F355894

General Info

Members Datasets Scaffolds Average Seq Length
243 168 243 112

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0722898|Ga0495586_0722898_204_551
Length 115
Sequence MALYLFRFGYTPEAWAALIASPEDRRNNLASRIFGTFGGRLEGFWYSFGEHDGYALVDLPDTVAATAAXXXVSATGSFRHLETTVLITVDEMIEALGRAKEFDYARPGEAPPHIR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
107 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
108 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
111 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
112 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
165 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 4.94
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10706883 3300005328 Bacteria 736
2 Ga0070683_100506323 3300005329 Bacteria 1154
3 Ga0070680_100344198 3300005336 Unclassified 1267
4 Ga0070660_100323277 3300005339 Bacteria 1268
5 Ga0070661_100296376 3300005344 Bacteria 1258
6 Ga0070661_100397046 3300005344 Bacteria 1090
7 Ga0070674_100149628 3300005356 Bacteria 1760
8 Ga0070673_100538176 3300005364 Unclassified 1060
9 Ga0070694_100197535 3300005444 Bacteria 1497
10 Ga0070708_100082952 3300005445 Bacteria 2904
11 Ga0070663_100154285 3300005455 Bacteria 1763
12 Ga0070678_100241266 3300005456 Unclassified 1511
13 Ga0070681_10082984 3300005458 Bacteria 3159
14 Ga0070681_11153109 3300005458 Bacteria 696
15 Ga0070681_11453678 3300005458 Bacteria 610
16 Ga0068867_100302622 3300005459 Bacteria 1319
17 Ga0068867_100365329 3300005459 Bacteria 1208
18 Ga0070706_100007223 3300005467 Bacteria 10441
19 Ga0070707_100223941 3300005468 Bacteria 1831
20 Ga0070707_100338689 3300005468 Unclassified 1461
21 Ga0070707_100616533 3300005468 Bacteria 1047
22 Ga0070698_100037992 3300005471 Bacteria 4963
23 Ga0070698_100162751 3300005471 Unclassified 2175
24 Ga0070698_100192166 3300005471 Bacteria 1979
25 Ga0070699_100048547 3300005518 Bacteria 3674
26 Ga0070699_100054366 3300005518 Bacteria 3465
27 Ga0070684_100946503 3300005535 Bacteria 808
28 Ga0070697_100647609 3300005536 Unclassified 930
29 Ga0068853_100655534 3300005539 Bacteria 999
30 Ga0068853_102063975 3300005539 Unclassified 553
31 Ga0070696_100410201 3300005546 Bacteria 1062
32 Ga0070693_101424736 3300005547 Bacteria 539
33 Ga0070665_100405638 3300005548 Bacteria 1371
34 Ga0070664_100554878 3300005564 Bacteria 1062
35 Ga0068857_101320672 3300005577 Bacteria 700
36 Ga0068854_100756462 3300005578 Bacteria 843
37 Ga0068856_100003293 3300005614 Bacteria 16425
38 Ga0068859_100149761 3300005617 Bacteria 2409
39 Ga0068864_100151022 3300005618 Bacteria 2104
40 Ga0068866_10145789 3300005718 Bacteria 1365
41 Ga0081455_10070945 3300005937 Bacteria 2890
42 Ga0081538_10035423 3300005981 Bacteria 3279
43 Ga0075365_10094083 3300006038 Bacteria 2045
44 Ga0075364_11014029 3300006051 Unclassified 564
45 Ga0075432_10182755 3300006058 Bacteria 821
46 Ga0075367_10036931 3300006178 Bacteria 2835
47 Ga0075369_10227672 3300006186 Bacteria 863
48 Ga0068871_100476218 3300006358 Bacteria 1122
49 Ga0075428_100006010 3300006844 Bacteria 13486
50 Ga0075428_101473173 3300006844 Bacteria 713
51 Ga0075428_101543005 3300006844 Bacteria 695
52 Ga0075430_100031201 3300006846 Bacteria 4523
53 Ga0075430_100036446 3300006846 Bacteria 4171
54 Ga0075430_101304070 3300006846 Bacteria 597
55 Ga0075430_101479146 3300006846 Bacteria 558
56 Ga0075431_100008201 3300006847 Bacteria 10438
57 Ga0075431_100016953 3300006847 Bacteria 7398
58 Ga0075431_100159467 3300006847 Unclassified 2320
59 Ga0075431_100830465 3300006847 Bacteria 896
60 Ga0097620_100149759 3300006931 Bacteria 2409
61 Ga0111539_10076390 3300009094 Bacteria 3944
62 Ga0111539_10118089 3300009094 Bacteria 3109
63 Ga0111539_10311897 3300009094 Unclassified 1831
64 Ga0111539_10484980 3300009094 Bacteria 1440
65 Ga0114129_10000763 3300009147 Bacteria 41055
66 Ga0114129_10022509 3300009147 Bacteria 8942
67 Ga0105243_11796815 3300009148 Bacteria 644
68 Ga0105242_11040039 3300009176 Bacteria 829
69 Ga0105238_10382752 3300009551 Bacteria 1398
70 Ga0157373_11111598 3300013100 Bacteria 593
71 Ga0157369_10250271 3300013105 Unclassified 1849
72 Ga0157374_10927417 3300013296 Bacteria 889
73 Ga0163162_10187012 3300013306 Bacteria 2198
74 Ga0157372_10004848 3300013307 Bacteria 14304
75 Ga0157375_11675807 3300013308 Bacteria 753
76 Ga0157380_10030212 3300014326 Bacteria 4148
77 Ga0182008_10211543 3300014497 Bacteria 989
78 Ga0157376_11507651 3300014969 Bacteria 705
79 Ga0182007_10074883 3300015262 Bacteria 1109
80 Ga0163161_10410242 3300017792 Bacteria 1088
81 Ga0207645_11061424 3300025907 Unclassified 547
82 Ga0207684_10011568 3300025910 Bacteria 7712
83 Ga0207684_10126523 3300025910 Bacteria 2193
84 Ga0207707_11026325 3300025912 Bacteria 676
85 Ga0207660_10144955 3300025917 Bacteria 1819
86 Ga0207657_10448803 3300025919 Unclassified 1012
87 Ga0207646_10168354 3300025922 Bacteria 1978
88 Ga0207646_10519686 3300025922 Bacteria 1072
89 Ga0207669_10904345 3300025937 Bacteria 737
90 Ga0207661_10114659 3300025944 Bacteria 2285
91 Ga0207679_10363923 3300025945 Bacteria 1264
92 Ga0207651_10875781 3300025960 Bacteria 799
93 Ga0207651_11058305 3300025960 Unclassified 726
94 Ga0207640_10782612 3300025981 Bacteria 825
95 Ga0207678_10275867 3300026067 Bacteria 1442
96 Ga0207708_11864921 3300026075 Bacteria 527
97 Ga0207702_10130905 3300026078 Bacteria 2257
98 Ga0207641_11690173 3300026088 Unclassified 635
99 Ga0207648_10208561 3300026089 Bacteria 1734
100 Ga0207648_10261885 3300026089 Unclassified 1543
101 Ga0207674_11734786 3300026116 Bacteria 592
102 Ga0207683_10297335 3300026121 Unclassified 1477
103 Ga0207698_11629302 3300026142 Bacteria 661
104 Ga0209981_1052938 3300027378 Bacteria 616
105 Ga0209996_1008321 3300027395 Unclassified 1358
106 Ga0209995_1002246 3300027471 Bacteria 3042
107 Ga0209995_1007535 3300027471 Bacteria 1754
108 Ga0209968_1034826 3300027526 Bacteria 849
109 Ga0209999_1031836 3300027543 Bacteria 980
110 Ga0209999_1108993 3300027543 Bacteria 541
111 Ga0209983_1060488 3300027665 Bacteria 836
112 Ga0209966_1031892 3300027695 Bacteria 1071
113 Ga0209998_10063566 3300027717 Bacteria 872
114 Ga0209974_10115253 3300027876 Bacteria 948
115 Ga0209974_10373410 3300027876 Bacteria 556
116 Ga0207428_10007028 3300027907 Bacteria 10307
117 Ga0307408_100031169 3300031548 Bacteria 3711
118 Ga0307408_102487124 3300031548 Bacteria 503
119 Ga0307405_10001630 3300031731 Bacteria 9544
120 Ga0307405_10192814 3300031731 Bacteria 1473
121 Ga0307405_11185538 3300031731 Bacteria 660
122 Ga0307405_11498141 3300031731 Bacteria 593
123 Ga0307413_10164011 3300031824 Bacteria 1564
124 Ga0307413_10202420 3300031824 Bacteria 1435
125 Ga0307410_10017980 3300031852 Bacteria 4259
126 Ga0307410_10220873 3300031852 Bacteria 1458
127 Ga0307410_11135008 3300031852 Bacteria 679
128 Ga0307406_10005014 3300031901 Bacteria 7216
129 Ga0307406_10056696 3300031901 Bacteria 2510
130 Ga0307406_10236219 3300031901 Bacteria 1368
131 Ga0307406_12120448 3300031901 Bacteria 504
132 Ga0307407_10068925 3300031903 Bacteria 2097
133 Ga0307412_10013893 3300031911 Bacteria 4734
134 Ga0307412_10028268 3300031911 Bacteria 3506
135 Ga0307412_10733038 3300031911 Bacteria 851
136 Ga0307409_100031969 3300031995 Bacteria 3807
137 Ga0307409_100034884 3300031995 Bacteria 3681
138 Ga0307409_100070674 3300031995 Unclassified 2772
139 Ga0307409_100226405 3300031995 Bacteria 1692
140 Ga0307409_100454654 3300031995 Bacteria 1237
141 Ga0307409_102097700 3300031995 Bacteria 595
142 Ga0307416_100000515 3300032002 Bacteria 19795
143 Ga0307416_100019244 3300032002 Bacteria 4836
144 Ga0307416_100267439 3300032002 Bacteria 1676
145 Ga0307416_100378571 3300032002 Bacteria 1445
146 Ga0307416_100618159 3300032002 Bacteria 1165
147 Ga0307416_101660654 3300032002 Bacteria 744
148 Ga0307414_10656406 3300032004 Bacteria 946
149 Ga0307414_11077934 3300032004 Bacteria 741
150 Ga0307411_10014302 3300032005 Bacteria 4410
151 Ga0307411_10089964 3300032005 Bacteria 2140
152 Ga0307411_10834614 3300032005 Unclassified 814
153 Ga0307415_100013239 3300032126 Bacteria 4808
154 Ga0307415_100169983 3300032126 Bacteria 1699
155 Ga0307415_100605121 3300032126 Bacteria 976
156 Ga0395898_0549740 3300037466 Bacteria 1097
157 Ga0395905_0438367 3300037471 Bacteria 1204
158 Ga0395905_0917131 3300037471 Bacteria 779
159 Ga0395901_1764957 3300038443 Bacteria 569
160 Ga0439466_0115439 3300041411 Unclassified 831
161 Ga0439465_0202843 3300041413 Bacteria 723
162 Ga0451853_3542821 3300041512 Unclassified 625
163 Ga0439431_0268691 3300041997 Bacteria 509
164 Ga0439433_0159871 3300041999 Bacteria 583
165 Ga0439443_108763 3300042003 Bacteria 536
166 Ga0439449_0143805 3300042007 Bacteria 888
167 Ga0450888_010498 3300042126 Bacteria 1074
168 Ga0450898_107615 3300042134 Bacteria 587
169 Ga0450904_035955 3300042139 Bacteria 525
170 Ga0439434_0058524 3300042435 Bacteria 1203
171 Ga0450893_0003619 3300042532 Bacteria 2438
172 Ga0439440_0021814 3300042993 Bacteria 1447
173 Ga0466958_0198934 3300045836 Bacteria 1275
174 Ga0495630_1173801 3300046517 Bacteria 581
175 Ga0495586_0722898 3300046535 Bacteria 575
176 Ga0495625_0412399 3300046660 Bacteria 842
177 Ga0495615_0018272 3300048090 Bacteria 1541
178 Ga0496102_0715938 3300048905 Bacteria 924
179 Ga0496104_0029934 3300048907 Bacteria 5056
180 Ga0496105_0027824 3300048908 Bacteria 4622
181 Ga0496106_0257164 3300048909 Bacteria 1397
182 Ga0496109_0385895 3300048912 Bacteria 1323
183 Ga0496109_0897395 3300048912 Unclassified 824
184 Ga0496110_0042257 3300048913 Bacteria 3979
185 Ga0496111_0145809 3300048914 Bacteria 1755
186 Ga0496112_0381141 3300048915 Bacteria 1351
187 Ga0496112_0412680 3300048915 Bacteria 1289
188 Ga0496112_0832013 3300048915 Bacteria 847
189 Ga0496113_0334726 3300048916 Bacteria 1214
190 Ga0501032_0757787 3300049569 Bacteria 614
191 Ga0501033_0561609 3300049570 Bacteria 785
192 Ga0501034_1481473 3300049571 Bacteria 553
193 Ga0501036_0951747 3300049572 Bacteria 704
194 Ga0501037_0295723 3300049573 Bacteria 1125
195 Ga0501038_0080097 3300049574 Bacteria 2753
196 Ga0501039_0058694 3300049575 Bacteria 2980
197 Ga0501041_0041666 3300049577 Bacteria 2789
198 Ga0501042_0004788 3300049578 Bacteria 8643
199 Ga0501042_0401979 3300049578 Bacteria 992
200 Ga0501043_0156681 3300049579 Bacteria 1781
201 Ga0501046_0714590 3300049580 Bacteria 705
202 Ga0501048_0013101 3300049582 Bacteria 6156
203 Ga0501048_0618411 3300049582 Bacteria 778
204 Ga0501068_0923350 3300049584 Bacteria 575
205 Ga0501069_0354293 3300049585 Bacteria 865
206 Ga0501071_0023974 3300049587 Bacteria 4265
207 Ga0501072_0003539 3300049588 Bacteria 11748
208 Ga0501073_0956336 3300049589 Bacteria 589
209 Ga0501074_0223553 3300049590 Bacteria 1340
210 Ga0501074_0675884 3300049590 Bacteria 729
211 Ga0501075_0783120 3300049591 Bacteria 726
212 Ga0501076_0808324 3300049592 Bacteria 773
213 Ga0501077_0397816 3300049593 Bacteria 880
214 Ga0501243_035103 3300049675 Bacteria 867
215 Ga0501079_0016735 3300049741 Bacteria 5600
216 Ga0501079_0377289 3300049741 Bacteria 1112
217 Ga0501035_0077220 3300049822 Bacteria 2943
218 Ga0501035_0215374 3300049822 Bacteria 1642
219 Ga0501212_091551 3300049851 Bacteria 562
220 nmdc:mga03683_164286_c1 3300050489 Bacteria 1007
221 nmdc:mga00v17_785438_c1 3300050491 Unclassified 607
222 nmdc:mga0yw44_150111_c1 3300050492 Bacteria 1519
223 nmdc:mga0yw44_467182_c1 3300050492 Bacteria 855
224 nmdc:mga0yw44_84977_c1 3300050492 Bacteria 1990
225 nmdc:mga06z11_144709_c1 3300050494 Bacteria 1346
226 nmdc:mga05p37_54523_c1 3300050507 Bacteria 4919
227 nmdc:mga05p37_8540_c1 3300050507 Bacteria 12106
228 nmdc:mga09592_131249_c1 3300050508 Bacteria 2156
229 nmdc:mga0qj67_1038692_c1 3300050509 Bacteria 642
230 nmdc:mga0qj67_41287_c1 3300050509 Bacteria 3628
231 nmdc:mga0qj67_449171_c1 3300050509 Bacteria 1038
232 nmdc:mga06r32_472987_c1 3300050510 Bacteria 1232
233 nmdc:mga06r32_6810_c1 3300050510 Bacteria 10272
234 nmdc:mga06r32_730726_c1 3300050510 Bacteria 954
235 nmdc:mga08y16_1250966_c1 3300050511 Bacteria 711
236 nmdc:mga08y16_134328_c1 3300050511 Bacteria 2572
237 nmdc:mga08y16_962678_c1 3300050511 Bacteria 836
238 Ga0500604_0085046 3300053151 Bacteria 1027
239 Ga0500627_0143725 3300053158 Bacteria 1077
240 Ga0501084_0015918 3300054114 Bacteria 6238
241 Ga0501084_0168689 3300054114 Bacteria 1848
242 Ga0590077_151583 3300059426 Bacteria 555
243 Ga0530510_0909028 3300061734 Bacteria 673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100365329 Ga0068867_1003653292 107
2 3300005329 Ga0070683_100506323 Ga0070683_1005063232 108
3 3300005344 Ga0070661_100397046 Ga0070661_1003970462 108
4 3300005356 Ga0070674_100149628 Ga0070674_1001496282 108
5 3300005458 Ga0070681_11453678 Ga0070681_114536781 108
6 3300005459 Ga0068867_100302622 Ga0068867_1003026222 108
7 3300005471 Ga0070698_100192166 Ga0070698_1001921662 108
8 3300005518 Ga0070699_100048547 Ga0070699_1000485475 108
9 3300005535 Ga0070684_100946503 Ga0070684_1009465032 108
10 3300005718 Ga0068866_10145789 Ga0068866_101457892 108
11 3300005937 Ga0081455_10070945 Ga0081455_100709452 108
12 3300005981 Ga0081538_10035423 Ga0081538_100354233 108
13 3300006038 Ga0075365_10094083 Ga0075365_100940833 108
14 3300006058 Ga0075432_10182755 Ga0075432_101827551 108
15 3300006844 Ga0075428_100006010 Ga0075428_1000060102 108
16 3300006846 Ga0075430_100031201 Ga0075430_1000312012 108
17 3300006846 Ga0075430_100036446 Ga0075430_1000364463 108
18 3300006847 Ga0075431_100008201 Ga0075431_1000082017 108
19 3300006847 Ga0075431_100016953 Ga0075431_1000169536 108
20 3300009094 Ga0111539_10076390 Ga0111539_100763902 108
21 3300009094 Ga0111539_10118089 Ga0111539_101180893 108
22 3300009147 Ga0114129_10022509 Ga0114129_100225098 108
23 3300009148 Ga0105243_11796815 Ga0105243_117968152 108
24 3300009176 Ga0105242_11040039 Ga0105242_110400391 108
25 3300013100 Ga0157373_11111598 Ga0157373_111115981 108
26 3300014326 Ga0157380_10030212 Ga0157380_100302125 108
27 3300014497 Ga0182008_10211543 Ga0182008_102115433 108
28 3300015262 Ga0182007_10074883 Ga0182007_100748832 108
29 3300025912 Ga0207707_11026325 Ga0207707_110263251 108
30 3300025937 Ga0207669_10904345 Ga0207669_109043451 108
31 3300025944 Ga0207661_10114659 Ga0207661_101146591 108
32 3300025945 Ga0207679_10363923 Ga0207679_103639232 108
33 3300026075 Ga0207708_11864921 Ga0207708_118649211 108
34 3300026089 Ga0207648_10208561 Ga0207648_102085613 108
35 3300026116 Ga0207674_11734786 Ga0207674_117347862 108
36 3300027378 Ga0209981_1052938 Ga0209981_10529381 108
37 3300027395 Ga0209996_1008321 Ga0209996_10083211 108
38 3300027471 Ga0209995_1002246 Ga0209995_10022463 108
39 3300027526 Ga0209968_1034826 Ga0209968_10348261 108
40 3300027543 Ga0209999_1031836 Ga0209999_10318361 108
41 3300027665 Ga0209983_1060488 Ga0209983_10604881 108
42 3300027695 Ga0209966_1031892 Ga0209966_10318921 108
43 3300027907 Ga0207428_10007028 Ga0207428_100070289 108
44 3300031548 Ga0307408_102487124 Ga0307408_1024871242 108
45 3300031731 Ga0307405_10192814 Ga0307405_101928141 108
46 3300031824 Ga0307413_10202420 Ga0307413_102024202 108
47 3300031901 Ga0307406_10056696 Ga0307406_100566962 108
48 3300031901 Ga0307406_10236219 Ga0307406_102362192 108
49 3300031901 Ga0307406_12120448 Ga0307406_121204481 108
50 3300031911 Ga0307412_10028268 Ga0307412_100282683 108
51 3300031995 Ga0307409_100226405 Ga0307409_1002264052 108
52 3300031995 Ga0307409_100454654 Ga0307409_1004546542 108
53 3300032002 Ga0307416_100019244 Ga0307416_1000192442 108
54 3300032002 Ga0307416_101660654 Ga0307416_1016606541 108
55 3300032126 Ga0307415_100169983 Ga0307415_1001699832 108
56 3300037466 Ga0395898_0549740 Ga0395898_0549740_294_620 108
57 3300037471 Ga0395905_0438367 Ga0395905_0438367_171_497 108
58 3300037471 Ga0395905_0917131 Ga0395905_0917131_296_628 108
59 3300038443 Ga0395901_1764957 Ga0395901_1764957_72_398 108
60 3300045836 Ga0466958_0198934 Ga0466958_0198934_649_1005 108
61 3300049570 Ga0501033_0561609 Ga0501033_0561609_369_695 108
62 3300049571 Ga0501034_1481473 Ga0501034_1481473_44_370 108
63 3300049573 Ga0501037_0295723 Ga0501037_0295723_518_844 108
64 3300049574 Ga0501038_0080097 Ga0501038_0080097_403_729 108
65 3300049575 Ga0501039_0058694 Ga0501039_0058694_314_640 108
66 3300049577 Ga0501041_0041666 Ga0501041_0041666_367_693 108
67 3300049578 Ga0501042_0004788 Ga0501042_0004788_5836_6162 108
68 3300049578 Ga0501042_0401979 Ga0501042_0401979_581_907 108
69 3300049579 Ga0501043_0156681 Ga0501043_0156681_1016_1342 108
70 3300049580 Ga0501046_0714590 Ga0501046_0714590_95_421 108
71 3300049582 Ga0501048_0013101 Ga0501048_0013101_4960_5286 108
72 3300049582 Ga0501048_0618411 Ga0501048_0618411_393_719 108
73 3300049584 Ga0501068_0923350 Ga0501068_0923350_34_360 108
74 3300049585 Ga0501069_0354293 Ga0501069_0354293_461_787 108
75 3300049587 Ga0501071_0023974 Ga0501071_0023974_339_665 108
76 3300049588 Ga0501072_0003539 Ga0501072_0003539_11344_11670 108
77 3300049589 Ga0501073_0956336 Ga0501073_0956336_106_432 108
78 3300049590 Ga0501074_0223553 Ga0501074_0223553_730_1056 108
79 3300049592 Ga0501076_0808324 Ga0501076_0808324_342_668 108
80 3300049593 Ga0501077_0397816 Ga0501077_0397816_148_474 108
81 3300049741 Ga0501079_0016735 Ga0501079_0016735_2847_3173 108
82 3300049822 Ga0501035_0077220 Ga0501035_0077220_2304_2630 108
83 3300049822 Ga0501035_0215374 Ga0501035_0215374_678_1004 108
84 3300049851 Ga0501212_091551 Ga0501212_091551_209_535 108
85 3300050492 nmdc:mga0yw44_150111_c1 nmdc:mga0yw44_150111_c1_538_864 108
86 3300050507 nmdc:mga05p37_54523_c1 nmdc:mga05p37_54523_c1_2270_2596 108
87 3300050508 nmdc:mga09592_131249_c1 nmdc:mga09592_131249_c1_768_1094 108
88 3300050509 nmdc:mga0qj67_41287_c1 nmdc:mga0qj67_41287_c1_855_1184 108
89 3300050510 nmdc:mga06r32_472987_c1 nmdc:mga06r32_472987_c1_764_1090 108
90 3300050510 nmdc:mga06r32_6810_c1 nmdc:mga06r32_6810_c1_4055_4384 108
91 3300050511 nmdc:mga08y16_134328_c1 nmdc:mga08y16_134328_c1_1607_1933 108
92 3300050511 nmdc:mga08y16_962678_c1 nmdc:mga08y16_962678_c1_127_453 108
93 3300054114 Ga0501084_0015918 Ga0501084_0015918_5330_5656 108
94 3300005455 Ga0070663_100154285 Ga0070663_1001542852 109
95 3300026067 Ga0207678_10275867 Ga0207678_102758672 109
96 3300005364 Ga0070673_100538176 Ga0070673_1005381762 110
97 3300005445 Ga0070708_100082952 Ga0070708_1000829522 110
98 3300005456 Ga0070678_100241266 Ga0070678_1002412662 110
99 3300005458 Ga0070681_11153109 Ga0070681_111531092 110
100 3300005467 Ga0070706_100007223 Ga0070706_1000072236 110
101 3300005468 Ga0070707_100223941 Ga0070707_1002239412 110
102 3300005468 Ga0070707_100338689 Ga0070707_1003386891 110
103 3300005468 Ga0070707_100616533 Ga0070707_1006165331 110
104 3300005471 Ga0070698_100037992 Ga0070698_1000379922 110
105 3300005471 Ga0070698_100162751 Ga0070698_1001627513 110
106 3300005518 Ga0070699_100054366 Ga0070699_1000543661 110
107 3300005536 Ga0070697_100647609 Ga0070697_1006476092 110
108 3300005539 Ga0068853_102063975 Ga0068853_1020639751 110
109 3300005546 Ga0070696_100410201 Ga0070696_1004102011 110
110 3300006051 Ga0075364_11014029 Ga0075364_110140292 110
111 3300006178 Ga0075367_10036931 Ga0075367_100369314 110
112 3300006186 Ga0075369_10227672 Ga0075369_102276722 110
113 3300006844 Ga0075428_101543005 Ga0075428_1015430051 110
114 3300006846 Ga0075430_101479146 Ga0075430_1014791461 110
115 3300006847 Ga0075431_100159467 Ga0075431_1001594672 110
116 3300006847 Ga0075431_100830465 Ga0075431_1008304651 110
117 3300009094 Ga0111539_10311897 Ga0111539_103118972 110
118 3300009094 Ga0111539_10484980 Ga0111539_104849802 110
119 3300009147 Ga0114129_10000763 Ga0114129_1000076322 110
120 3300013308 Ga0157375_11675807 Ga0157375_116758071 110
121 3300014969 Ga0157376_11507651 Ga0157376_115076511 110
122 3300017792 Ga0163161_10410242 Ga0163161_104102422 110
123 3300025910 Ga0207684_10011568 Ga0207684_100115686 110
124 3300025910 Ga0207684_10126523 Ga0207684_101265232 110
125 3300025919 Ga0207657_10448803 Ga0207657_104488032 110
126 3300025922 Ga0207646_10168354 Ga0207646_101683545 110
127 3300025922 Ga0207646_10519686 Ga0207646_105196861 110
128 3300025960 Ga0207651_10875781 Ga0207651_108757812 110
129 3300025960 Ga0207651_11058305 Ga0207651_110583052 110
130 3300026121 Ga0207683_10297335 Ga0207683_102973352 110
131 3300027471 Ga0209995_1007535 Ga0209995_10075352 110
132 3300027543 Ga0209999_1108993 Ga0209999_11089931 110
133 3300027717 Ga0209998_10063566 Ga0209998_100635662 110
134 3300027876 Ga0209974_10115253 Ga0209974_101152531 110
135 3300027876 Ga0209974_10373410 Ga0209974_103734101 110
136 3300031548 Ga0307408_100031169 Ga0307408_1000311693 110
137 3300031731 Ga0307405_10001630 Ga0307405_100016307 110
138 3300031731 Ga0307405_11185538 Ga0307405_111855381 110
139 3300031731 Ga0307405_11498141 Ga0307405_114981411 110
140 3300031824 Ga0307413_10164011 Ga0307413_101640111 110
141 3300031852 Ga0307410_10017980 Ga0307410_100179803 110
142 3300031852 Ga0307410_10220873 Ga0307410_102208732 110
143 3300031852 Ga0307410_11135008 Ga0307410_111350082 110
144 3300031901 Ga0307406_10005014 Ga0307406_100050146 110
145 3300031903 Ga0307407_10068925 Ga0307407_100689252 110
146 3300031911 Ga0307412_10013893 Ga0307412_100138935 110
147 3300031911 Ga0307412_10733038 Ga0307412_107330381 110
148 3300031995 Ga0307409_100031969 Ga0307409_1000319695 110
149 3300031995 Ga0307409_100034884 Ga0307409_1000348844 110
150 3300031995 Ga0307409_100070674 Ga0307409_1000706742 110
151 3300031995 Ga0307409_102097700 Ga0307409_1020977001 110
152 3300032002 Ga0307416_100000515 Ga0307416_1000005153 110
153 3300032002 Ga0307416_100267439 Ga0307416_1002674392 110
154 3300032002 Ga0307416_100378571 Ga0307416_1003785712 110
155 3300032002 Ga0307416_100618159 Ga0307416_1006181592 110
156 3300032004 Ga0307414_10656406 Ga0307414_106564062 110
157 3300032004 Ga0307414_11077934 Ga0307414_110779341 110
158 3300032005 Ga0307411_10014302 Ga0307411_100143025 110
159 3300032005 Ga0307411_10089964 Ga0307411_100899643 110
160 3300032005 Ga0307411_10834614 Ga0307411_108346142 110
161 3300032126 Ga0307415_100013239 Ga0307415_1000132392 110
162 3300032126 Ga0307415_100605121 Ga0307415_1006051213 110
163 3300041411 Ga0439466_0115439 Ga0439466_0115439_69_401 110
164 3300041413 Ga0439465_0202843 Ga0439465_0202843_127_489 110
165 3300041997 Ga0439431_0268691 Ga0439431_0268691_50_412 110
166 3300041999 Ga0439433_0159871 Ga0439433_0159871_57_389 110
167 3300042003 Ga0439443_108763 Ga0439443_108763_145_477 110
168 3300042007 Ga0439449_0143805 Ga0439449_0143805_411_743 110
169 3300042126 Ga0450888_010498 Ga0450888_010498_391_723 110
170 3300042134 Ga0450898_107615 Ga0450898_107615_152_514 110
171 3300042139 Ga0450904_035955 Ga0450904_035955_148_480 110
172 3300042435 Ga0439434_0058524 Ga0439434_0058524_396_758 110
173 3300042532 Ga0450893_0003619 Ga0450893_0003619_1475_1807 110
174 3300042993 Ga0439440_0021814 Ga0439440_0021814_217_549 110
175 3300049572 Ga0501036_0951747 Ga0501036_0951747_26_388 110
176 3300049591 Ga0501075_0783120 Ga0501075_0783120_356_688 110
177 3300049675 Ga0501243_035103 Ga0501243_035103_302_634 110
178 3300049741 Ga0501079_0377289 Ga0501079_0377289_485_817 110
179 3300050489 nmdc:mga03683_164286_c1 nmdc:mga03683_164286_c1_513_935 110
180 3300050491 nmdc:mga00v17_785438_c1 nmdc:mga00v17_785438_c1_97_429 110
181 3300050492 nmdc:mga0yw44_467182_c1 nmdc:mga0yw44_467182_c1_504_836 110
182 3300050492 nmdc:mga0yw44_84977_c1 nmdc:mga0yw44_84977_c1_1464_1796 110
183 3300050494 nmdc:mga06z11_144709_c1 nmdc:mga06z11_144709_c1_460_864 110
184 3300050507 nmdc:mga05p37_8540_c1 nmdc:mga05p37_8540_c1_7701_8033 110
185 3300050509 nmdc:mga0qj67_449171_c1 nmdc:mga0qj67_449171_c1_425_757 110
186 3300050510 nmdc:mga06r32_730726_c1 nmdc:mga06r32_730726_c1_144_476 110
187 3300050511 nmdc:mga08y16_1250966_c1 nmdc:mga08y16_1250966_c1_117_449 110
188 3300053151 Ga0500604_0085046 Ga0500604_0085046_274_606 110
189 3300053158 Ga0500627_0143725 Ga0500627_0143725_352_684 110
190 3300059426 Ga0590077_151583 Ga0590077_151583_109_441 110
191 3300061734 Ga0530510_0909028 Ga0530510_0909028_54_386 110
192 3300005444 Ga0070694_100197535 Ga0070694_1001975352 111
193 3300046660 Ga0495625_0412399 Ga0495625_0412399_363_698 111
194 3300048090 Ga0495615_0018272 Ga0495615_0018272_304_639 111
195 3300048915 Ga0496112_0412680 Ga0496112_0412680_883_1224 111
196 3300006844 Ga0075428_101473173 Ga0075428_1014731731 112
197 3300006846 Ga0075430_101304070 Ga0075430_1013040702 112
198 3300041512 Ga0451853_3542821 Ga0451853_3542821_90_428 112
199 3300048907 Ga0496104_0029934 Ga0496104_0029934_2252_2590 112
200 3300048908 Ga0496105_0027824 Ga0496105_0027824_2211_2549 112
201 3300048912 Ga0496109_0385895 Ga0496109_0385895_493_831 112
202 3300048913 Ga0496110_0042257 Ga0496110_0042257_547_885 112
203 3300048914 Ga0496111_0145809 Ga0496111_0145809_406_744 112
204 3300048915 Ga0496112_0381141 Ga0496112_0381141_379_717 112
205 3300048916 Ga0496113_0334726 Ga0496113_0334726_606_944 112
206 3300050509 nmdc:mga0qj67_1038692_c1 nmdc:mga0qj67_1038692_c1_210_548 112
207 3300046517 Ga0495630_1173801 Ga0495630_1173801_210_557 114
208 3300046535 Ga0495586_0722898 Ga0495586_0722898_204_551 114
209 3300049569 Ga0501032_0757787 Ga0501032_0757787_184_552 114
210 3300049590 Ga0501074_0675884 Ga0501074_0675884_125_496 115
211 3300054114 Ga0501084_0168689 Ga0501084_0168689_1195_1566 115
212 3300005328 Ga0070676_10706883 Ga0070676_107068832 120
213 3300005336 Ga0070680_100344198 Ga0070680_1003441981 120
214 3300005339 Ga0070660_100323277 Ga0070660_1003232772 120
215 3300005344 Ga0070661_100296376 Ga0070661_1002963762 120
216 3300005458 Ga0070681_10082984 Ga0070681_100829843 120
217 3300005539 Ga0068853_100655534 Ga0068853_1006555342 120
218 3300005547 Ga0070693_101424736 Ga0070693_1014247361 120
219 3300005548 Ga0070665_100405638 Ga0070665_1004056382 120
220 3300005564 Ga0070664_100554878 Ga0070664_1005548782 120
221 3300005577 Ga0068857_101320672 Ga0068857_1013206722 120
222 3300005578 Ga0068854_100756462 Ga0068854_1007564622 120
223 3300005614 Ga0068856_100003293 Ga0068856_10000329317 120
224 3300005617 Ga0068859_100149761 Ga0068859_1001497614 120
225 3300005618 Ga0068864_100151022 Ga0068864_1001510221 120
226 3300006358 Ga0068871_100476218 Ga0068871_1004762182 120
227 3300006931 Ga0097620_100149759 Ga0097620_1001497592 120
228 3300009551 Ga0105238_10382752 Ga0105238_103827522 120
229 3300013105 Ga0157369_10250271 Ga0157369_102502712 120
230 3300013296 Ga0157374_10927417 Ga0157374_109274172 120
231 3300013306 Ga0163162_10187012 Ga0163162_101870122 120
232 3300013307 Ga0157372_10004848 Ga0157372_100048483 120
233 3300025907 Ga0207645_11061424 Ga0207645_110614241 120
234 3300025917 Ga0207660_10144955 Ga0207660_101449551 120
235 3300025981 Ga0207640_10782612 Ga0207640_107826121 120
236 3300026078 Ga0207702_10130905 Ga0207702_101309052 120
237 3300026088 Ga0207641_11690173 Ga0207641_116901731 120
238 3300026089 Ga0207648_10261885 Ga0207648_102618851 120
239 3300026142 Ga0207698_11629302 Ga0207698_116293022 120
240 3300048905 Ga0496102_0715938 Ga0496102_0715938_144_506 120
241 3300048909 Ga0496106_0257164 Ga0496106_0257164_425_787 120
242 3300048912 Ga0496109_0897395 Ga0496109_0897395_413_811 120
243 3300048915 Ga0496112_0832013 Ga0496112_0832013_209_571 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08734

GYD

GYD domain

4

96

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dzs-assembly2.cif.gz_D mycobacterial homoserine dehydrogenase thra in complex with nadp 0.7948 2 87
4pcq-assembly1.cif.gz_B crystal structure of mtbaldr (rv2779c) 0.7843 2 87
4pcq-assembly2.cif.gz_D crystal structure of mtbaldr (rv2779c) 0.7821 2 87
6dzs-assembly1.cif.gz_B mycobacterial homoserine dehydrogenase thra in complex with nadp 0.7798 2 87
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.7644 2 87
ID Description Score Start End Superfamily
4pcqD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7716 2 85 3.30.70.920
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7574 2 87 3.30.70.920
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.742 1 85 3.30.70.920
2cyyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.739 3 88 3.30.70.920
2cajA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.7182 2 85 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A0F8NDR1-F1-model_v4 GYD domain-containing protein 0.9883 1 84
AF-A0A2V8CDI2-F1-model_v4 GYD domain-containing protein 0.9861 1 79
AF-A0A382ZXV7-F1-model_v4 GYD domain-containing protein 0.9827 1 91
AF-A0A0F8NDR1-F1-model_v4 GYD domain-containing protein 0.9769 1 84
AF-A0A0F8T5H1-F1-model_v4 GYD domain-containing protein 0.9766 1 95

Feature Viewer

pLDDT pTM Quality
88.92 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map