990
95 Ga0265323_10094076 3300028653 Unclassified 998
96 Ga0265322_10000168 3300028654 Bacteria 30155
97 Ga0265322_10000276 3300028654 Bacteria 21779
98 Ga0265322_10083667 3300028654 Bacteria 906
99 Ga0265322_10199601 3300028654 Bacteria 573
100 Ga0265322_10204825 3300028654 Bacteria 565
101 Ga0265336_10242487 3300028666 Bacteria 535
102 Ga0265336_10246158 3300028666 Bacteria 531
103 Ga0265338_10000245 3300028800 Bacteria 99446
104 Ga0265338_10118179 3300028800 Bacteria 2119
105 Ga0265338_10703660 3300028800 Bacteria 697
106 Ga0265338_10739711 3300028800 Bacteria 677
107 Ga0265324_10019395 3300029957 Unclassified 2449
108 Ga0265324_10025781 3300029957 Bacteria 2083
109 Ga0265324_10051097 3300029957 Bacteria 1420
110 Ga0265324_10055859 3300029957 Bacteria 1353
111 Ga0265330_10021082 3300031235 Bacteria 2977
112 Ga0265330_10167555 3300031235 Bacteria 932
113 Ga0265330_10500007 3300031235 Bacteria 517
114 Ga0265332_10065388 3300031238 Bacteria 1553
115 Ga0265332_10155526 3300031238 Unclassified 956
116 Ga0265328_10008016 3300031239 Bacteria 4378
117 Ga0265320_10000970 3300031240 Bacteria 21353
118 Ga0265320_10002290 3300031240 Bacteria 13418
119 Ga0265320_10002719 3300031240 Bacteria 12229
120 Ga0265320_10009581 3300031240 Bacteria 5831
121 Ga0265320_10011241 3300031240 Bacteria 5279
122 Ga0265320_10018383 3300031240 Bacteria 3850
123 Ga0265320_10059931 3300031240 Bacteria 1818
124 Ga0265320_10072197 3300031240 Bacteria 1624
125 Ga0265320_10108971 3300031240 Bacteria 1270
126 Ga0265320_10220102 3300031240 Bacteria 846
127 Ga0265325_10007359 3300031241 Bacteria 6594
128 Ga0265325_10059241 3300031241 Bacteria 1947
129 Ga0265340_10063086 3300031247 Bacteria 1769
130 Ga0265339_10061510 3300031249 Bacteria 2021
131 Ga0265339_10206890 3300031249 Bacteria 965
132 Ga0265339_10273617 3300031249 Unclassified 811
133 Ga0265339_10372001 3300031249 Bacteria 671
134 Ga0265331_10002927 3300031250 Bacteria 11278
135 Ga0265331_10198844 3300031250 Bacteria 903
136 Ga0265331_10234190 3300031250 Bacteria 824
137 Ga0265327_10009132 3300031251 Bacteria 7212
138 Ga0265327_10044263 3300031251 Bacteria 2375
139 Ga0265327_10084182 3300031251 Bacteria 1563
140 Ga0265327_10086472 3300031251 Bacteria 1538
141 Ga0265327_10159403 3300031251 Bacteria 1043
142 Ga0265327_10283440 3300031251 Bacteria 732
143 Ga0265316_10013045 3300031344 Bacteria 7412
144 Ga0265316_10018006 3300031344 Bacteria 6086
145 Ga0265316_10214416 3300031344 Bacteria 1423
146 Ga0265316_10567581 3300031344 Bacteria 806
147 Ga0265316_10686747 3300031344 Bacteria 722
148 Ga0265316_10801138 3300031344 Bacteria 661
149 Ga0265316_11105982 3300031344 Bacteria 549
150 Ga0307509_10301617 3300031507 Bacteria 1350
151 Ga0265313_10000633 3300031595 Bacteria 36277
152 Ga0265313_10001720 3300031595 Bacteria 20171
153 Ga0265313_10002575 3300031595 Bacteria 15460
154 Ga0265313_10005280 3300031595 Bacteria 9563
155 Ga0265313_10016495 3300031595 Bacteria 4243
156 Ga0265313_10116258 3300031595 Bacteria 1171
157 Ga0265314_10003959 3300031711 Bacteria 14038
158 Ga0265314_10015600 3300031711 Bacteria 6023
159 Ga0265314_10015773 3300031711 Bacteria 5984
160 Ga0265314_10034371 3300031711 Bacteria 3706
161 Ga0265314_10067493 3300031711 Bacteria 2409
162 Ga0265314_10125998 3300031711 Bacteria 1604
163 Ga0265314_10129107 3300031711 Bacteria 1579
164 Ga0265314_10183399 3300031711 Bacteria 1252
165 Ga0265314_10188027 3300031711 Bacteria 1231
166 Ga0265314_10381452 3300031711 Bacteria 767
167 Ga0265314_10433730 3300031711 Bacteria 703
168 Ga0265342_10016038 3300031712 Bacteria 4907
169 Ga0265342_10035173 3300031712 Bacteria 3068
170 Ga0265342_10039925 3300031712 Bacteria 2848
171 Ga0265342_10045675 3300031712 Bacteria 2635
172 Ga0307416_100618639 3300032002 Bacteria 1165
173 Ga0316580_10097028 3300032139 Bacteria 902
174 Ga0316593_10089292 3300032168 Bacteria 1084
175 Ga0373948_0135278 3300034817 Bacteria 606
176 Ga0373935_0736226 3300035692 Unclassified 726
177 Ga0373933_0711706 3300035724 Unclassified 660
178 Ga0451787_109841 3300041441 Bacteria 618
179 Ga0451795_0653296 3300041456 Bacteria 1256
180 Ga0451807_2596295 3300041486 Unclassified 548
181 Ga0451839_1376699 3300041496 Bacteria 592
182 Ga0451577_0004620 3300042876 Bacteria 14463
183 Ga0451577_0148513 3300042876 Bacteria 2108
184 Ga0451577_0165124 3300042876 Bacteria 1994
185 Ga0451577_0315032 3300042876 Bacteria 1418
186 Ga0451577_0669705 3300042876 Bacteria 941
187 Ga0451577_0726099 3300042876 Unclassified 899
188 Ga0453684_0000001 3300044712 Bacteria 2623166
189 Ga0453684_0007068 3300044712 Bacteria 20971
190 Ga0453684_0056312 3300044712 Bacteria 5101
191 Ga0451576_2134090 3300045051 Bacteria 576
192 Ga0451576_2248117 3300045051 Bacteria 559
193 Ga0495618_0668542 3300046514 Bacteria 613
194 Ga0495618_0688635 3300046514 Unclassified 602
195 Ga0495628_0494777 3300046516 Unclassified 884
196 Ga0495586_0433301 3300046535 Unclassified 758
197 Ga0495611_0097260 3300046648 Bacteria 1364
198 Ga0495599_0638182 3300046678 Unclassified 618
199 Ga0501031_0791219 3300049568 Bacteria 608
200 Ga0501033_0004272 3300049570 Bacteria 11484
201 Ga0501036_0416454 3300049572 Bacteria 1120
202 Ga0501037_0069809 3300049573 Bacteria 2557
203 Ga0501037_0818769 3300049573 Bacteria 614
204 Ga0501038_0576935 3300049574 Bacteria 853
205 Ga0501038_0736326 3300049574 Unclassified 736
206 Ga0501038_0824615 3300049574 Bacteria 688
207 Ga0501039_0964919 3300049575 Unclassified 663
208 Ga0501041_0557583 3300049577 Unclassified 730
209 Ga0501042_0415874 3300049578 Bacteria 974
210 Ga0501043_0388788 3300049579 Bacteria 1055
211 Ga0501046_0000164 3300049580 Bacteria 69259
212 Ga0501047_0033023 3300049581 Bacteria 4996
213 Ga0501047_1134949 3300049581 Bacteria 595
214 Ga0501048_0391813 3300049582 Bacteria 992
215 Ga0501068_0903511 3300049584 Bacteria 581
216 Ga0501070_0262228 3300049586 Bacteria 1412
217 Ga0501070_0332731 3300049586 Bacteria 1234
218 Ga0501070_1399117 3300049586 Unclassified 532
219 Ga0501075_1157560 3300049591 Bacteria 587
220 Ga0501076_1662550 3300049592 Unclassified 524
221 Ga0501243_003751 3300049675 Bacteria 2265
222 Ga0501081_0309926 3300049743 Unclassified 1159
223 Ga0501081_1159516 3300049743 Unclassified 585
224 Ga0501083_0019352 3300049744 Bacteria 4743
225 Ga0501083_0047784 3300049744 Bacteria 2890
226 Ga0501035_0004424 3300049822 Bacteria 13339
227 Ga0501035_0325991 3300049822 Bacteria 1289
228 Ga0501044_0002907 3300049823 Bacteria 19493
229 Ga0501044_0062925 3300049823 Bacteria 3791
230 nmdc:mga05p37_33554_c1 3300050507 Bacteria 6287
231 nmdc:mga09592_28634_c1 3300050508 Bacteria 4629
232 nmdc:mga09592_564709_c1 3300050508 Bacteria 977
233 nmdc:mga0qj67_557960_c1 3300050509 Bacteria 918
234 nmdc:mga06r32_269380_c1 3300050510 Bacteria 1690
235 nmdc:mga0n895_74614_c1 3300050512 Bacteria 3370
236 nmdc:mga08x19_600790_c1 3300050514 Unclassified 780
237 nmdc:mga0a205_225901_c1 3300050515 Bacteria 1757
238 nmdc:mga0a205_693279_c1 3300050515 Bacteria 868
239 nmdc:mga0a205_890435_c1 3300050515 Bacteria 737
240 Ga0495619_0758657 3300053085 Unclassified 658
241 Ga0500641_0031504 3300053096 Bacteria 2092
242 Ga0500579_244663 3300053143 Unclassified 590
243 Ga0501084_0776165 3300054114 Bacteria 807
244 Ga0530510_0270907 3300061734 Bacteria 1267
245 Ga0501047_0002311
246 Ga0065704_10193805
247 Ga0065707_10088723
248 Ga0065707_10513886
249 Ga0070682_100700368
250 Ga0070682_101371217
251 Ga0070689_100487645
252 Ga0070689_100717284
253 Ga0070674_101914128
254 Ga0070688_100207903
255 Ga0070713_100588444
256 Ga0070710_10062950
257 Ga0070662_101974522
258 Ga0070681_10331608
259 Ga0070698_101305522
260 Ga0070699_100053966
261 Ga0070679_101482263
262 Ga0070672_101665937
263 Ga0070686_100104087
264 Ga0070693_101281663
265 Ga0070665_100474070
266 Ga0070704_101540079
267 Ga0068855_100881078
268 Ga0068856_102400132
269 Ga0068861_102676976
270 Ga0068863_100230137
271 Ga0068858_101525673
272 Ga0068871_100948537
273 Ga0075428_100013536
274 Ga0075428_100059651
275 Ga0075428_100750903
276 Ga0075428_101177202
277 Ga0075428_101497481
278 Ga0075431_100652418
279 Ga0075433_10019279
280 Ga0075433_11066546
281 Ga0075434_100065260
282 Ga0075429_100058759
283 Ga0105240_10431164
284 Ga0105240_11695587
285 Ga0111539_13230515
286 Ga0105245_10406082
287 Ga0105245_10751933
288 Ga0105245_11662594
289 Ga0114129_10006440
290 Ga0105248_10807037
291 Ga0105238_12488327
292 Ga0105249_10719903
293 Ga0105249_12002236
294 Ga0157378_11498266
295 Ga0163162_11577510
296 Ga0157372_12576047
297 Ga0157375_10889462
298 Ga0163163_10813395
299 Ga0163163_11341853
300 Ga0157380_12454559
301 Ga0157379_11306300
302 Ga0157376_11066705
303 Ga0207692_10082282
304 Ga0207707_10426443
305 Ga0207694_10873287
306 Ga0207700_10392620
307 Ga0207691_10937223
308 Ga0207712_10550194
309 Ga0207703_10489962
310 Ga0207703_11424213
311 Ga0207641_10333905
312 Ga0207683_11511233
313 Ga0268266_10687171
314 Ga0265337_1003163
315 Ga0265337_1008692
316 Ga0265337_1049941
317 Ga0265337_1095696
318 Ga0265319_1000046
319 Ga0265319_1002046
320 Ga0265319_1003903
321 Ga0265319_1008946
322 Ga0265319_1013263
323 Ga0265319_1022122
324 Ga0265319_1101212
325 Ga0265319_1129505
326 Ga0265334_10005005
327 Ga0265334_10011648
328 Ga0265334_10055636
329 Ga0265334_10155790
330 Ga0265334_10277323
331 Ga0265318_10000158
332 Ga0265318_10000417
333 Ga0265318_10007782
334 Ga0265318_10310671
335 Ga0265323_10000048
336 Ga0265323_10000224
337 Ga0265323_10021112
338 Ga0265323_10030985
339 Ga0265323_10094076
340 Ga0265322_10000168
341 Ga0265322_10000276
342 Ga0265322_10083667
343 Ga0265322_10199601
344 Ga0265322_10204825
345 Ga0265336_10242487
346 Ga0265336_10246158
347 Ga0265338_10000245
348 Ga0265338_10118179
349 Ga0265338_10703660
350 Ga0265338_10739711
351 Ga0265324_10019395
352 Ga0265324_10025781
353 Ga0265324_10051097
354 Ga0265324_10055859
355 Ga0265330_10021082
356 Ga0265330_10167555
357 Ga0265330_10500007
358 Ga0265332_10065388
359 Ga0265332_10155526
360 Ga0265328_10008016
361 Ga0265320_10000970
362 Ga0265320_10002290
363 Ga0265320_10002719
364 Ga0265320_10009581
365 Ga0265320_10011241
366 Ga0265320_10018383
367 Ga0265320_10059931
368 Ga0265320_10072197
369 Ga0265320_10108971
370 Ga0265320_10220102
371 Ga0265325_10007359
372 Ga0265325_10059241
373 Ga0265340_10063086
374 Ga0265339_10061510
375 Ga0265339_10206890
376 Ga0265339_10273617
377 Ga0265339_10372001
378 Ga0265331_10002927
379 Ga0265331_10198844
380 Ga0265331_10234190
381 Ga0265327_10009132
382 Ga0265327_10044263
383 Ga0265327_10084182
384 Ga0265327_10086472
385 Ga0265327_10159403
386 Ga0265327_10283440
387 Ga0265316_10013045
388 Ga0265316_10018006
389 Ga0265316_10214416
390 Ga0265316_10567581
391 Ga0265316_10686747
392 Ga0265316_10801138
393 Ga0265316_11105982
394 Ga0307509_10301617
395 Ga0265313_10000633
396 Ga0265313_10001720
397 Ga0265313_10002575
398 Ga0265313_10005280
399 Ga0265313_10016495
400 Ga0265313_10116258
401 Ga0265314_10003959
402 Ga0265314_10015600
403 Ga0265314_10015773
404 Ga0265314_10034371
405 Ga0265314_10067493
406 Ga0265314_10125998
407 Ga0265314_10129107
408 Ga0265314_10183399
409 Ga0265314_10188027
410 Ga0265314_10381452
411 Ga0265314_10433730
412 Ga0265342_10016038
413 Ga0265342_10035173
414 Ga0265342_10039925
415 Ga0265342_10045675
416 Ga0307416_100618639
417 Ga0316580_10097028
418 Ga0316593_10089292
419 Ga0373948_0135278
420 Ga0373935_0736226
421 Ga0373933_0711706
422 Ga0451787_109841
423 Ga0451795_0653296
424 Ga0451807_2596295
425 Ga0451839_1376699
426 Ga0451577_0004620
427 Ga0451577_0148513
428 Ga0451577_0165124
429 Ga0451577_0315032
430 Ga0451577_0669705
431 Ga0451577_0726099
432 Ga0453684_0000001
433 Ga0453684_0007068
434 Ga0453684_0056312
435 Ga0451576_2134090
436 Ga0451576_2248117
437 Ga0495618_0668542
438 Ga0495618_0688635
439 Ga0495628_0494777
440 Ga0495586_0433301
441 Ga0495611_0097260
442 Ga0495599_0638182
443 Ga0501031_0791219
444 Ga0501033_0004272
445 Ga0501036_0416454
446 Ga0501037_0069809
447 Ga0501037_0818769
448 Ga0501038_0576935
449 Ga0501038_0736326
450 Ga0501038_0824615
451 Ga0501039_0964919
452 Ga0501041_0557583
453 Ga0501042_0415874
454 Ga0501043_0388788
455 Ga0501046_0000164
456 Ga0501047_0033023
457 Ga0501047_1134949
458 Ga0501048_0391813
459 Ga0501068_0903511
460 Ga0501070_0262228
461 Ga0501070_0332731
462 Ga0501070_1399117
463 Ga0501075_1157560
464 Ga0501076_1662550
465 Ga0501243_003751
466 Ga0501081_0309926
467 Ga0501081_1159516
468 Ga0501083_0019352
469 Ga0501083_0047784
470 Ga0501035_0004424
471 Ga0501035_0325991
472 Ga0501044_0002907
473 Ga0501044_0062925
474 nmdc:mga05p37_33554_c1
475 nmdc:mga09592_28634_c1
476 nmdc:mga09592_564709_c1
477 nmdc:mga0qj67_557960_c1
478 nmdc:mga06r32_269380_c1
479 nmdc:mga0n895_74614_c1
480 nmdc:mga08x19_600790_c1
481 nmdc:mga0a205_225901_c1
482 nmdc:mga0a205_693279_c1
483 nmdc:mga0a205_890435_c1
484 Ga0495619_0758657
485 Ga0500641_0031504
486 Ga0500579_244663
487 Ga0501084_0776165
488 Ga0530510_0270907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

16

104

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6owg-assembly1.cif.gz_DR structure of a synthetic beta-carboxysome shell, t=4 0.9413 1 100
6owg-assembly1.cif.gz_DR structure of a synthetic beta-carboxysome shell, t=4 0.9319 1 100
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9259 1 93
4i7a-assembly1.cif.gz_C grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9217 1 93
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9217 1 93
ID Description Score Start End Superfamily
2z9hB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9253 1 103 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9217 1 93 2.40.50.220
2z9hB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9163 1 103 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9112 1 93 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8936 1 102 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A518CBD1-F1-model_v4 Carbon dioxide concentrating mechanism protein CcmL 0.9763 1 103 GO:0031469
AF-Q7UVK2-F1-model_v4 Probable ethanolamine utilization protein EutN 0.9763 1 98 GO:0031469
AF-A0A7V8VB38-F1-model_v4 Ethanolamine utilization protein EutN 0.976 1 101 GO:0031469
AF-A0A7Y5SLK4-F1-model_v4 EutN/CcmL family microcompartment protein 0.9753 1 102 GO:0031469
AF-A0A2G2KQ48-F1-model_v4 deleted 0.975 1 102

Map