F355975

General Info

Members Datasets Scaffolds Average Seq Length
243 185 486 117

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0024849|Ga0501034_0024849_5472_5891
Length 139
Sequence MNDLTVYGIPNCDTVKKARAWLDARQRPYRFHDFKKAGVPEARLPRWIAQAGWEKLVNRQGTTWRKLPPESQARIQDAASATRLMLDQPSLIKRPVVEWPDGGVTVGFNEAVWAEKLSADAPARQPKSPPGSCPPPAAR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
66 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
158 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
159 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
160 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
161 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
162 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
163 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
164 2643221660 Methylibium sp. Root1272 Isolate Unclassified
165 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
166 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
167 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
168 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
169 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
170 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
171 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
172 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
173 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
174 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
175 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
176 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
177 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
178 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
179 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
180 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
181 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
182 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
183 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
184 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
185 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.07
Metatranscriptomes 0
Isolates 11.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.58
Nodule 9.05
Rhizoplane 3.7
Rhizosphere 65.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0024849 3300049571 Bacteria 6095
2 JGI25406J46586_10007299 3300003203 Bacteria 5057
3 JGI25153J46596_10016678 3300003215 Bacteria 2928
4 rootL2_10018915 3300003322 Bacteria 1723
5 Ga0055528_1043019 3300003790 Bacteria 987
6 Ga0070668_101299571 3300005347 Bacteria 661
7 Ga0070671_100131668 3300005355 Bacteria 2106
8 Ga0070659_100001737 3300005366 Bacteria 15653
9 Ga0070710_10588457 3300005437 Bacteria 773
10 Ga0068856_102195318 3300005614 Bacteria 561
11 Ga0068859_100792440 3300005617 Bacteria 1036
12 Ga0068864_100070737 3300005618 Bacteria 3036
13 Ga0068860_102259649 3300005843 Bacteria 565
14 Ga0081540_1041887 3300005983 Bacteria 2369
15 Ga0081540_1078132 3300005983 Bacteria 1502
16 Ga0081539_10001457 3300005985 Bacteria 40268
17 Ga0075365_10155982 3300006038 Bacteria 1589
18 Ga0075363_100055723 3300006048 Bacteria 2118
19 Ga0075363_100079362 3300006048 Bacteria 1793
20 Ga0075364_10167814 3300006051 Bacteria 1483
21 Ga0075369_10170404 3300006186 Bacteria 999
22 Ga0068871_101756342 3300006358 Bacteria 589
23 Ga0075430_100077506 3300006846 Bacteria 2786
24 Ga0075433_11040670 3300006852 Bacteria 713
25 Ga0075434_100007392 3300006871 Bacteria 10173
26 Ga0075434_101266709 3300006871 Bacteria 749
27 Ga0075429_100000167 3300006880 Bacteria 42008
28 Ga0075435_100087994 3300007076 Bacteria 2560
29 Ga0099795_10003482 3300007788 Bacteria 3902
30 Ga0105240_11105387 3300009093 Bacteria 843
31 Ga0111539_10136480 3300009094 Bacteria 2873
32 Ga0105243_11390906 3300009148 Bacteria 722
33 Ga0105248_10081176 3300009177 Bacteria 3645
34 Ga0105249_10064582 3300009553 Bacteria 3366
35 Ga0105249_12189863 3300009553 Bacteria 626
36 Ga0157378_10505062 3300013297 Bacteria 1208
37 Ga0157380_11686446 3300014326 Bacteria 691
38 Ga0213873_10215126 3300021358 Bacteria 600
39 Ga0213872_10001238 3300021361 Bacteria 17233
40 Ga0213872_10099046 3300021361 Bacteria 1300
41 Ga0213872_10156917 3300021361 Bacteria 991
42 Ga0213876_10007809 3300021384 Bacteria 5804
43 Ga0213876_10505515 3300021384 Bacteria 643
44 Ga0213875_10003596 3300021388 Bacteria 8774
45 Ga0209129_1002846 3300025258 Bacteria 7995
46 Ga0209673_1009942 3300025273 Bacteria 4062
47 Ga0209564_1006552 3300025295 Bacteria 6255
48 Ga0209758_1006596 3300025297 Bacteria 8231
49 Ga0209256_1017581 3300025299 Bacteria 2366
50 Ga0209051_1012822 3300025303 Bacteria 4032
51 Ga0207699_11245104 3300025906 Bacteria 551
52 Ga0207684_10125323 3300025910 Bacteria 2204
53 Ga0207690_10028481 3300025932 Bacteria 3541
54 Ga0207668_11273941 3300025972 Bacteria 661
55 Ga0207676_10368066 3300026095 Bacteria 1334
56 Ga0209813_10287956 3300027866 Bacteria 634
57 Ga0207428_10387137 3300027907 Bacteria 1025
58 Ga0265330_10434788 3300031235 Bacteria 556
59 Ga0307408_100000213 3300031548 Bacteria 61855
60 Ga0307406_10004684 3300031901 Bacteria 7454
61 Ga0307415_100760106 3300032126 Bacteria 881
62 Ga0373943_0319928 3300035170 Bacteria 884
63 Ga0373961_0375832 3300035241 Bacteria 541
64 Ga0395899_0425408 3300037312 Bacteria 874
65 Ga0395898_0172419 3300037466 Bacteria 2068
66 Ga0395905_0409491 3300037471 Bacteria 1251
67 Ga0395901_0082509 3300038443 Bacteria 3359
68 Ga0395901_0088383 3300038443 Bacteria 3241
69 Ga0436365_0172938 3300039437 Bacteria 773
70 Ga0436365_0261616 3300039437 Bacteria 624
71 Ga0436365_1293339 3300039437 Bacteria 704
72 Ga0436361_0060214 3300039447 Bacteria 7615
73 Ga0436361_0589776 3300039447 Bacteria 1754
74 Ga0436361_0824908 3300039447 Bacteria 7441
75 Ga0451802_2034463 3300041460 Bacteria 537
76 Ga0439448_0164910 3300042005 Bacteria 772
77 Ga0450920_096444 3300042122 Bacteria 612
78 Ga0450918_000119 3300042531 Bacteria 16684
79 Ga0451576_2000222 3300045051 Bacteria 597
80 Ga0466967_1456977 3300045976 Bacteria 682
81 Ga0495617_166445 3300046452 Bacteria 697
82 Ga0495603_0091168 3300046455 Bacteria 1782
83 Ga0495603_0777007 3300046455 Bacteria 547
84 Ga0495638_0000484 3300046460 Bacteria 47792
85 Ga0495638_0008425 3300046460 Bacteria 7314
86 Ga0495650_0150894 3300046471 Bacteria 834
87 Ga0495605_0012438 3300046474 Bacteria 4722
88 Ga0495584_0137205 3300046491 Bacteria 1242
89 Ga0495596_0144293 3300046500 Bacteria 925
90 Ga0495607_0275998 3300046501 Bacteria 799
91 Ga0495583_0035746 3300046506 Bacteria 2368
92 Ga0495606_0083678 3300046507 Bacteria 1978
93 Ga0495620_0151314 3300046515 Bacteria 904
94 Ga0495631_0007380 3300046518 Bacteria 5593
95 Ga0495637_0185331 3300046520 Bacteria 770
96 Ga0495654_0055999 3300046530 Bacteria 1907
97 Ga0495609_0040546 3300046538 Bacteria 2095
98 Ga0495609_0240842 3300046538 Bacteria 747
99 Ga0495597_0003090 3300046542 Bacteria 10018
100 Ga0495597_0250214 3300046542 Bacteria 697
101 Ga0495633_0006679 3300046558 Bacteria 6794
102 Ga0495668_0006098 3300046616 Bacteria 7980
103 Ga0495668_0170683 3300046616 Bacteria 1192
104 Ga0495611_0080735 3300046648 Bacteria 1495
105 Ga0495611_0276146 3300046648 Bacteria 777
106 Ga0495625_0003025 3300046660 Bacteria 17248
107 Ga0495625_0006705 3300046660 Bacteria 10209
108 Ga0495661_0378128 3300046665 Bacteria 692
109 Ga0495671_0033538 3300046692 Bacteria 2615
110 Ga0495672_0024299 3300047320 Bacteria 3907
111 Ga0495683_0079956 3300047323 Bacteria 1596
112 Ga0496102_0506401 3300048905 Bacteria 1130
113 Ga0496104_0515968 3300048907 Bacteria 1106
114 Ga0496106_0000858 3300048909 Bacteria 22078
115 Ga0496108_0103544 3300048911 Bacteria 2429
116 Ga0496110_0893789 3300048913 Bacteria 794
117 Ga0496111_1278196 3300048914 Bacteria 518
118 Ga0496112_0005552 3300048915 Bacteria 10929
119 Ga0496113_0093062 3300048916 Bacteria 2326
120 Ga0496121_0000374 3300048924 Bacteria 92048
121 Ga0496121_0624175 3300048924 Bacteria 661
122 Ga0496122_0528257 3300048925 Bacteria 567
123 Ga0496123_0439954 3300048926 Bacteria 583
124 Ga0496124_0000125 3300048927 Bacteria 159942
125 Ga0496125_0012554 3300048928 Bacteria 8397
126 Ga0496125_0131173 3300048928 Bacteria 1764
127 Ga0495678_024117 3300049459 Bacteria 2632
128 Ga0501031_0134586 3300049568 Bacteria 1614
129 Ga0501031_0281576 3300049568 Bacteria 1078
130 Ga0501031_0522068 3300049568 Bacteria 765
131 Ga0501032_0092558 3300049569 Bacteria 2005
132 Ga0501032_0187746 3300049569 Bacteria 1351
133 Ga0501032_0405397 3300049569 Bacteria 875
134 Ga0501032_0795091 3300049569 Bacteria 597
135 Ga0501033_0004584 3300049570 Bacteria 11071
136 Ga0501033_0318543 3300049570 Bacteria 1092
137 Ga0501034_0170939 3300049571 Bacteria 2140
138 Ga0501034_0256142 3300049571 Bacteria 1693
139 Ga0501034_0283340 3300049571 Bacteria 1596
140 Ga0501034_1498820 3300049571 Bacteria 548
141 Ga0501036_0185541 3300049572 Bacteria 1750
142 Ga0501037_0018585 3300049573 Bacteria 5123
143 Ga0501037_0068154 3300049573 Bacteria 2590
144 Ga0501037_0253658 3300049573 Bacteria 1230
145 Ga0501037_0351841 3300049573 Bacteria 1016
146 Ga0501037_0413827 3300049573 Bacteria 923
147 Ga0501037_0581599 3300049573 Bacteria 753
148 Ga0501038_0101680 3300049574 Bacteria 2392
149 Ga0501038_0159845 3300049574 Bacteria 1831
150 Ga0501038_0179781 3300049574 Bacteria 1707
151 Ga0501038_0726092 3300049574 Bacteria 742
152 Ga0501039_0085532 3300049575 Bacteria 2456
153 Ga0501039_0121698 3300049575 Bacteria 2045
154 Ga0501039_0415606 3300049575 Bacteria 1056
155 Ga0501040_0133491 3300049576 Bacteria 1746
156 Ga0501043_0021609 3300049579 Bacteria 5045
157 Ga0501043_0236327 3300049579 Bacteria 1410
158 Ga0501043_0327277 3300049579 Bacteria 1167
159 Ga0501046_0013971 3300049580 Bacteria 6783
160 Ga0501046_0531899 3300049580 Bacteria 839
161 Ga0501047_0228376 3300049581 Bacteria 1715
162 Ga0501047_0269143 3300049581 Bacteria 1550
163 Ga0501047_0579070 3300049581 Bacteria 945
164 Ga0501047_0583393 3300049581 Bacteria 940
165 Ga0501067_0078811 3300049583 Bacteria 1825
166 Ga0501068_0607351 3300049584 Bacteria 713
167 Ga0501069_0030065 3300049585 Bacteria 2983
168 Ga0501070_0265494 3300049586 Bacteria 1402
169 Ga0501071_0343286 3300049587 Bacteria 1136
170 Ga0501071_1052337 3300049587 Bacteria 629
171 Ga0501072_0615877 3300049588 Bacteria 855
172 Ga0501073_0020039 3300049589 Bacteria 4822
173 Ga0501074_0281804 3300049590 Bacteria 1181
174 Ga0501075_0690642 3300049591 Bacteria 778
175 Ga0501080_0148647 3300049742 Bacteria 2166
176 Ga0501083_0026044 3300049744 Bacteria 4045
177 Ga0501265_098281 3300049762 Bacteria 532
178 Ga0501035_0007782 3300049822 Bacteria 10012
179 Ga0501035_0220571 3300049822 Bacteria 1619
180 Ga0501035_0503563 3300049822 Bacteria 996
181 Ga0501035_0551885 3300049822 Bacteria 944
182 Ga0501035_0612836 3300049822 Bacteria 886
183 Ga0501035_1155081 3300049822 Bacteria 602
184 Ga0501044_0031142 3300049823 Bacteria 5616
185 Ga0501044_0049394 3300049823 Bacteria 4343
186 Ga0501045_0048136 3300049824 Bacteria 3107
187 nmdc:mga03683_249165_c1 3300050489 Bacteria 824
188 nmdc:mga03n38_652593_c1 3300050490 Bacteria 603
189 nmdc:mga00v17_222244_c1 3300050491 Bacteria 1223
190 nmdc:mga04h51_323790_c1 3300050495 Bacteria 632
191 nmdc:mga09592_1007_c1 3300050508 Bacteria 22372
192 nmdc:mga0qj67_46758_c1 3300050509 Bacteria 3417
193 nmdc:mga06r32_483576_c1 3300050510 Bacteria 1216
194 nmdc:mga0n895_1210929_c1 3300050512 Bacteria 729
195 nmdc:mga0rr50_73737_c1 3300050513 Bacteria 2610
196 nmdc:mga0a205_10001_c1 3300050515 Bacteria 8702
197 Ga0500646_0060380 3300053090 Bacteria 1115
198 Ga0500651_0513868 3300053093 Bacteria 659
199 Ga0500650_0049006 3300053098 Bacteria 1960
200 Ga0500555_000894 3300053103 Bacteria 10599
201 Ga0500562_126612 3300053108 Bacteria 696
202 Ga0500569_025655 3300053109 Bacteria 1607
203 Ga0500568_0001527 3300053139 Bacteria 14735
204 Ga0500588_0383790 3300053146 Bacteria 535
205 Ga0500604_0011679 3300053151 Bacteria 2363
206 Ga0500616_0000202 3300053153 Bacteria 97657
207 Ga0500616_0002800 3300053153 Bacteria 14047
208 Ga0500616_0012848 3300053153 Bacteria 4884
209 Ga0500616_0086242 3300053153 Bacteria 1566
210 Ga0500627_0439080 3300053158 Bacteria 551
211 Ga0500645_000053 3300053730 Bacteria 95820
212 Ga0501084_0468961 3300054114 Bacteria 1064
213 Ga0501084_1061775 3300054114 Bacteria 680
214 Ga0501082_0022541 3300060353 Bacteria 5423
215 2510135760 2510065019 Bacteria 6903379
216 2515741099 2515154134 Bacteria 7220242
217 2517038544 2516653077 Bacteria 7555578
218 2517078810 2516653085 Bacteria 7346596
219 2585523858 2585427526 Bacteria 7258840
220 2644237583 2643221643 Bacteria 5749658
221 2644245476 2643221644 Bacteria 6865017
222 2644340183 2643221660 Bacteria 4208257
223 2766063247 2765235942 Bacteria 7445910
224 2776916157 2775507049 Bacteria 6284736
225 2838689758 2838686498 Bacteria 7807632
226 2838731546 2838729681 Bacteria 7400765
227 2838744487 2838742623 Bacteria 7396178
228 2841853027 2841851746 Bacteria 7532261
229 2842160354 2842156927 Bacteria 6894975
230 2842165668 2842163707 Bacteria 6916235
231 2842183980 2842180545 Bacteria 6888678
232 2842231562 2842229732 Bacteria 7475766
233 2842245969 2842243621 Bacteria 7421798
234 2842260347 2842257432 Bacteria 7401195
235 2842273758 2842271015 Bacteria 7807131
236 2842308379 2842304105 Bacteria 7023636
237 2844456506 2844454524 Bacteria 7952546
238 2932426228 2932422444 Bacteria 4678430
239 2933574828 2933570622 Bacteria 7023390
240 2935902407 2935901341 Bacteria 7341747
241 8005310337 8005307578 Bacteria 7395396
242 8023681186 8023680758 Bacteria 7729763
243 8024479781 8024479707 Bacteria 6954785
244 Ga0501034_0024849
245 JGI25406J46586_10007299
246 JGI25153J46596_10016678
247 rootL2_10018915
248 Ga0055528_1043019
249 Ga0070668_101299571
250 Ga0070671_100131668
251 Ga0070659_100001737
252 Ga0070710_10588457
253 Ga0068856_102195318
254 Ga0068859_100792440
255 Ga0068864_100070737
256 Ga0068860_102259649
257 Ga0081540_1041887
258 Ga0081540_1078132
259 Ga0081539_10001457
260 Ga0075365_10155982
261 Ga0075363_100055723
262 Ga0075363_100079362
263 Ga0075364_10167814
264 Ga0075369_10170404
265 Ga0068871_101756342
266 Ga0075430_100077506
267 Ga0075433_11040670
268 Ga0075434_100007392
269 Ga0075434_101266709
270 Ga0075429_100000167
271 Ga0075435_100087994
272 Ga0099795_10003482
273 Ga0105240_11105387
274 Ga0111539_10136480
275 Ga0105243_11390906
276 Ga0105248_10081176
277 Ga0105249_10064582
278 Ga0105249_12189863
279 Ga0157378_10505062
280 Ga0157380_11686446
281 Ga0213873_10215126
282 Ga0213872_10001238
283 Ga0213872_10099046
284 Ga0213872_10156917
285 Ga0213876_10007809
286 Ga0213876_10505515
287 Ga0213875_10003596
288 Ga0209129_1002846
289 Ga0209673_1009942
290 Ga0209564_1006552
291 Ga0209758_1006596
292 Ga0209256_1017581
293 Ga0209051_1012822
294 Ga0207699_11245104
295 Ga0207684_10125323
296 Ga0207690_10028481
297 Ga0207668_11273941
298 Ga0207676_10368066
299 Ga0209813_10287956
300 Ga0207428_10387137
301 Ga0265330_10434788
302 Ga0307408_100000213
303 Ga0307406_10004684
304 Ga0307415_100760106
305 Ga0373943_0319928
306 Ga0373961_0375832
307 Ga0395899_0425408
308 Ga0395898_0172419
309 Ga0395905_0409491
310 Ga0395901_0082509
311 Ga0395901_0088383
312 Ga0436365_0172938
313 Ga0436365_0261616
314 Ga0436365_1293339
315 Ga0436361_0060214
316 Ga0436361_0589776
317 Ga0436361_0824908
318 Ga0451802_2034463
319 Ga0439448_0164910
320 Ga0450920_096444
321 Ga0450918_000119
322 Ga0451576_2000222
323 Ga0466967_1456977
324 Ga0495617_166445
325 Ga0495603_0091168
326 Ga0495603_0777007
327 Ga0495638_0000484
328 Ga0495638_0008425
329 Ga0495650_0150894
330 Ga0495605_0012438
331 Ga0495584_0137205
332 Ga0495596_0144293
333 Ga0495607_0275998
334 Ga0495583_0035746
335 Ga0495606_0083678
336 Ga0495620_0151314
337 Ga0495631_0007380
338 Ga0495637_0185331
339 Ga0495654_0055999
340 Ga0495609_0040546
341 Ga0495609_0240842
342 Ga0495597_0003090
343 Ga0495597_0250214
344 Ga0495633_0006679
345 Ga0495668_0006098
346 Ga0495668_0170683
347 Ga0495611_0080735
348 Ga0495611_0276146
349 Ga0495625_0003025
350 Ga0495625_0006705
351 Ga0495661_0378128
352 Ga0495671_0033538
353 Ga0495672_0024299
354 Ga0495683_0079956
355 Ga0496102_0506401
356 Ga0496104_0515968
357 Ga0496106_0000858
358 Ga0496108_0103544
359 Ga0496110_0893789
360 Ga0496111_1278196
361 Ga0496112_0005552
362 Ga0496113_0093062
363 Ga0496121_0000374
364 Ga0496121_0624175
365 Ga0496122_0528257
366 Ga0496123_0439954
367 Ga0496124_0000125
368 Ga0496125_0012554
369 Ga0496125_0131173
370 Ga0495678_024117
371 Ga0501031_0134586
372 Ga0501031_0281576
373 Ga0501031_0522068
374 Ga0501032_0092558
375 Ga0501032_0187746
376 Ga0501032_0405397
377 Ga0501032_0795091
378 Ga0501033_0004584
379 Ga0501033_0318543
380 Ga0501034_0170939
381 Ga0501034_0256142
382 Ga0501034_0283340
383 Ga0501034_1498820
384 Ga0501036_0185541
385 Ga0501037_0018585
386 Ga0501037_0068154
387 Ga0501037_0253658
388 Ga0501037_0351841
389 Ga0501037_0413827
390 Ga0501037_0581599
391 Ga0501038_0101680
392 Ga0501038_0159845
393 Ga0501038_0179781
394 Ga0501038_0726092
395 Ga0501039_0085532
396 Ga0501039_0121698
397 Ga0501039_0415606
398 Ga0501040_0133491
399 Ga0501043_0021609
400 Ga0501043_0236327
401 Ga0501043_0327277
402 Ga0501046_0013971
403 Ga0501046_0531899
404 Ga0501047_0228376
405 Ga0501047_0269143
406 Ga0501047_0579070
407 Ga0501047_0583393
408 Ga0501067_0078811
409 Ga0501068_0607351
410 Ga0501069_0030065
411 Ga0501070_0265494
412 Ga0501071_0343286
413 Ga0501071_1052337
414 Ga0501072_0615877
415 Ga0501073_0020039
416 Ga0501074_0281804
417 Ga0501075_0690642
418 Ga0501080_0148647
419 Ga0501083_0026044
420 Ga0501265_098281
421 Ga0501035_0007782
422 Ga0501035_0220571
423 Ga0501035_0503563
424 Ga0501035_0551885
425 Ga0501035_0612836
426 Ga0501035_1155081
427 Ga0501044_0031142
428 Ga0501044_0049394
429 Ga0501045_0048136
430 nmdc:mga03683_249165_c1
431 nmdc:mga03n38_652593_c1
432 nmdc:mga00v17_222244_c1
433 nmdc:mga04h51_323790_c1
434 nmdc:mga09592_1007_c1
435 nmdc:mga0qj67_46758_c1
436 nmdc:mga06r32_483576_c1
437 nmdc:mga0n895_1210929_c1
438 nmdc:mga0rr50_73737_c1
439 nmdc:mga0a205_10001_c1
440 Ga0500646_0060380
441 Ga0500651_0513868
442 Ga0500650_0049006
443 Ga0500555_000894
444 Ga0500562_126612
445 Ga0500569_025655
446 Ga0500568_0001527
447 Ga0500588_0383790
448 Ga0500604_0011679
449 Ga0500616_0000202
450 Ga0500616_0002800
451 Ga0500616_0012848
452 Ga0500616_0086242
453 Ga0500627_0439080
454 Ga0500645_000053
455 Ga0501084_0468961
456 Ga0501084_1061775
457 Ga0501082_0022541
458 2510135760
459 2515741099
460 2517038544
461 2517078810
462 2585523858
463 2644237583
464 2644245476
465 2644340183
466 2766063247
467 2776916157
468 2838689758
469 2838731546
470 2838744487
471 2841853027
472 2842160354
473 2842165668
474 2842183980
475 2842231562
476 2842245969
477 2842260347
478 2842273758
479 2842308379
480 2844456506
481 2932426228
482 2933574828
483 2935902407
484 8005310337
485 8023681186
486 8024479781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

7

116

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9518 12 122
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9446 12 42
6uih-assembly1.cif.gz_A crystal structure of the core domain from the gst-like protein gdap1 0.9237 12 41
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9199 12 122
7dro-assembly3.cif.gz_E structure of atp-grasp ligase psnb complexed with minimal precursor 0.9057 14 45
ID Description Score Start End Superfamily
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9495 13 122 3.40.30.10
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9495 12 122 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9475 14 42 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9447 13 41 3.40.30.10
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9446 12 42 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3B0X388-F1-model_v4 FIG138056: a glutathione-dependent thiol reductase 0.991 13 122
AF-A0A5C8P7V7-F1-model_v4 ArsC family reductase 0.9807 11 124
AF-A0A1W6VG45-F1-model_v4 deleted 0.98 12 124
AF-A0A5C5CR54-F1-model_v4 ArsC family reductase (Arsenate reductase (EC 1.20.4.1)) 0.9788 12 123
AF-G6XL66-F1-model_v4 Arsenate reductase 0.9787 12 127

Map