F355992

General Info

Members Datasets Scaffolds Average Seq Length
243 189 486 203

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0014249|Ga0501069_0014249_943_1614
Length 223
Sequence VTTTRSPNLRCCIGLTGGIGSGKSSAARFFEELGASVIDTDAIAHELTAPGQPALTWIRERLGTACFDNTGALDRACLRRRVFTDAAARRELEAILHPLIRAETGARIAAARGAYVVLVVPLLLESGAYRALIHRIAVVDCDPETQVSRAVARSRLTPDEVRAIMRTQLPRNQRLEHADDIIANDGDLAALRRQVVELDHRYRALAATPKDSCETDNKLDHRR

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
183 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
184 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
185 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
186 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
187 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
188 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
189 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.41
Rhizoplane 3.7
Rhizosphere 90.53
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0014249 3300049585 Bacteria 4247
2 Ga0070670_100003026 3300005331 Bacteria 13907
3 Ga0070677_10025894 3300005333 Bacteria 2195
4 Ga0068869_100051147 3300005334 Bacteria 2997
5 Ga0070666_10017227 3300005335 Bacteria 4632
6 Ga0070680_100232914 3300005336 Bacteria 1556
7 Ga0070682_100588571 3300005337 Bacteria 877
8 Ga0068868_100005175 3300005338 Bacteria 9155
9 Ga0068868_100595337 3300005338 Bacteria 979
10 Ga0070661_100143227 3300005344 Bacteria 1802
11 Ga0070675_100002603 3300005354 Bacteria 13541
12 Ga0070674_100032592 3300005356 Bacteria 3461
13 Ga0070673_100113978 3300005364 Bacteria 2245
14 Ga0070667_100239170 3300005367 Bacteria 1621
15 Ga0070714_100001996 3300005435 Bacteria 14913
16 Ga0070705_100237115 3300005440 Bacteria 1272
17 Ga0070694_100170631 3300005444 Bacteria 1602
18 Ga0070678_100267869 3300005456 Bacteria 1439
19 Ga0070662_100427672 3300005457 Bacteria 1096
20 Ga0070681_10021992 3300005458 Bacteria 6399
21 Ga0070681_10099300 3300005458 Bacteria 2857
22 Ga0070706_100189634 3300005467 Bacteria 1921
23 Ga0070699_100038529 3300005518 Bacteria 4139
24 Ga0070697_100005790 3300005536 Bacteria 9531
25 Ga0068853_100047579 3300005539 Bacteria 3681
26 Ga0070672_100014995 3300005543 Bacteria 5506
27 Ga0070695_100001380 3300005545 Bacteria 13483
28 Ga0070696_100000395 3300005546 Bacteria 26958
29 Ga0070693_100221551 3300005547 Bacteria 1240
30 Ga0070704_100166143 3300005549 Bacteria 1750
31 Ga0068855_100401992 3300005563 Bacteria 1501
32 Ga0068856_100243637 3300005614 Bacteria 1813
33 Ga0070702_100020468 3300005615 Bacteria 3467
34 Ga0068852_100087331 3300005616 Bacteria 2782
35 Ga0068852_100642173 3300005616 Bacteria 1068
36 Ga0068864_100031868 3300005618 Bacteria 4475
37 Ga0068851_10054012 3300005834 Bacteria 2046
38 Ga0068870_10202121 3300005840 Bacteria 1205
39 Ga0068870_10263484 3300005840 Bacteria 1073
40 Ga0068858_100154387 3300005842 Bacteria 2159
41 Ga0068860_100162354 3300005843 Bacteria 2155
42 Ga0075364_10012362 3300006051 Bacteria 5219
43 Ga0075364_10021876 3300006051 Bacteria 4033
44 Ga0070716_100136933 3300006173 Bacteria 1556
45 Ga0097621_100006813 3300006237 Bacteria 8117
46 Ga0097621_100395035 3300006237 Bacteria 1237
47 Ga0097621_100556814 3300006237 Bacteria 1044
48 Ga0075434_100002533 3300006871 Bacteria 16119
49 Ga0075429_100375771 3300006880 Bacteria 1244
50 Ga0075436_100000989 3300006914 Bacteria 19059
51 Ga0075436_100002087 3300006914 Bacteria 13796
52 Ga0079104_1001246 3300006946 Bacteria 17777
53 Ga0075435_100000193 3300007076 Bacteria 36806
54 Ga0075435_100292739 3300007076 Bacteria 1391
55 Ga0111539_10007683 3300009094 Bacteria 13774
56 Ga0111539_10489364 3300009094 Bacteria 1433
57 Ga0105245_10372675 3300009098 Bacteria 1420
58 Ga0105237_10050061 3300009545 Bacteria 4199
59 Ga0105238_10076233 3300009551 Bacteria 3344
60 Ga0105249_10051098 3300009553 Bacteria 3770
61 Ga0105239_10524456 3300010375 Bacteria 1348
62 Ga0157370_10003438 3300013104 Bacteria 18595
63 Ga0157374_10000028 3300013296 Bacteria 213725
64 Ga0157374_10000173 3300013296 Bacteria 59752
65 Ga0157374_10143871 3300013296 Bacteria 2316
66 Ga0157378_10106742 3300013297 Bacteria 2562
67 Ga0157378_10147183 3300013297 Bacteria 2192
68 Ga0157380_10599368 3300014326 Bacteria 1090
69 Ga0157377_10049750 3300014745 Bacteria 2357
70 Ga0157377_10129503 3300014745 Bacteria 1539
71 Ga0157379_10448293 3300014968 Bacteria 1191
72 Ga0157376_10088833 3300014969 Bacteria 2671
73 Ga0163161_10099994 3300017792 Bacteria 2157
74 Ga0213872_10005728 3300021361 Bacteria 6327
75 Ga0209672_103990 3300025228 Bacteria 2868
76 Ga0207653_10012280 3300025885 Bacteria 2674
77 Ga0207680_10043500 3300025903 Bacteria 2635
78 Ga0207643_10198794 3300025908 Bacteria 1220
79 Ga0207705_10612722 3300025909 Bacteria 847
80 Ga0207707_10098412 3300025912 Bacteria 2557
81 Ga0207707_10292630 3300025912 Bacteria 1409
82 Ga0207657_10695736 3300025919 Unclassified 790
83 Ga0207649_10045428 3300025920 Bacteria 2693
84 Ga0207659_10673052 3300025926 Bacteria 885
85 Ga0207687_10351749 3300025927 Unclassified 1200
86 Ga0207664_10003403 3300025929 Bacteria 10595
87 Ga0207706_10076308 3300025933 Bacteria 2948
88 Ga0207669_10047397 3300025937 Bacteria 2546
89 Ga0207665_10054810 3300025939 Bacteria 2689
90 Ga0207691_10001965 3300025940 Bacteria 20102
91 Ga0207711_10068570 3300025941 Bacteria 3072
92 Ga0207689_10037959 3300025942 Bacteria 3992
93 Ga0207689_10600362 3300025942 Bacteria 926
94 Ga0207679_10004648 3300025945 Bacteria 8547
95 Ga0207667_10768327 3300025949 Bacteria 962
96 Ga0207651_10067493 3300025960 Bacteria 2517
97 Ga0207651_10070659 3300025960 Bacteria 2471
98 Ga0207658_10534948 3300025986 Bacteria 1047
99 Ga0207703_10088938 3300026035 Bacteria 2593
100 Ga0207639_10009524 3300026041 Bacteria 6706
101 Ga0207678_10666829 3300026067 Bacteria 914
102 Ga0207678_11280819 3300026067 Unclassified 649
103 Ga0207702_10077228 3300026078 Bacteria 2880
104 Ga0207676_10024078 3300026095 Bacteria 4502
105 Ga0207676_10129063 3300026095 Bacteria 2146
106 Ga0207674_10065805 3300026116 Bacteria 3653
107 Ga0207428_10180474 3300027907 Bacteria 1595
108 Ga0265318_10030691 3300028577 Bacteria 2089
109 Ga0265330_10219598 3300031235 Bacteria 802
110 Ga0265332_10002997 3300031238 Bacteria 8286
111 Ga0265328_10000946 3300031239 Bacteria 13330
112 Ga0265339_10154797 3300031249 Bacteria 1157
113 Ga0265331_10001329 3300031250 Bacteria 18302
114 Ga0265331_10009149 3300031250 Bacteria 5588
115 Ga0265327_10000307 3300031251 Bacteria 95145
116 Ga0265327_10000542 3300031251 Bacteria 64581
117 Ga0265316_10143696 3300031344 Bacteria 1790
118 Ga0265314_10002443 3300031711 Bacteria 19012
119 Ga0265342_10020092 3300031712 Bacteria 4292
120 Ga0316576_10072512 3300031727 Bacteria 2542
121 Ga0316583_10003016 3300032133 Bacteria 5914
122 Ga0373953_0093747 3300035117 Bacteria 1258
123 Ga0373954_0000939 3300035118 Bacteria 11343
124 Ga0373946_0085097 3300035171 Bacteria 1392
125 Ga0373931_0248828 3300035691 Bacteria 1080
126 Ga0373931_0273580 3300035691 Bacteria 1035
127 Ga0373935_0001120 3300035692 Bacteria 14625
128 Ga0373937_0019936 3300036401 Bacteria 6006
129 Ga0436361_0268202 3300039447 Bacteria 49775
130 Ga0451853_4019260 3300041512 Bacteria 2149
131 Ga0439441_000066 3300042001 Bacteria 8045
132 Ga0439446_0189107 3300042156 Bacteria 691
133 Ga0451577_0000402 3300042876 Bacteria 78514
134 Ga0451577_0017981 3300042876 Bacteria 6518
135 Ga0451577_0038934 3300042876 Bacteria 4273
136 Ga0451577_0046085 3300042876 Bacteria 3901
137 Ga0451577_0516277 3300042876 Bacteria 1085
138 Ga0451577_0809534 3300042876 Unclassified 846
139 Ga0451577_0954475 3300042876 Bacteria 771
140 Ga0453684_0000063 3300044712 Bacteria 486079
141 Ga0453684_0000065 3300044712 Bacteria 468481
142 Ga0453684_0002276 3300044712 Bacteria 47408
143 Ga0453684_0170691 3300044712 Bacteria 2563
144 Ga0453684_0402618 3300044712 Bacteria 1532
145 Ga0453684_0412999 3300044712 Unclassified 1509
146 Ga0451576_0000006 3300045051 Bacteria 949698
147 Ga0451576_0000928 3300045051 Bacteria 55281
148 Ga0451576_0023770 3300045051 Bacteria 6632
149 Ga0451576_0168396 3300045051 Bacteria 2286
150 Ga0451576_0366414 3300045051 Bacteria 1509
151 Ga0451576_0373313 3300045051 Bacteria 1494
152 Ga0451576_1233461 3300045051 Bacteria 780
153 Ga0495592_0000402 3300046454 Bacteria 33287
154 Ga0495651_0021626 3300046462 Bacteria 5000
155 Ga0495608_0001458 3300046511 Bacteria 16807
156 Ga0495628_0001323 3300046516 Bacteria 22719
157 Ga0495628_0001365 3300046516 Bacteria 22367
158 Ga0495666_0049812 3300046526 Bacteria 2014
159 Ga0495652_0031771 3300046529 Bacteria 4621
160 Ga0495652_0073450 3300046529 Bacteria 2848
161 Ga0495652_0200629 3300046529 Bacteria 1514
162 Ga0495640_0001475 3300046533 Bacteria 18518
163 Ga0495586_0004208 3300046535 Bacteria 7709
164 Ga0495587_0005053 3300046536 Bacteria 8632
165 Ga0495587_0056378 3300046536 Bacteria 2312
166 Ga0495598_0055079 3300046537 Bacteria 1210
167 Ga0495645_0130274 3300046543 Bacteria 1763
168 Ga0495667_0000929 3300046559 Bacteria 18958
169 Ga0495634_0004749 3300046642 Bacteria 10571
170 Ga0495635_0201844 3300046663 Bacteria 1348
171 Ga0495599_0022184 3300046678 Bacteria 3963
172 Ga0495623_0036991 3300046679 Bacteria 3126
173 Ga0495646_0072234 3300046680 Bacteria 2029
174 Ga0495658_0077196 3300046683 Bacteria 1947
175 Ga0495613_0003024 3300046689 Bacteria 12577
176 Ga0495624_0004534 3300046690 Bacteria 10151
177 Ga0495600_0006471 3300046809 Bacteria 7132
178 Ga0495581_0139460 3300047315 Bacteria 1414
179 Ga0495604_0001290 3300047317 Bacteria 20493
180 Ga0495680_0000735 3300047322 Bacteria 36769
181 Ga0495684_0140004 3300047471 Bacteria 1814
182 Ga0496101_0827523 3300048904 Bacteria 730
183 Ga0496104_0423859 3300048907 Bacteria 1242
184 Ga0496105_0522873 3300048908 Bacteria 929
185 Ga0496106_0363062 3300048909 Bacteria 1163
186 Ga0496108_0100551 3300048911 Bacteria 2466
187 Ga0496109_0029895 3300048912 Bacteria 4882
188 Ga0496110_0100434 3300048913 Bacteria 2593
189 Ga0496112_0337387 3300048915 Bacteria 1451
190 Ga0496114_0061778 3300048917 Bacteria 3134
191 Ga0496121_0031239 3300048924 Bacteria 4870
192 Ga0496124_0000007 3300048927 Bacteria 883534
193 Ga0501032_0000306 3300049569 Bacteria 41367
194 Ga0501033_0007242 3300049570 Bacteria 8656
195 Ga0501034_0001385 3300049571 Bacteria 32621
196 Ga0501036_0000487 3300049572 Bacteria 28375
197 Ga0501037_0000868 3300049573 Bacteria 22587
198 Ga0501038_0004594 3300049574 Bacteria 12845
199 Ga0501039_0012954 3300049575 Bacteria 6375
200 Ga0501040_0000121 3300049576 Bacteria 41506
201 Ga0501042_0000089 3300049578 Bacteria 35548
202 Ga0501043_0000665 3300049579 Bacteria 30366
203 Ga0501043_0679971 3300049579 Unclassified 753
204 Ga0501046_0001686 3300049580 Bacteria 21120
205 Ga0501047_0007839 3300049581 Bacteria 10060
206 Ga0501048_0002466 3300049582 Bacteria 14121
207 Ga0501068_0000533 3300049584 Bacteria 19224
208 Ga0501068_0000711 3300049584 Bacteria 17044
209 Ga0501069_0069490 3300049585 Bacteria 1972
210 Ga0501070_0027035 3300049586 Bacteria 4813
211 Ga0501073_0000403 3300049589 Bacteria 29490
212 Ga0501073_0279599 3300049589 Bacteria 1152
213 Ga0501074_0006847 3300049590 Bacteria 8235
214 Ga0501074_0085352 3300049590 Bacteria 2262
215 Ga0501077_0309750 3300049593 Unclassified 1006
216 Ga0501080_0000762 3300049742 Bacteria 26133
217 Ga0501080_0174996 3300049742 Bacteria 1978
218 Ga0501080_0257255 3300049742 Bacteria 1591
219 Ga0501080_0716305 3300049742 Bacteria 882
220 Ga0501083_0071765 3300049744 Bacteria 2302
221 Ga0501035_0001288 3300049822 Bacteria 25883
222 Ga0501035_0559293 3300049822 Bacteria 936
223 Ga0501044_0001318 3300049823 Bacteria 29197
224 Ga0501045_0001772 3300049824 Bacteria 14572
225 nmdc:mga00v17_33631_c1 3300050491 Bacteria 3039
226 nmdc:mga00v17_9431_c1 3300050491 Bacteria 5282
227 nmdc:mga09592_780236_c1 3300050508 Bacteria 809
228 nmdc:mga06r32_81444_c1 3300050510 Bacteria 3152
229 nmdc:mga08y16_7909_c1 3300050511 Bacteria 11126
230 nmdc:mga0n895_458_c1 3300050512 Bacteria 27351
231 nmdc:mga0rr50_156_c1 3300050513 Bacteria 36930
232 nmdc:mga08x19_341_c1 3300050514 Bacteria 33752
233 nmdc:mga08x19_7621_c1 3300050514 Bacteria 6430
234 nmdc:mga0a205_299_c1 3300050515 Bacteria 36719
235 Ga0500566_0106366 3300053094 Bacteria 1531
236 Ga0500618_000463 3300053125 Bacteria 26408
237 2511386078 2511231026 Bacteria 5225445
238 2526213361 2526164512 Bacteria 4025691
239 2547374300 2547132103 Bacteria 5115736
240 2574432521 2574179768 Bacteria 4907129
241 2843694836 2843690924 Bacteria 5169057
242 2998345698 2998344455 Bacteria 4222996
243 639785847 639633007 Bacteria 4376040
244 Ga0501069_0014249
245 Ga0070670_100003026
246 Ga0070677_10025894
247 Ga0068869_100051147
248 Ga0070666_10017227
249 Ga0070680_100232914
250 Ga0070682_100588571
251 Ga0068868_100005175
252 Ga0068868_100595337
253 Ga0070661_100143227
254 Ga0070675_100002603
255 Ga0070674_100032592
256 Ga0070673_100113978
257 Ga0070667_100239170
258 Ga0070714_100001996
259 Ga0070705_100237115
260 Ga0070694_100170631
261 Ga0070678_100267869
262 Ga0070662_100427672
263 Ga0070681_10021992
264 Ga0070681_10099300
265 Ga0070706_100189634
266 Ga0070699_100038529
267 Ga0070697_100005790
268 Ga0068853_100047579
269 Ga0070672_100014995
270 Ga0070695_100001380
271 Ga0070696_100000395
272 Ga0070693_100221551
273 Ga0070704_100166143
274 Ga0068855_100401992
275 Ga0068856_100243637
276 Ga0070702_100020468
277 Ga0068852_100087331
278 Ga0068852_100642173
279 Ga0068864_100031868
280 Ga0068851_10054012
281 Ga0068870_10202121
282 Ga0068870_10263484
283 Ga0068858_100154387
284 Ga0068860_100162354
285 Ga0075364_10012362
286 Ga0075364_10021876
287 Ga0070716_100136933
288 Ga0097621_100006813
289 Ga0097621_100395035
290 Ga0097621_100556814
291 Ga0075434_100002533
292 Ga0075429_100375771
293 Ga0075436_100000989
294 Ga0075436_100002087
295 Ga0079104_1001246
296 Ga0075435_100000193
297 Ga0075435_100292739
298 Ga0111539_10007683
299 Ga0111539_10489364
300 Ga0105245_10372675
301 Ga0105237_10050061
302 Ga0105238_10076233
303 Ga0105249_10051098
304 Ga0105239_10524456
305 Ga0157370_10003438
306 Ga0157374_10000028
307 Ga0157374_10000173
308 Ga0157374_10143871
309 Ga0157378_10106742
310 Ga0157378_10147183
311 Ga0157380_10599368
312 Ga0157377_10049750
313 Ga0157377_10129503
314 Ga0157379_10448293
315 Ga0157376_10088833
316 Ga0163161_10099994
317 Ga0213872_10005728
318 Ga0209672_103990
319 Ga0207653_10012280
320 Ga0207680_10043500
321 Ga0207643_10198794
322 Ga0207705_10612722
323 Ga0207707_10098412
324 Ga0207707_10292630
325 Ga0207657_10695736
326 Ga0207649_10045428
327 Ga0207659_10673052
328 Ga0207687_10351749
329 Ga0207664_10003403
330 Ga0207706_10076308
331 Ga0207669_10047397
332 Ga0207665_10054810
333 Ga0207691_10001965
334 Ga0207711_10068570
335 Ga0207689_10037959
336 Ga0207689_10600362
337 Ga0207679_10004648
338 Ga0207667_10768327
339 Ga0207651_10067493
340 Ga0207651_10070659
341 Ga0207658_10534948
342 Ga0207703_10088938
343 Ga0207639_10009524
344 Ga0207678_10666829
345 Ga0207678_11280819
346 Ga0207702_10077228
347 Ga0207676_10024078
348 Ga0207676_10129063
349 Ga0207674_10065805
350 Ga0207428_10180474
351 Ga0265318_10030691
352 Ga0265330_10219598
353 Ga0265332_10002997
354 Ga0265328_10000946
355 Ga0265339_10154797
356 Ga0265331_10001329
357 Ga0265331_10009149
358 Ga0265327_10000307
359 Ga0265327_10000542
360 Ga0265316_10143696
361 Ga0265314_10002443
362 Ga0265342_10020092
363 Ga0316576_10072512
364 Ga0316583_10003016
365 Ga0373953_0093747
366 Ga0373954_0000939
367 Ga0373946_0085097
368 Ga0373931_0248828
369 Ga0373931_0273580
370 Ga0373935_0001120
371 Ga0373937_0019936
372 Ga0436361_0268202
373 Ga0451853_4019260
374 Ga0439441_000066
375 Ga0439446_0189107
376 Ga0451577_0000402
377 Ga0451577_0017981
378 Ga0451577_0038934
379 Ga0451577_0046085
380 Ga0451577_0516277
381 Ga0451577_0809534
382 Ga0451577_0954475
383 Ga0453684_0000063
384 Ga0453684_0000065
385 Ga0453684_0002276
386 Ga0453684_0170691
387 Ga0453684_0402618
388 Ga0453684_0412999
389 Ga0451576_0000006
390 Ga0451576_0000928
391 Ga0451576_0023770
392 Ga0451576_0168396
393 Ga0451576_0366414
394 Ga0451576_0373313
395 Ga0451576_1233461
396 Ga0495592_0000402
397 Ga0495651_0021626
398 Ga0495608_0001458
399 Ga0495628_0001323
400 Ga0495628_0001365
401 Ga0495666_0049812
402 Ga0495652_0031771
403 Ga0495652_0073450
404 Ga0495652_0200629
405 Ga0495640_0001475
406 Ga0495586_0004208
407 Ga0495587_0005053
408 Ga0495587_0056378
409 Ga0495598_0055079
410 Ga0495645_0130274
411 Ga0495667_0000929
412 Ga0495634_0004749
413 Ga0495635_0201844
414 Ga0495599_0022184
415 Ga0495623_0036991
416 Ga0495646_0072234
417 Ga0495658_0077196
418 Ga0495613_0003024
419 Ga0495624_0004534
420 Ga0495600_0006471
421 Ga0495581_0139460
422 Ga0495604_0001290
423 Ga0495680_0000735
424 Ga0495684_0140004
425 Ga0496101_0827523
426 Ga0496104_0423859
427 Ga0496105_0522873
428 Ga0496106_0363062
429 Ga0496108_0100551
430 Ga0496109_0029895
431 Ga0496110_0100434
432 Ga0496112_0337387
433 Ga0496114_0061778
434 Ga0496121_0031239
435 Ga0496124_0000007
436 Ga0501032_0000306
437 Ga0501033_0007242
438 Ga0501034_0001385
439 Ga0501036_0000487
440 Ga0501037_0000868
441 Ga0501038_0004594
442 Ga0501039_0012954
443 Ga0501040_0000121
444 Ga0501042_0000089
445 Ga0501043_0000665
446 Ga0501043_0679971
447 Ga0501046_0001686
448 Ga0501047_0007839
449 Ga0501048_0002466
450 Ga0501068_0000533
451 Ga0501068_0000711
452 Ga0501069_0069490
453 Ga0501070_0027035
454 Ga0501073_0000403
455 Ga0501073_0279599
456 Ga0501074_0006847
457 Ga0501074_0085352
458 Ga0501077_0309750
459 Ga0501080_0000762
460 Ga0501080_0174996
461 Ga0501080_0257255
462 Ga0501080_0716305
463 Ga0501083_0071765
464 Ga0501035_0001288
465 Ga0501035_0559293
466 Ga0501044_0001318
467 Ga0501045_0001772
468 nmdc:mga00v17_33631_c1
469 nmdc:mga00v17_9431_c1
470 nmdc:mga09592_780236_c1
471 nmdc:mga06r32_81444_c1
472 nmdc:mga08y16_7909_c1
473 nmdc:mga0n895_458_c1
474 nmdc:mga0rr50_156_c1
475 nmdc:mga08x19_341_c1
476 nmdc:mga08x19_7621_c1
477 nmdc:mga0a205_299_c1
478 Ga0500566_0106366
479 Ga0500618_000463
480 2511386078
481 2526213361
482 2547374300
483 2574432521
484 2843694836
485 2998345698
486 639785847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

11

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i1u-assembly1.cif.gz_A apo crystal structure of a dephospho-coa kinase from burkholderia vietnamiensis 0.9303 2 204
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.9236 1 203
1n3b-assembly1.cif.gz_A crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.9193 1 207
2f6r-assembly1.cif.gz_A crystal structure of bifunctional coenzyme a synthase (coa synthase): (18044849) from mus musculus at 1.70 a resolution 0.9178 2 197
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.9131 1 207
ID Description Score Start End Superfamily
af_Q4D748_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9556 116 199 3.40.50.300
af_Q9VI57_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9532 3 199 3.40.50.300
af_P34558_5_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9523 3 198 3.40.50.300
af_Q13057_357_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.948 1 194 3.40.50.300
af_Q2FXP1_1_198_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9478 1 197 3.40.50.300
ID Description Score Start End GO Terms
AF-Q46X10-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9913 3 205 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A6M4H4H7-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9894 1 199 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A494GA06-F1-model_v4 Dephospho-CoA kinase 0.985 3 206 GO:0004140
GO:0005524
GO:0005737
GO:0015937
GO:0051301
AF-H1SEB0-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.985 3 203 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A151QD71-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9831 2 203 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Map