F356693

General Info

Members Datasets Scaffolds Average Seq Length
244 161 244 147

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1311932|Ga0436360_1311932_85_627
Length 180
Sequence MVERKGEDPASFGSSMFSRTFNDQRWASSLERNFDMPTSEKPLHIDIPVKLTEEKVVFSIAALAFEGDLPASIFHLGLVMSDIAEWNAKAQVVAVFHTNAGHVTLHDGAYNRERNVATGNPYKDLLADLMKHGVQIELCGATAKAHKWGNADLLPGIKINRNAMARTTQLVQEGFVKITE

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
75 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
76 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
83 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
84 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
98 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 0.82
Rhizoplane 2.87
Rhizosphere 84.02
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000296 3300002459 Bacteria 18771
2 Ga0065712_10276964 3300005290 Bacteria 903
3 Ga0070670_100001499 3300005331 Bacteria 18809
4 Ga0070680_100224359 3300005336 Bacteria 1586
5 Ga0070675_100066573 3300005354 Bacteria 2980
6 Ga0070673_101670335 3300005364 Unclassified 602
7 Ga0070667_101353721 3300005367 Unclassified 667
8 Ga0070708_100021796 3300005445 Bacteria 5425
9 Ga0070708_100039212 3300005445 Bacteria 4143
10 Ga0070708_100418432 3300005445 Bacteria 1264
11 Ga0070663_100020908 3300005455 Bacteria 4341
12 Ga0070678_100746377 3300005456 Bacteria 885
13 Ga0070706_100017376 3300005467 Bacteria 6637
14 Ga0070706_100215402 3300005467 Bacteria 1793
15 Ga0070706_100290944 3300005467 Bacteria 1524
16 Ga0070707_100004608 3300005468 Bacteria 12896
17 Ga0070698_100089663 3300005471 Bacteria 3059
18 Ga0070698_100115964 3300005471 Bacteria 2642
19 Ga0070698_100178276 3300005471 Bacteria 2063
20 Ga0070698_101394292 3300005471 Unclassified 652
21 Ga0070699_100007454 3300005518 Bacteria 9521
22 Ga0070699_100150020 3300005518 Unclassified 2061
23 Ga0070699_100231393 3300005518 Bacteria 1648
24 Ga0070699_101579321 3300005518 Bacteria 601
25 Ga0070679_100162641 3300005530 Bacteria 2206
26 Ga0070697_100157239 3300005536 Bacteria 1919
27 Ga0070697_100980601 3300005536 Unclassified 751
28 Ga0070665_100093533 3300005548 Bacteria 3011
29 Ga0070665_100279251 3300005548 Bacteria 1672
30 Ga0070665_102184271 3300005548 Bacteria 557
31 Ga0068855_101526666 3300005563 Unclassified 685
32 Ga0068859_100460448 3300005617 Bacteria 1368
33 Ga0068859_101391373 3300005617 Bacteria 774
34 Ga0068870_10208136 3300005840 Unclassified 1190
35 Ga0068863_100124139 3300005841 Bacteria 2463
36 Ga0068863_100596316 3300005841 Bacteria 1093
37 Ga0068858_100972956 3300005842 Bacteria 831
38 Ga0068860_100213492 3300005843 Unclassified 1872
39 Ga0070717_10001502 3300006028 Bacteria 16141
40 Ga0075365_10028697 3300006038 Bacteria 3550
41 Ga0075363_100011764 3300006048 Bacteria 4199
42 Ga0075367_10767007 3300006178 Unclassified 614
43 Ga0075369_10428515 3300006186 Bacteria 625
44 Ga0097621_100424881 3300006237 Bacteria 1193
45 Ga0075370_10017410 3300006353 Bacteria 3883
46 Ga0068871_100877872 3300006358 Bacteria 830
47 Ga0097620_100460447 3300006931 Bacteria 1368
48 Ga0097620_101391474 3300006931 Bacteria 774
49 Ga0099794_10000728 3300007265 Bacteria 11054
50 Ga0099794_10022985 3300007265 Bacteria 2847
51 Ga0099794_10213844 3300007265 Unclassified 989
52 Ga0099794_10300594 3300007265 Bacteria 831
53 Ga0099795_10015761 3300007788 Unclassified 2375
54 Ga0099795_10043039 3300007788 Bacteria 1614
55 Ga0105247_10056959 3300009101 Bacteria 2415
56 Ga0105243_10179961 3300009148 Bacteria 1838
57 Ga0105248_10069788 3300009177 Bacteria 3946
58 Ga0105248_10125547 3300009177 Bacteria 2895
59 Ga0105248_10550194 3300009177 Bacteria 1302
60 Ga0105237_10502705 3300009545 Bacteria 1219
61 Ga0105237_11026828 3300009545 Bacteria 831
62 Ga0105238_10094484 3300009551 Bacteria 2978
63 Ga0105238_10803568 3300009551 Bacteria 956
64 Ga0105249_11187446 3300009553 Bacteria 834
65 Ga0099796_10030432 3300010159 Bacteria 1751
66 Ga0099796_10181514 3300010159 Bacteria 845
67 Ga0105239_10051169 3300010375 Bacteria 4528
68 Ga0105239_10879404 3300010375 Bacteria 1028
69 Ga0105246_10895584 3300011119 Bacteria 795
70 Ga0157373_10591193 3300013100 Bacteria 807
71 Ga0157370_10059157 3300013104 Bacteria 3642
72 Ga0157369_10404939 3300013105 Bacteria 1415
73 Ga0157374_10236489 3300013296 Bacteria 1795
74 Ga0163162_10375923 3300013306 Bacteria 1554
75 Ga0157375_11735536 3300013308 Unclassified 739
76 Ga0163163_10001643 3300014325 Bacteria 18815
77 Ga0163163_10218703 3300014325 Bacteria 1954
78 Ga0157380_10605540 3300014326 Unclassified 1085
79 Ga0157380_11218021 3300014326 Unclassified 797
80 Ga0157379_10121299 3300014968 Unclassified 2351
81 Ga0157376_11001051 3300014969 Bacteria 858
82 Ga0213873_10001287 3300021358 Bacteria 4127
83 Ga0213873_10001594 3300021358 Bacteria 3784
84 Ga0213873_10089158 3300021358 Bacteria 874
85 Ga0213872_10000669 3300021361 Bacteria 25970
86 Ga0213872_10007268 3300021361 Bacteria 5469
87 Ga0213872_10031686 3300021361 Bacteria 2423
88 Ga0213872_10045607 3300021361 Bacteria 1995
89 Ga0213874_10042493 3300021377 Bacteria 1366
90 Ga0213871_10002342 3300021441 Bacteria 3471
91 Ga0213871_10002721 3300021441 Bacteria 3296
92 Ga0213871_10033771 3300021441 Bacteria 1347
93 Ga0213871_10045996 3300021441 Bacteria 1184
94 Ga0207647_10322471 3300025904 Bacteria 877
95 Ga0207684_10007789 3300025910 Bacteria 9582
96 Ga0207654_10285882 3300025911 Unclassified 1117
97 Ga0207649_10801848 3300025920 Bacteria 735
98 Ga0207646_10002359 3300025922 Bacteria 22306
99 Ga0207646_10005399 3300025922 Bacteria 13447
100 Ga0207646_11066608 3300025922 Unclassified 712
101 Ga0207646_11811981 3300025922 Unclassified 522
102 Ga0207694_10461850 3300025924 Bacteria 1061
103 Ga0207650_10000005 3300025925 Bacteria 663190
104 Ga0207659_10731923 3300025926 Unclassified 848
105 Ga0207644_10233946 3300025931 Bacteria 1461
106 Ga0207711_10847028 3300025941 Bacteria 851
107 Ga0207711_10863054 3300025941 Bacteria 842
108 Ga0207667_12016067 3300025949 Unclassified 537
109 Ga0207651_11295320 3300025960 Unclassified 655
110 Ga0207703_10563660 3300026035 Bacteria 1075
111 Ga0207678_10007197 3300026067 Bacteria 9864
112 Ga0207641_10338775 3300026088 Bacteria 1431
113 Ga0207683_10744714 3300026121 Bacteria 909
114 Ga0209389_1000242 3300027296 Bacteria 35240
115 Ga0209489_102751 3300027361 Bacteria 35240
116 Ga0209179_1010541 3300027512 Bacteria 1614
117 Ga0209588_1000258 3300027671 Bacteria 14028
118 Ga0209588_1023999 3300027671 Bacteria 1925
119 Ga0209588_1103161 3300027671 Bacteria 917
120 Ga0209588_1172283 3300027671 Unclassified 681
121 Ga0209813_10438549 3300027866 Unclassified 532
122 Ga0268266_10001037 3300028379 Bacteria 34914
123 Ga0268266_10648502 3300028379 Bacteria 1016
124 Ga0268265_10136132 3300028380 Bacteria 2050
125 Ga0268264_10136535 3300028381 Unclassified 2181
126 Ga0373940_0193197 3300035088 Bacteria 666
127 Ga0373949_0025559 3300035090 Bacteria 1378
128 Ga0373952_0021475 3300035092 Bacteria 1363
129 Ga0373932_0037553 3300035112 Bacteria 1381
130 Ga0373939_0077793 3300035114 Bacteria 1095
131 Ga0373960_0005265 3300035121 Bacteria 2990
132 Ga0373961_0004998 3300035241 Bacteria 3186
133 Ga0373931_0002844 3300035691 Bacteria 7716
134 Ga0395900_0398966 3300037418 Unclassified 1340
135 Ga0395900_1857767 3300037418 Unclassified 513
136 Ga0395901_0796095 3300038443 Bacteria 935
137 Ga0436365_0462671 3300039437 Unclassified 790
138 Ga0436365_0648780 3300039437 Bacteria 741
139 Ga0436360_0312325 3300039438 Bacteria 577
140 Ga0436360_0608758 3300039438 Bacteria 5905
141 Ga0436360_0650530 3300039438 Bacteria 1461
142 Ga0436360_0914568 3300039438 Bacteria 14130
143 Ga0436360_1020421 3300039438 Bacteria 6961
144 Ga0436360_1084181 3300039438 Unclassified 832
145 Ga0436360_1130004 3300039438 Bacteria 2146
146 Ga0436360_1198409 3300039438 Bacteria 832
147 Ga0436360_1311932 3300039438 Unclassified 727
148 Ga0436361_0156387 3300039447 Bacteria 2341
149 Ga0436361_0170712 3300039447 Bacteria 1747
150 Ga0436361_0384722 3300039447 Bacteria 11499
151 Ga0436361_0484284 3300039447 Bacteria 530
152 Ga0436361_0546649 3300039447 Bacteria 567
153 Ga0436361_0782403 3300039447 Unclassified 1065
154 Ga0436361_0795914 3300039447 Bacteria 15178
155 Ga0436361_1020706 3300039447 Bacteria 66534
156 Ga0436361_1142409 3300039447 Bacteria 1820
157 Ga0436363_1116891 3300039450 Unclassified 1428
158 Ga0436362_0063915 3300039453 Bacteria 5363
159 Ga0436362_0462054 3300039453 Bacteria 13636
160 Ga0436362_0564693 3300039453 Bacteria 779
161 Ga0436362_0828585 3300039453 Bacteria 1940
162 Ga0436362_1051322 3300039453 Bacteria 8807
163 Ga0436362_1226127 3300039453 Bacteria 669
164 Ga0436362_1232264 3300039453 Bacteria 917
165 Ga0436362_1269762 3300039453 Unclassified 854
166 Ga0451789_0224449 3300041443 Bacteria 684
167 Ga0451855_1915907 3300041511 Unclassified 540
168 Ga0451853_1514959 3300041512 Unclassified 960
169 Ga0451853_2974777 3300041512 Unclassified 884
170 Ga0453683_1007890 3300044673 Unclassified 553
171 Ga0495629_0007889 3300046459 Bacteria 7832
172 Ga0495641_0065393 3300046461 Bacteria 1637
173 Ga0495651_0531561 3300046462 Bacteria 749
174 Ga0495653_0010215 3300046463 Bacteria 7684
175 Ga0495653_0026763 3300046463 Bacteria 4621
176 Ga0495650_0095908 3300046471 Bacteria 1120
177 Ga0495580_0011423 3300046472 Bacteria 6870
178 Ga0495580_0478173 3300046472 Bacteria 833
179 Ga0495582_0079732 3300046473 Bacteria 1817
180 Ga0495664_0037646 3300046477 Bacteria 2855
181 Ga0495606_0002033 3300046507 Bacteria 24798
182 Ga0495608_0231861 3300046511 Bacteria 1155
183 Ga0495618_0062200 3300046514 Bacteria 2368
184 Ga0495628_0017352 3300046516 Bacteria 5993
185 Ga0495628_0060957 3300046516 Bacteria 2959
186 Ga0495630_0131781 3300046517 Bacteria 1898
187 Ga0495666_0079515 3300046526 Bacteria 1552
188 Ga0495652_0140761 3300046529 Bacteria 1897
189 Ga0495654_0292719 3300046530 Bacteria 667
190 Ga0495665_0098189 3300046531 Bacteria 1537
191 Ga0495640_0128000 3300046533 Bacteria 1645
192 Ga0495586_0385332 3300046535 Bacteria 806
193 Ga0495645_0529266 3300046543 Bacteria 733
194 Ga0495667_0172990 3300046559 Bacteria 1387
195 Ga0495634_0183402 3300046642 Bacteria 1309
196 Ga0495625_0802961 3300046660 Unclassified 547
197 Ga0495635_0048164 3300046663 Bacteria 2938
198 Ga0495657_0109581 3300046675 Bacteria 1751
199 Ga0495623_0030623 3300046679 Bacteria 3461
200 Ga0495646_0007526 3300046680 Bacteria 6919
201 Ga0495646_0017659 3300046680 Bacteria 4523
202 Ga0495624_0003273 3300046690 Bacteria 12071
203 Ga0495624_0106453 3300046690 Bacteria 1725
204 Ga0495589_0043642 3300046794 Bacteria 2231
205 Ga0495600_0073898 3300046809 Bacteria 2226
206 Ga0495581_0000837 3300047315 Bacteria 16374
207 Ga0495604_0115123 3300047317 Bacteria 1954
208 Ga0495674_0142696 3300047319 Bacteria 2012
209 Ga0495672_0134093 3300047320 Bacteria 1300
210 Ga0495676_0026178 3300047321 Bacteria 5025
211 Ga0495676_0034795 3300047321 Bacteria 4222
212 Ga0495680_0032539 3300047322 Bacteria 4231
213 Ga0495683_0030905 3300047323 Bacteria 2730
214 Ga0495675_0017502 3300047444 Bacteria 4542
215 Ga0495684_0141192 3300047471 Bacteria 1806
216 Ga0495686_0126946 3300047472 Bacteria 1516
217 Ga0495593_0003331 3300047673 Bacteria 9628
218 Ga0495593_0020138 3300047673 Bacteria 3735
219 Ga0495602_0174654 3300048088 Bacteria 1663
220 Ga0495614_0009943 3300048089 Bacteria 4199
221 Ga0495614_0026856 3300048089 Bacteria 2482
222 Ga0496104_0037779 3300048907 Bacteria 4515
223 Ga0496106_0000034 3300048909 Bacteria 130368
224 Ga0496109_0093613 3300048912 Bacteria 2781
225 Ga0496109_0403602 3300048912 Bacteria 1291
226 Ga0496112_0043925 3300048915 Bacteria 4376
227 Ga0496114_1596132 3300048917 Bacteria 540
228 Ga0496119_0068961 3300048922 Bacteria 2080
229 Ga0496119_0127158 3300048922 Unclassified 1393
230 Ga0496120_0016035 3300048923 Bacteria 4912
231 Ga0496121_0010494 3300048924 Bacteria 10440
232 Ga0496124_0002691 3300048927 Bacteria 22735
233 Ga0496124_0348134 3300048927 Bacteria 1049
234 Ga0496125_0002454 3300048928 Bacteria 24086
235 Ga0496126_0011863 3300048929 Bacteria 8965
236 Ga0496126_0092623 3300048929 Bacteria 2655
237 nmdc:mga03n38_1338_c1 3300050490 Bacteria 6966
238 nmdc:mga0yw44_120649_c1 3300050492 Bacteria 1688
239 nmdc:mga04h51_18502_c1 3300050495 Bacteria 2053
240 nmdc:mga04h51_473021_c1 3300050495 Unclassified 532
241 nmdc:mga07m45_1618_c1 3300050496 Bacteria 10369
242 Ga0500595_021261 3300053119 Bacteria 2319
243 Ga0500568_0016194 3300053139 Bacteria 3320
244 Ga0500622_0002097 3300053156 Bacteria 14859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100066573 Ga0070675_1000665734 145
2 3300005445 Ga0070708_100418432 Ga0070708_1004184322 145
3 3300005455 Ga0070663_100020908 Ga0070663_1000209084 145
4 3300005456 Ga0070678_100746377 Ga0070678_1007463772 145
5 3300005467 Ga0070706_100215402 Ga0070706_1002154021 145
6 3300005471 Ga0070698_100089663 Ga0070698_1000896632 145
7 3300005471 Ga0070698_101394292 Ga0070698_1013942922 145
8 3300005518 Ga0070699_100231393 Ga0070699_1002313932 145
9 3300005518 Ga0070699_101579321 Ga0070699_1015793211 145
10 3300005548 Ga0070665_100093533 Ga0070665_1000935333 145
11 3300005548 Ga0070665_100279251 Ga0070665_1002792511 145
12 3300005548 Ga0070665_102184271 Ga0070665_1021842711 145
13 3300006028 Ga0070717_10001502 Ga0070717_100015024 145
14 3300006038 Ga0075365_10028697 Ga0075365_100286973 145
15 3300006048 Ga0075363_100011764 Ga0075363_1000117644 145
16 3300006178 Ga0075367_10767007 Ga0075367_107670071 145
17 3300006186 Ga0075369_10428515 Ga0075369_104285151 145
18 3300006237 Ga0097621_100424881 Ga0097621_1004248812 145
19 3300006353 Ga0075370_10017410 Ga0075370_100174101 145
20 3300006358 Ga0068871_100877872 Ga0068871_1008778722 145
21 3300007265 Ga0099794_10000728 Ga0099794_100007284 145
22 3300007265 Ga0099794_10022985 Ga0099794_100229854 145
23 3300007265 Ga0099794_10300594 Ga0099794_103005942 145
24 3300007788 Ga0099795_10015761 Ga0099795_100157612 145
25 3300007788 Ga0099795_10043039 Ga0099795_100430392 145
26 3300009101 Ga0105247_10056959 Ga0105247_100569592 145
27 3300009177 Ga0105248_10125547 Ga0105248_101255473 145
28 3300009545 Ga0105237_10502705 Ga0105237_105027053 145
29 3300009545 Ga0105237_11026828 Ga0105237_110268282 145
30 3300009551 Ga0105238_10094484 Ga0105238_100944842 145
31 3300009551 Ga0105238_10803568 Ga0105238_108035681 145
32 3300009553 Ga0105249_11187446 Ga0105249_111874461 145
33 3300010159 Ga0099796_10030432 Ga0099796_100304322 145
34 3300010159 Ga0099796_10181514 Ga0099796_101815142 145
35 3300011119 Ga0105246_10895584 Ga0105246_108955842 145
36 3300013105 Ga0157369_10404939 Ga0157369_104049393 145
37 3300013306 Ga0163162_10375923 Ga0163162_103759232 145
38 3300013308 Ga0157375_11735536 Ga0157375_117355362 145
39 3300014326 Ga0157380_10605540 Ga0157380_106055401 145
40 3300014326 Ga0157380_11218021 Ga0157380_112180211 145
41 3300014969 Ga0157376_11001051 Ga0157376_110010512 145
42 3300021358 Ga0213873_10001287 Ga0213873_100012872 145
43 3300021358 Ga0213873_10001594 Ga0213873_100015942 145
44 3300021358 Ga0213873_10089158 Ga0213873_100891582 145
45 3300021361 Ga0213872_10007268 Ga0213872_100072682 145
46 3300021361 Ga0213872_10031686 Ga0213872_100316861 145
47 3300021361 Ga0213872_10045607 Ga0213872_100456073 145
48 3300021377 Ga0213874_10042493 Ga0213874_100424932 145
49 3300021441 Ga0213871_10002342 Ga0213871_100023422 145
50 3300021441 Ga0213871_10002721 Ga0213871_100027212 145
51 3300021441 Ga0213871_10033771 Ga0213871_100337712 145
52 3300021441 Ga0213871_10045996 Ga0213871_100459962 145
53 3300025904 Ga0207647_10322471 Ga0207647_103224711 145
54 3300025920 Ga0207649_10801848 Ga0207649_108018482 145
55 3300025922 Ga0207646_11066608 Ga0207646_110666082 145
56 3300025924 Ga0207694_10461850 Ga0207694_104618502 145
57 3300025926 Ga0207659_10731923 Ga0207659_107319232 145
58 3300025931 Ga0207644_10233946 Ga0207644_102339461 145
59 3300025941 Ga0207711_10847028 Ga0207711_108470282 145
60 3300026067 Ga0207678_10007197 Ga0207678_100071977 145
61 3300026121 Ga0207683_10744714 Ga0207683_107447142 145
62 3300027296 Ga0209389_1000242 Ga0209389_100024224 145
63 3300027361 Ga0209489_102751 Ga0209489_10275124 145
64 3300027512 Ga0209179_1010541 Ga0209179_10105412 145
65 3300027671 Ga0209588_1000258 Ga0209588_10002588 145
66 3300027671 Ga0209588_1023999 Ga0209588_10239992 145
67 3300027671 Ga0209588_1103161 Ga0209588_11031611 145
68 3300027671 Ga0209588_1172283 Ga0209588_11722831 145
69 3300027866 Ga0209813_10438549 Ga0209813_104385491 145
70 3300028379 Ga0268266_10001037 Ga0268266_1000103720 145
71 3300028379 Ga0268266_10648502 Ga0268266_106485021 145
72 3300035088 Ga0373940_0193197 Ga0373940_0193197_113_550 145
73 3300035090 Ga0373949_0025559 Ga0373949_0025559_742_1179 145
74 3300035092 Ga0373952_0021475 Ga0373952_0021475_144_581 145
75 3300035112 Ga0373932_0037553 Ga0373932_0037553_753_1190 145
76 3300035114 Ga0373939_0077793 Ga0373939_0077793_103_540 145
77 3300035121 Ga0373960_0005265 Ga0373960_0005265_628_1065 145
78 3300035241 Ga0373961_0004998 Ga0373961_0004998_933_1370 145
79 3300035691 Ga0373931_0002844 Ga0373931_0002844_6223_6660 145
80 3300039437 Ga0436365_0648780 Ga0436365_0648780_242_679 145
81 3300039438 Ga0436360_0312325 Ga0436360_0312325_127_564 145
82 3300039438 Ga0436360_0608758 Ga0436360_0608758_5112_5549 145
83 3300039438 Ga0436360_0914568 Ga0436360_0914568_13489_13926 145
84 3300039438 Ga0436360_1020421 Ga0436360_1020421_850_1287 145
85 3300039438 Ga0436360_1084181 Ga0436360_1084181_159_596 145
86 3300039438 Ga0436360_1130004 Ga0436360_1130004_24_461 145
87 3300039438 Ga0436360_1198409 Ga0436360_1198409_11_448 145
88 3300039438 Ga0436360_1311932 Ga0436360_1311932_85_627 145
89 3300039447 Ga0436361_0156387 Ga0436361_0156387_46_483 145
90 3300039447 Ga0436361_0170712 Ga0436361_0170712_458_1000 145
91 3300039447 Ga0436361_0384722 Ga0436361_0384722_1211_1648 145
92 3300039447 Ga0436361_0484284 Ga0436361_0484284_53_490 145
93 3300039447 Ga0436361_0546649 Ga0436361_0546649_102_539 145
94 3300039447 Ga0436361_0782403 Ga0436361_0782403_522_959 145
95 3300039447 Ga0436361_0795914 Ga0436361_0795914_10055_10492 145
96 3300039450 Ga0436363_1116891 Ga0436363_1116891_856_1293 145
97 3300039453 Ga0436362_0063915 Ga0436362_0063915_110_547 145
98 3300039453 Ga0436362_0462054 Ga0436362_0462054_3622_4059 145
99 3300039453 Ga0436362_0564693 Ga0436362_0564693_94_531 145
100 3300039453 Ga0436362_0828585 Ga0436362_0828585_267_809 145
101 3300039453 Ga0436362_1226127 Ga0436362_1226127_207_644 145
102 3300039453 Ga0436362_1232264 Ga0436362_1232264_61_498 145
103 3300039453 Ga0436362_1269762 Ga0436362_1269762_87_629 145
104 3300041443 Ga0451789_0224449 Ga0451789_0224449_65_502 145
105 3300041511 Ga0451855_1915907 Ga0451855_1915907_79_522 145
106 3300041512 Ga0451853_1514959 Ga0451853_1514959_270_713 145
107 3300041512 Ga0451853_2974777 Ga0451853_2974777_42_479 145
108 3300044673 Ga0453683_1007890 Ga0453683_1007890_80_517 145
109 3300046459 Ga0495629_0007889 Ga0495629_0007889_545_982 145
110 3300046461 Ga0495641_0065393 Ga0495641_0065393_893_1330 145
111 3300046462 Ga0495651_0531561 Ga0495651_0531561_285_722 145
112 3300046463 Ga0495653_0010215 Ga0495653_0010215_2403_2903 145
113 3300046463 Ga0495653_0026763 Ga0495653_0026763_3397_3834 145
114 3300046471 Ga0495650_0095908 Ga0495650_0095908_400_837 145
115 3300046472 Ga0495580_0011423 Ga0495580_0011423_2916_3353 145
116 3300046472 Ga0495580_0478173 Ga0495580_0478173_286_786 145
117 3300046473 Ga0495582_0079732 Ga0495582_0079732_978_1415 145
118 3300046477 Ga0495664_0037646 Ga0495664_0037646_1893_2330 145
119 3300046507 Ga0495606_0002033 Ga0495606_0002033_6136_6573 145
120 3300046511 Ga0495608_0231861 Ga0495608_0231861_358_795 145
121 3300046514 Ga0495618_0062200 Ga0495618_0062200_1897_2334 145
122 3300046516 Ga0495628_0017352 Ga0495628_0017352_1294_1794 145
123 3300046516 Ga0495628_0060957 Ga0495628_0060957_719_1156 145
124 3300046517 Ga0495630_0131781 Ga0495630_0131781_1367_1804 145
125 3300046526 Ga0495666_0079515 Ga0495666_0079515_741_1178 145
126 3300046529 Ga0495652_0140761 Ga0495652_0140761_833_1270 145
127 3300046530 Ga0495654_0292719 Ga0495654_0292719_95_532 145
128 3300046531 Ga0495665_0098189 Ga0495665_0098189_250_687 145
129 3300046533 Ga0495640_0128000 Ga0495640_0128000_809_1246 145
130 3300046535 Ga0495586_0385332 Ga0495586_0385332_13_450 145
131 3300046543 Ga0495645_0529266 Ga0495645_0529266_39_476 145
132 3300046559 Ga0495667_0172990 Ga0495667_0172990_394_831 145
133 3300046642 Ga0495634_0183402 Ga0495634_0183402_285_722 145
134 3300046660 Ga0495625_0802961 Ga0495625_0802961_56_493 145
135 3300046663 Ga0495635_0048164 Ga0495635_0048164_395_832 145
136 3300046675 Ga0495657_0109581 Ga0495657_0109581_730_1167 145
137 3300046679 Ga0495623_0030623 Ga0495623_0030623_2237_2674 145
138 3300046680 Ga0495646_0007526 Ga0495646_0007526_5863_6300 145
139 3300046680 Ga0495646_0017659 Ga0495646_0017659_1303_1803 145
140 3300046690 Ga0495624_0003273 Ga0495624_0003273_6790_7290 145
141 3300046690 Ga0495624_0106453 Ga0495624_0106453_778_1215 145
142 3300046794 Ga0495589_0043642 Ga0495589_0043642_1210_1647 145
143 3300046809 Ga0495600_0073898 Ga0495600_0073898_145_582 145
144 3300047315 Ga0495581_0000837 Ga0495581_0000837_14095_14532 145
145 3300047317 Ga0495604_0115123 Ga0495604_0115123_1268_1705 145
146 3300047319 Ga0495674_0142696 Ga0495674_0142696_618_1055 145
147 3300047320 Ga0495672_0134093 Ga0495672_0134093_174_611 145
148 3300047321 Ga0495676_0026178 Ga0495676_0026178_2342_2842 145
149 3300047321 Ga0495676_0034795 Ga0495676_0034795_3522_3959 145
150 3300047322 Ga0495680_0032539 Ga0495680_0032539_1999_2436 145
151 3300047323 Ga0495683_0030905 Ga0495683_0030905_1989_2426 145
152 3300047444 Ga0495675_0017502 Ga0495675_0017502_2160_2597 145
153 3300047471 Ga0495684_0141192 Ga0495684_0141192_1170_1607 145
154 3300047472 Ga0495686_0126946 Ga0495686_0126946_26_463 145
155 3300047673 Ga0495593_0003331 Ga0495593_0003331_1574_2074 145
156 3300047673 Ga0495593_0020138 Ga0495593_0020138_2261_2698 145
157 3300048088 Ga0495602_0174654 Ga0495602_0174654_619_1056 145
158 3300048089 Ga0495614_0009943 Ga0495614_0009943_2194_2631 145
159 3300048089 Ga0495614_0026856 Ga0495614_0026856_582_1082 145
160 3300048907 Ga0496104_0037779 Ga0496104_0037779_4022_4459 145
161 3300048909 Ga0496106_0000034 Ga0496106_0000034_64127_64564 145
162 3300048912 Ga0496109_0093613 Ga0496109_0093613_427_864 145
163 3300048917 Ga0496114_1596132 Ga0496114_1596132_59_496 145
164 3300048922 Ga0496119_0068961 Ga0496119_0068961_1618_2055 145
165 3300048922 Ga0496119_0127158 Ga0496119_0127158_665_1102 145
166 3300048923 Ga0496120_0016035 Ga0496120_0016035_1920_2357 145
167 3300048924 Ga0496121_0010494 Ga0496121_0010494_5486_5923 145
168 3300048927 Ga0496124_0002691 Ga0496124_0002691_13335_13772 145
169 3300048927 Ga0496124_0348134 Ga0496124_0348134_504_941 145
170 3300048928 Ga0496125_0002454 Ga0496125_0002454_13749_14186 145
171 3300048929 Ga0496126_0011863 Ga0496126_0011863_3113_3550 145
172 3300050490 nmdc:mga03n38_1338_c1 nmdc:mga03n38_1338_c1_3984_4421 145
173 3300050492 nmdc:mga0yw44_120649_c1 nmdc:mga0yw44_120649_c1_460_897 145
174 3300050495 nmdc:mga04h51_18502_c1 nmdc:mga04h51_18502_c1_945_1382 145
175 3300050495 nmdc:mga04h51_473021_c1 nmdc:mga04h51_473021_c1_77_514 145
176 3300050496 nmdc:mga07m45_1618_c1 nmdc:mga07m45_1618_c1_9386_9823 145
177 3300053119 Ga0500595_021261 Ga0500595_021261_309_746 145
178 3300053139 Ga0500568_0016194 Ga0500568_0016194_1200_1637 145
179 3300053156 Ga0500622_0002097 Ga0500622_0002097_586_1023 145
180 3300005290 Ga0065712_10276964 Ga0065712_102769642 146
181 3300005336 Ga0070680_100224359 Ga0070680_1002243593 146
182 3300005364 Ga0070673_101670335 Ga0070673_1016703351 146
183 3300005367 Ga0070667_101353721 Ga0070667_1013537212 146
184 3300005530 Ga0070679_100162641 Ga0070679_1001626412 146
185 3300005563 Ga0068855_101526666 Ga0068855_1015266661 146
186 3300005841 Ga0068863_100124139 Ga0068863_1001241392 146
187 3300005841 Ga0068863_100596316 Ga0068863_1005963162 146
188 3300005843 Ga0068860_100213492 Ga0068860_1002134921 146
189 3300007265 Ga0099794_10213844 Ga0099794_102138441 146
190 3300009148 Ga0105243_10179961 Ga0105243_101799611 146
191 3300009177 Ga0105248_10550194 Ga0105248_105501942 146
192 3300010375 Ga0105239_10051169 Ga0105239_100511694 146
193 3300010375 Ga0105239_10879404 Ga0105239_108794042 146
194 3300013100 Ga0157373_10591193 Ga0157373_105911931 146
195 3300013104 Ga0157370_10059157 Ga0157370_100591572 146
196 3300013296 Ga0157374_10236489 Ga0157374_102364892 146
197 3300014325 Ga0163163_10218703 Ga0163163_102187032 146
198 3300014968 Ga0157379_10121299 Ga0157379_101212991 146
199 3300021361 Ga0213872_10000669 Ga0213872_1000066918 146
200 3300025941 Ga0207711_10863054 Ga0207711_108630542 146
201 3300025949 Ga0207667_12016067 Ga0207667_120160671 146
202 3300025960 Ga0207651_11295320 Ga0207651_112953201 146
203 3300028381 Ga0268264_10136535 Ga0268264_101365352 146
204 3300037418 Ga0395900_0398966 Ga0395900_0398966_687_1127 146
205 3300037418 Ga0395900_1857767 Ga0395900_1857767_60_500 146
206 3300038443 Ga0395901_0796095 Ga0395901_0796095_437_877 146
207 3300039437 Ga0436365_0462671 Ga0436365_0462671_120_560 146
208 3300039447 Ga0436361_1020706 Ga0436361_1020706_55836_56276 146
209 3300039447 Ga0436361_1142409 Ga0436361_1142409_764_1204 146
210 3300039453 Ga0436362_1051322 Ga0436362_1051322_798_1238 146
211 3300048912 Ga0496109_0403602 Ga0496109_0403602_195_635 146
212 3300048915 Ga0496112_0043925 Ga0496112_0043925_769_1209 146
213 3300048929 Ga0496126_0092623 Ga0496126_0092623_885_1325 146
214 3300002459 JGI24751J29686_10000296 JGI24751J29686_1000029612 147
215 3300005331 Ga0070670_100001499 Ga0070670_10000149912 147
216 3300005445 Ga0070708_100021796 Ga0070708_1000217965 147
217 3300005445 Ga0070708_100039212 Ga0070708_1000392123 147
218 3300005467 Ga0070706_100017376 Ga0070706_1000173763 147
219 3300005467 Ga0070706_100290944 Ga0070706_1002909443 147
220 3300005468 Ga0070707_100004608 Ga0070707_1000046089 147
221 3300005471 Ga0070698_100115964 Ga0070698_1001159643 147
222 3300005471 Ga0070698_100178276 Ga0070698_1001782764 147
223 3300005518 Ga0070699_100007454 Ga0070699_1000074548 147
224 3300005518 Ga0070699_100150020 Ga0070699_1001500201 147
225 3300005536 Ga0070697_100157239 Ga0070697_1001572393 147
226 3300005536 Ga0070697_100980601 Ga0070697_1009806012 147
227 3300005617 Ga0068859_100460448 Ga0068859_1004604482 147
228 3300005617 Ga0068859_101391373 Ga0068859_1013913731 147
229 3300005840 Ga0068870_10208136 Ga0068870_102081361 147
230 3300005842 Ga0068858_100972956 Ga0068858_1009729562 147
231 3300006931 Ga0097620_100460447 Ga0097620_1004604472 147
232 3300006931 Ga0097620_101391474 Ga0097620_1013914741 147
233 3300009177 Ga0105248_10069788 Ga0105248_100697882 147
234 3300014325 Ga0163163_10001643 Ga0163163_1000164311 147
235 3300025910 Ga0207684_10007789 Ga0207684_100077898 147
236 3300025911 Ga0207654_10285882 Ga0207654_102858822 147
237 3300025922 Ga0207646_10002359 Ga0207646_1000235911 147
238 3300025922 Ga0207646_10005399 Ga0207646_100053999 147
239 3300025922 Ga0207646_11811981 Ga0207646_118119811 147
240 3300025925 Ga0207650_10000005 Ga0207650_10000005476 147
241 3300026035 Ga0207703_10563660 Ga0207703_105636602 147
242 3300026088 Ga0207641_10338775 Ga0207641_103387752 147
243 3300028380 Ga0268265_10136132 Ga0268265_101361322 147
244 3300039438 Ga0436360_0650530 Ga0436360_0650530_952_1401 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

53

179

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.9427 19 145
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.9344 19 145
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.891 19 145
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8763 19 145
2hy5-assembly1.cif.gz_C crystal structure of dsrefh 0.8125 21 144
ID Description Score Start End Superfamily
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9374 19 145 3.40.1260.10
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9292 19 145 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8753 22 143 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8737 19 145 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8609 22 143 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A0Q6R3G9-F1-model_v4 Sulfur reduction protein DsrE 0.9975 56 145
AF-A0A0F2LMK6-F1-model_v4 Sulfur reductase DrsE 0.974 55 143
AF-A0A5B1BD16-F1-model_v4 DsrE family protein 0.9738 35 145
AF-A0A401K008-F1-model_v4 Uncharacterized protein 0.9566 4 145
AF-A0A3D0LU76-F1-model_v4 Uncharacterized protein 0.956 2 145

Feature Viewer

pLDDT pTM Quality
91.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map