F355819
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 133 | 243 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300042003|Ga0439443_030860|Ga0439443_030860_146_724 |
| Length | 192 |
| Sequence | LIKFIPTPKKNFIQCRPEFKPPLFSEMSAINQLIQQYNLQPHPEGGWYCQTYKSNEQITSESLPQRFEGSRAFSTAIYFLLEQGNFSAFHRIKSDECWHFYAGDPLDIYIIEQNGELKIISLGNDFEKGLSFQYVVPANSWFASRPAPNSEYCFVGCTVSPGFEFEDFELANSTELSAIYPKHKKIIEQLCR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 106 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 107 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 108 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 109 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 110 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 111 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 116 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 117 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 118 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 119 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 120 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 121 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 122 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 123 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 124 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 125 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 126 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 127 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 128 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 129 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 0.82 |
| Rhizosphere | 97.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10167266 | 3300003316 | Bacteria | 2046 |
| 2 | JGI25160J50197_1001424 | 3300003354 | Bacteria | 11971 |
| 3 | Ga0065712_10086498 | 3300005290 | Bacteria | 2617 |
| 4 | Ga0065712_10188957 | 3300005290 | Bacteria | 1153 |
| 5 | Ga0065712_10349123 | 3300005290 | Unclassified | 790 |
| 6 | Ga0065712_10444096 | 3300005290 | Unclassified | 691 |
| 7 | Ga0065712_10622623 | 3300005290 | Bacteria | 580 |
| 8 | Ga0065715_10220300 | 3300005293 | Bacteria | 1270 |
| 9 | Ga0065715_10415480 | 3300005293 | Bacteria | 864 |
| 10 | Ga0065707_10108956 | 3300005295 | Unclassified | 2488 |
| 11 | Ga0065707_10679294 | 3300005295 | Unclassified | 649 |
| 12 | Ga0070670_100085767 | 3300005331 | Bacteria | 2706 |
| 13 | Ga0070670_100537501 | 3300005331 | Bacteria | 1042 |
| 14 | Ga0068869_100436513 | 3300005334 | Bacteria | 1083 |
| 15 | Ga0068868_100392158 | 3300005338 | Bacteria | 1197 |
| 16 | Ga0068868_100914000 | 3300005338 | Unclassified | 798 |
| 17 | Ga0070689_100004057 | 3300005340 | Bacteria | 9853 |
| 18 | Ga0070687_100157436 | 3300005343 | Unclassified | 1339 |
| 19 | Ga0070668_100098410 | 3300005347 | Bacteria | 2315 |
| 20 | Ga0070668_100196564 | 3300005347 | Bacteria | 1654 |
| 21 | Ga0070668_101018143 | 3300005347 | Bacteria | 745 |
| 22 | Ga0070669_100265984 | 3300005353 | Unclassified | 1370 |
| 23 | Ga0070675_100035871 | 3300005354 | Bacteria | 4032 |
| 24 | Ga0070675_100344461 | 3300005354 | Bacteria | 1321 |
| 25 | Ga0070675_100628951 | 3300005354 | Bacteria | 975 |
| 26 | Ga0070674_100155229 | 3300005356 | Bacteria | 1731 |
| 27 | Ga0070673_100157211 | 3300005364 | Bacteria | 1930 |
| 28 | Ga0070673_100678861 | 3300005364 | Bacteria | 945 |
| 29 | Ga0070688_100028583 | 3300005365 | Bacteria | 3330 |
| 30 | Ga0070688_100597024 | 3300005365 | Unclassified | 845 |
| 31 | Ga0070700_100423049 | 3300005441 | Bacteria | 1007 |
| 32 | Ga0068867_100859814 | 3300005459 | Bacteria | 813 |
| 33 | Ga0070685_10031948 | 3300005466 | Bacteria | 2945 |
| 34 | Ga0070707_100171197 | 3300005468 | Bacteria | 2116 |
| 35 | Ga0070698_100001648 | 3300005471 | Bacteria | 24891 |
| 36 | Ga0070698_100009165 | 3300005471 | Bacteria | 10623 |
| 37 | Ga0070698_100017594 | 3300005471 | Bacteria | 7533 |
| 38 | Ga0070698_100174881 | 3300005471 | Unclassified | 2087 |
| 39 | Ga0068853_100012451 | 3300005539 | Bacteria | 6920 |
| 40 | Ga0070672_100011645 | 3300005543 | Bacteria | 6138 |
| 41 | Ga0070672_100063280 | 3300005543 | Bacteria | 2921 |
| 42 | Ga0070686_100345933 | 3300005544 | Bacteria | 1116 |
| 43 | Ga0070704_100268427 | 3300005549 | Bacteria | 1409 |
| 44 | Ga0068857_100084603 | 3300005577 | Bacteria | 2835 |
| 45 | Ga0068854_100269630 | 3300005578 | Bacteria | 1366 |
| 46 | Ga0068852_100126374 | 3300005616 | Unclassified | 2349 |
| 47 | Ga0068852_100287273 | 3300005616 | Bacteria | 1588 |
| 48 | Ga0068852_101034194 | 3300005616 | Unclassified | 841 |
| 49 | Ga0068859_100012459 | 3300005617 | Bacteria | 8556 |
| 50 | Ga0068859_100055060 | 3300005617 | Bacteria | 4002 |
| 51 | Ga0068859_100398845 | 3300005617 | Bacteria | 1471 |
| 52 | Ga0068859_100442702 | 3300005617 | Unclassified | 1396 |
| 53 | Ga0068859_100920566 | 3300005617 | Unclassified | 958 |
| 54 | Ga0068859_101106379 | 3300005617 | Bacteria | 871 |
| 55 | Ga0068864_100302801 | 3300005618 | Unclassified | 1497 |
| 56 | Ga0068861_100006081 | 3300005719 | Bacteria | 8212 |
| 57 | Ga0068861_101482432 | 3300005719 | Bacteria | 665 |
| 58 | Ga0068851_10192373 | 3300005834 | Unclassified | 1135 |
| 59 | Ga0068870_10012117 | 3300005840 | Bacteria | 4020 |
| 60 | Ga0068863_100082685 | 3300005841 | Bacteria | 3043 |
| 61 | Ga0068863_100275399 | 3300005841 | Bacteria | 1629 |
| 62 | Ga0068863_100641289 | 3300005841 | Bacteria | 1053 |
| 63 | Ga0068860_100135679 | 3300005843 | Unclassified | 2363 |
| 64 | Ga0068860_100267845 | 3300005843 | Bacteria | 1667 |
| 65 | Ga0068860_100270493 | 3300005843 | Bacteria | 1658 |
| 66 | Ga0068860_100293900 | 3300005843 | Bacteria | 1590 |
| 67 | Ga0068860_100463771 | 3300005843 | Unclassified | 1261 |
| 68 | Ga0068862_100443398 | 3300005844 | Bacteria | 1222 |
| 69 | Ga0068862_100701309 | 3300005844 | Bacteria | 981 |
| 70 | Ga0068862_101285156 | 3300005844 | Unclassified | 732 |
| 71 | Ga0081539_10000147 | 3300005985 | Bacteria | 164274 |
| 72 | Ga0070715_10101438 | 3300006163 | Unclassified | 1343 |
| 73 | Ga0097621_100050896 | 3300006237 | Unclassified | 3369 |
| 74 | Ga0097621_100607953 | 3300006237 | Bacteria | 1000 |
| 75 | Ga0068871_100004221 | 3300006358 | Bacteria | 9950 |
| 76 | Ga0068871_100203112 | 3300006358 | Unclassified | 1712 |
| 77 | Ga0068871_100212287 | 3300006358 | Bacteria | 1674 |
| 78 | Ga0068871_101822208 | 3300006358 | Unclassified | 578 |
| 79 | Ga0075428_100005197 | 3300006844 | Bacteria | 14461 |
| 80 | Ga0075428_100073295 | 3300006844 | Unclassified | 3739 |
| 81 | Ga0075428_100073625 | 3300006844 | Unclassified | 3731 |
| 82 | Ga0075428_100403580 | 3300006844 | Bacteria | 1465 |
| 83 | Ga0075430_100027135 | 3300006846 | Bacteria | 4868 |
| 84 | Ga0075430_100126784 | 3300006846 | Unclassified | 2128 |
| 85 | Ga0075431_100610247 | 3300006847 | Bacteria | 1074 |
| 86 | Ga0075429_100066540 | 3300006880 | Unclassified | 3137 |
| 87 | Ga0097620_100012459 | 3300006931 | Bacteria | 8556 |
| 88 | Ga0097620_100055059 | 3300006931 | Bacteria | 4002 |
| 89 | Ga0097620_100398845 | 3300006931 | Bacteria | 1471 |
| 90 | Ga0097620_100442694 | 3300006931 | Unclassified | 1396 |
| 91 | Ga0097620_100920616 | 3300006931 | Unclassified | 958 |
| 92 | Ga0097620_101106391 | 3300006931 | Bacteria | 871 |
| 93 | Ga0111539_10070995 | 3300009094 | Bacteria | 4110 |
| 94 | Ga0111539_10786805 | 3300009094 | Bacteria | 1107 |
| 95 | Ga0111539_11924680 | 3300009094 | Unclassified | 686 |
| 96 | Ga0105247_10126432 | 3300009101 | Bacteria | 1662 |
| 97 | Ga0114129_10072551 | 3300009147 | Bacteria | 4798 |
| 98 | Ga0114129_10581750 | 3300009147 | Bacteria | 1453 |
| 99 | Ga0105241_10417535 | 3300009174 | Bacteria | 1180 |
| 100 | Ga0105242_10061404 | 3300009176 | Unclassified | 3091 |
| 101 | Ga0105242_10124408 | 3300009176 | Bacteria | 2218 |
| 102 | Ga0105242_10243498 | 3300009176 | Bacteria | 1618 |
| 103 | Ga0105242_10265086 | 3300009176 | Bacteria | 1553 |
| 104 | Ga0105242_11460819 | 3300009176 | Bacteria | 713 |
| 105 | Ga0105242_11644635 | 3300009176 | Bacteria | 677 |
| 106 | Ga0105237_10027460 | 3300009545 | Bacteria | 5811 |
| 107 | Ga0105249_10001878 | 3300009553 | Bacteria | 18200 |
| 108 | Ga0105249_10256736 | 3300009553 | Bacteria | 1735 |
| 109 | Ga0105239_10039687 | 3300010375 | Bacteria | 5158 |
| 110 | Ga0105246_10340020 | 3300011119 | Bacteria | 1226 |
| 111 | Ga0157371_10323542 | 3300013102 | Bacteria | 1119 |
| 112 | Ga0157371_10499204 | 3300013102 | Unclassified | 898 |
| 113 | Ga0157370_10201952 | 3300013104 | Bacteria | 1844 |
| 114 | Ga0157374_12291045 | 3300013296 | Bacteria | 567 |
| 115 | Ga0157378_10007504 | 3300013297 | Bacteria | 9523 |
| 116 | Ga0163162_10005237 | 3300013306 | Bacteria | 12498 |
| 117 | Ga0163162_10026963 | 3300013306 | Bacteria | 5682 |
| 118 | Ga0163162_10035877 | 3300013306 | Bacteria | 4940 |
| 119 | Ga0163162_10299226 | 3300013306 | Bacteria | 1741 |
| 120 | Ga0163162_11433952 | 3300013306 | Unclassified | 786 |
| 121 | Ga0157372_10143945 | 3300013307 | Bacteria | 2749 |
| 122 | Ga0157372_10185112 | 3300013307 | Bacteria | 2412 |
| 123 | Ga0157372_11089992 | 3300013307 | Unclassified | 924 |
| 124 | Ga0157375_10228037 | 3300013308 | Unclassified | 2022 |
| 125 | Ga0157375_10296762 | 3300013308 | Bacteria | 1779 |
| 126 | Ga0157375_12420839 | 3300013308 | Bacteria | 627 |
| 127 | Ga0163163_10565423 | 3300014325 | Bacteria | 1200 |
| 128 | Ga0157380_10029978 | 3300014326 | Bacteria | 4163 |
| 129 | Ga0157380_10257316 | 3300014326 | Bacteria | 1584 |
| 130 | Ga0157380_10315163 | 3300014326 | Bacteria | 1448 |
| 131 | Ga0157380_10436815 | 3300014326 | Bacteria | 1253 |
| 132 | Ga0157377_10047490 | 3300014745 | Bacteria | 2405 |
| 133 | Ga0157377_10129021 | 3300014745 | Bacteria | 1542 |
| 134 | Ga0157377_10976677 | 3300014745 | Unclassified | 639 |
| 135 | Ga0157377_11307817 | 3300014745 | Unclassified | 567 |
| 136 | Ga0157377_11319104 | 3300014745 | Bacteria | 565 |
| 137 | Ga0157376_10218611 | 3300014969 | Unclassified | 1763 |
| 138 | Ga0157376_10376649 | 3300014969 | Unclassified | 1366 |
| 139 | Ga0157376_12301778 | 3300014969 | Bacteria | 578 |
| 140 | Ga0163161_10171999 | 3300017792 | Unclassified | 1657 |
| 141 | Ga0163161_10211527 | 3300017792 | Unclassified | 1498 |
| 142 | Ga0163161_10379998 | 3300017792 | Bacteria | 1129 |
| 143 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 144 | Ga0207682_10011772 | 3300025893 | Bacteria | 3417 |
| 145 | Ga0207710_10009223 | 3300025900 | Bacteria | 4149 |
| 146 | Ga0207647_10066574 | 3300025904 | Bacteria | 2184 |
| 147 | Ga0207643_10004491 | 3300025908 | Bacteria | 7498 |
| 148 | Ga0207671_10021067 | 3300025914 | Bacteria | 4952 |
| 149 | Ga0207662_10024697 | 3300025918 | Bacteria | 3459 |
| 150 | Ga0207646_10139125 | 3300025922 | Bacteria | 2186 |
| 151 | Ga0207681_10074580 | 3300025923 | Bacteria | 2377 |
| 152 | Ga0207681_10157274 | 3300025923 | Bacteria | 1709 |
| 153 | Ga0207681_10824998 | 3300025923 | Unclassified | 775 |
| 154 | Ga0207650_10194063 | 3300025925 | Bacteria | 1624 |
| 155 | Ga0207650_10524478 | 3300025925 | Bacteria | 991 |
| 156 | Ga0207659_10006818 | 3300025926 | Bacteria | 7021 |
| 157 | Ga0207659_10476482 | 3300025926 | Bacteria | 1054 |
| 158 | Ga0207659_10754619 | 3300025926 | Bacteria | 835 |
| 159 | Ga0207659_10755578 | 3300025926 | Bacteria | 834 |
| 160 | Ga0207686_10000175 | 3300025934 | Bacteria | 49208 |
| 161 | Ga0207686_10271109 | 3300025934 | Unclassified | 1248 |
| 162 | Ga0207686_10551205 | 3300025934 | Bacteria | 901 |
| 163 | Ga0207670_10011684 | 3300025936 | Bacteria | 5109 |
| 164 | Ga0207670_10394979 | 3300025936 | Bacteria | 1104 |
| 165 | Ga0207670_10709850 | 3300025936 | Unclassified | 833 |
| 166 | Ga0207691_10013389 | 3300025940 | Bacteria | 7852 |
| 167 | Ga0207689_10131518 | 3300025942 | Bacteria | 2059 |
| 168 | Ga0207689_11228311 | 3300025942 | Bacteria | 631 |
| 169 | Ga0207651_10073380 | 3300025960 | Unclassified | 2433 |
| 170 | Ga0207651_10197705 | 3300025960 | Bacteria | 1608 |
| 171 | Ga0207712_10001398 | 3300025961 | Bacteria | 16497 |
| 172 | Ga0207712_10086990 | 3300025961 | Unclassified | 2291 |
| 173 | Ga0207712_10190350 | 3300025961 | Unclassified | 1619 |
| 174 | Ga0207668_10098798 | 3300025972 | Bacteria | 2164 |
| 175 | Ga0207640_10191514 | 3300025981 | Bacteria | 1542 |
| 176 | Ga0207677_10284718 | 3300026023 | Bacteria | 1358 |
| 177 | Ga0207703_11593431 | 3300026035 | Bacteria | 628 |
| 178 | Ga0207639_10008496 | 3300026041 | Bacteria | 7039 |
| 179 | Ga0207639_10314930 | 3300026041 | Unclassified | 1387 |
| 180 | Ga0207708_10088163 | 3300026075 | Unclassified | 2390 |
| 181 | Ga0207708_10336745 | 3300026075 | Bacteria | 1235 |
| 182 | Ga0207708_10704242 | 3300026075 | Bacteria | 863 |
| 183 | Ga0207641_10005276 | 3300026088 | Bacteria | 11037 |
| 184 | Ga0207641_10022092 | 3300026088 | Bacteria | 5234 |
| 185 | Ga0207641_10068248 | 3300026088 | Bacteria | 3048 |
| 186 | Ga0207648_10265282 | 3300026089 | Unclassified | 1533 |
| 187 | Ga0207676_10149456 | 3300026095 | Bacteria | 2010 |
| 188 | Ga0207676_10275791 | 3300026095 | Bacteria | 1525 |
| 189 | Ga0207674_10474996 | 3300026116 | Unclassified | 1208 |
| 190 | Ga0207675_100011632 | 3300026118 | Bacteria | 8229 |
| 191 | Ga0207675_100255018 | 3300026118 | Unclassified | 1699 |
| 192 | Ga0207675_100339332 | 3300026118 | Bacteria | 1470 |
| 193 | Ga0207675_100892462 | 3300026118 | Bacteria | 905 |
| 194 | Ga0207683_10190748 | 3300026121 | Bacteria | 1861 |
| 195 | Ga0207683_10937609 | 3300026121 | Unclassified | 804 |
| 196 | Ga0207698_10623418 | 3300026142 | Unclassified | 1065 |
| 197 | Ga0207698_10891957 | 3300026142 | Bacteria | 896 |
| 198 | Ga0207428_10247268 | 3300027907 | Unclassified | 1331 |
| 199 | Ga0207428_10480049 | 3300027907 | Bacteria | 904 |
| 200 | Ga0268265_10237447 | 3300028380 | Bacteria | 1606 |
| 201 | Ga0268264_10041950 | 3300028381 | Bacteria | 3786 |
| 202 | Ga0268264_10108366 | 3300028381 | Bacteria | 2428 |
| 203 | Ga0268264_10472369 | 3300028381 | Unclassified | 1218 |
| 204 | Ga0268264_10912019 | 3300028381 | Unclassified | 882 |
| 205 | Ga0265327_10093145 | 3300031251 | Bacteria | 1466 |
| 206 | Ga0373937_1564049 | 3300036401 | Bacteria | 607 |
| 207 | Ga0395905_0053789 | 3300037471 | Bacteria | 3768 |
| 208 | Ga0395901_0030068 | 3300038443 | Bacteria | 5595 |
| 209 | Ga0451800_0551985 | 3300041459 | Bacteria | 1736 |
| 210 | Ga0451807_1972687 | 3300041486 | Unclassified | 591 |
| 211 | Ga0439443_030860 | 3300042003 | Bacteria | 883 |
| 212 | Ga0439446_0063756 | 3300042156 | Unclassified | 1117 |
| 213 | Ga0439435_0164715 | 3300042436 | Unclassified | 717 |
| 214 | Ga0439444_0005211 | 3300042437 | Bacteria | 1920 |
| 215 | Ga0453684_0072009 | 3300044712 | Bacteria | 4366 |
| 216 | Ga0453684_1071136 | 3300044712 | Bacteria | 853 |
| 217 | Ga0495608_0730844 | 3300046511 | Unclassified | 587 |
| 218 | Ga0495598_0008031 | 3300046537 | Bacteria | 2445 |
| 219 | Ga0495621_0086134 | 3300046539 | Bacteria | 1178 |
| 220 | Ga0495674_0492225 | 3300047319 | Bacteria | 982 |
| 221 | Ga0501300_040175 | 3300049523 | Unclassified | 704 |
| 222 | Ga0501201_000565 | 3300049651 | Bacteria | 3456 |
| 223 | Ga0501206_001527 | 3300049653 | Bacteria | 2885 |
| 224 | Ga0501217_005915 | 3300049661 | Bacteria | 2576 |
| 225 | Ga0501223_000724 | 3300049663 | Bacteria | 7868 |
| 226 | Ga0501224_000319 | 3300049664 | Bacteria | 5632 |
| 227 | Ga0501233_004863 | 3300049668 | Bacteria | 2482 |
| 228 | Ga0501235_019975 | 3300049669 | Bacteria | 1487 |
| 229 | Ga0501243_100584 | 3300049675 | Unclassified | 583 |
| 230 | Ga0501259_001368 | 3300049688 | Bacteria | 4076 |
| 231 | Ga0501221_002154 | 3300049704 | Bacteria | 3270 |
| 232 | Ga0501225_0000487 | 3300049705 | Bacteria | 12349 |
| 233 | Ga0501234_000351 | 3300049707 | Bacteria | 6806 |
| 234 | Ga0501245_003591 | 3300049708 | Bacteria | 2111 |
| 235 | nmdc:mga05p37_104851_c1 | 3300050507 | Bacteria | 3478 |
| 236 | nmdc:mga05p37_490056_c1 | 3300050507 | Bacteria | 1413 |
| 237 | nmdc:mga09592_73615_c1 | 3300050508 | Unclassified | 2903 |
| 238 | nmdc:mga09592_89328_c1 | 3300050508 | Unclassified | 2632 |
| 239 | nmdc:mga0qj67_25082_c1 | 3300050509 | Bacteria | 4173 |
| 240 | nmdc:mga0qj67_267747_c1 | 3300050509 | Bacteria | 1386 |
| 241 | nmdc:mga06r32_681968_c1 | 3300050510 | Bacteria | 994 |
| 242 | nmdc:mga08y16_139305_c1 | 3300050511 | Bacteria | 2522 |
| 243 | nmdc:mga08y16_805340_c1 | 3300050511 | Unclassified | 932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005617 | Ga0068859_100398845 | Ga0068859_1003988453 | 160 |
| 2 | 3300005843 | Ga0068860_100267845 | Ga0068860_1002678452 | 160 |
| 3 | 3300006931 | Ga0097620_100398845 | Ga0097620_1003988451 | 160 |
| 4 | 3300025923 | Ga0207681_10824998 | Ga0207681_108249981 | 160 |
| 5 | 3300028381 | Ga0268264_10108366 | Ga0268264_101083663 | 160 |
| 6 | 3300005719 | Ga0068861_101482432 | Ga0068861_1014824321 | 163 |
| 7 | 3300026118 | Ga0207675_100892462 | Ga0207675_1008924621 | 163 |
| 8 | 3300005331 | Ga0070670_100085767 | Ga0070670_1000857672 | 164 |
| 9 | 3300005347 | Ga0070668_101018143 | Ga0070668_1010181432 | 164 |
| 10 | 3300005354 | Ga0070675_100628951 | Ga0070675_1006289512 | 164 |
| 11 | 3300005356 | Ga0070674_100155229 | Ga0070674_1001552292 | 164 |
| 12 | 3300014325 | Ga0163163_10565423 | Ga0163163_105654231 | 164 |
| 13 | 3300014326 | Ga0157380_10029978 | Ga0157380_100299783 | 164 |
| 14 | 3300025925 | Ga0207650_10194063 | Ga0207650_101940632 | 164 |
| 15 | 3300025926 | Ga0207659_10476482 | Ga0207659_104764822 | 164 |
| 16 | 3300049523 | Ga0501300_040175 | Ga0501300_040175_22_516 | 164 |
| 17 | 3300049651 | Ga0501201_000565 | Ga0501201_000565_1074_1568 | 164 |
| 18 | 3300049653 | Ga0501206_001527 | Ga0501206_001527_1281_1775 | 164 |
| 19 | 3300049661 | Ga0501217_005915 | Ga0501217_005915_1346_1840 | 164 |
| 20 | 3300049663 | Ga0501223_000724 | Ga0501223_000724_1056_1550 | 164 |
| 21 | 3300049664 | Ga0501224_000319 | Ga0501224_000319_3586_4080 | 164 |
| 22 | 3300049668 | Ga0501233_004863 | Ga0501233_004863_1231_1725 | 164 |
| 23 | 3300049669 | Ga0501235_019975 | Ga0501235_019975_697_1191 | 164 |
| 24 | 3300049675 | Ga0501243_100584 | Ga0501243_100584_17_511 | 164 |
| 25 | 3300049688 | Ga0501259_001368 | Ga0501259_001368_276_770 | 164 |
| 26 | 3300049704 | Ga0501221_002154 | Ga0501221_002154_922_1416 | 164 |
| 27 | 3300049705 | Ga0501225_0000487 | Ga0501225_0000487_4813_5307 | 164 |
| 28 | 3300049707 | Ga0501234_000351 | Ga0501234_000351_5655_6149 | 164 |
| 29 | 3300049708 | Ga0501245_003591 | Ga0501245_003591_1496_1990 | 164 |
| 30 | 3300005459 | Ga0068867_100859814 | Ga0068867_1008598141 | 165 |
| 31 | 3300005616 | Ga0068852_100287273 | Ga0068852_1002872733 | 165 |
| 32 | 3300005616 | Ga0068852_101034194 | Ga0068852_1010341941 | 165 |
| 33 | 3300013104 | Ga0157370_10201952 | Ga0157370_102019523 | 165 |
| 34 | 3300013307 | Ga0157372_11089992 | Ga0157372_110899922 | 165 |
| 35 | 3300036401 | Ga0373937_1564049 | Ga0373937_1564049_80_577 | 165 |
| 36 | 3300041459 | Ga0451800_0551985 | Ga0451800_0551985_210_707 | 165 |
| 37 | 3300041486 | Ga0451807_1972687 | Ga0451807_1972687_21_518 | 165 |
| 38 | 3300047319 | Ga0495674_0492225 | Ga0495674_0492225_393_890 | 165 |
| 39 | 3300005290 | Ga0065712_10086498 | Ga0065712_100864983 | 166 |
| 40 | 3300005290 | Ga0065712_10188957 | Ga0065712_101889572 | 166 |
| 41 | 3300005290 | Ga0065712_10444096 | Ga0065712_104440961 | 166 |
| 42 | 3300005290 | Ga0065712_10622623 | Ga0065712_106226231 | 166 |
| 43 | 3300005293 | Ga0065715_10220300 | Ga0065715_102203001 | 166 |
| 44 | 3300005295 | Ga0065707_10108956 | Ga0065707_101089562 | 166 |
| 45 | 3300005295 | Ga0065707_10679294 | Ga0065707_106792941 | 166 |
| 46 | 3300005331 | Ga0070670_100537501 | Ga0070670_1005375011 | 166 |
| 47 | 3300005338 | Ga0068868_100392158 | Ga0068868_1003921582 | 166 |
| 48 | 3300005340 | Ga0070689_100004057 | Ga0070689_10000405712 | 166 |
| 49 | 3300005343 | Ga0070687_100157436 | Ga0070687_1001574362 | 166 |
| 50 | 3300005347 | Ga0070668_100098410 | Ga0070668_1000984102 | 166 |
| 51 | 3300005347 | Ga0070668_100196564 | Ga0070668_1001965642 | 166 |
| 52 | 3300005353 | Ga0070669_100265984 | Ga0070669_1002659843 | 166 |
| 53 | 3300005354 | Ga0070675_100035871 | Ga0070675_1000358713 | 166 |
| 54 | 3300005354 | Ga0070675_100344461 | Ga0070675_1003444611 | 166 |
| 55 | 3300005364 | Ga0070673_100157211 | Ga0070673_1001572113 | 166 |
| 56 | 3300005364 | Ga0070673_100678861 | Ga0070673_1006788611 | 166 |
| 57 | 3300005365 | Ga0070688_100028583 | Ga0070688_1000285833 | 166 |
| 58 | 3300005365 | Ga0070688_100597024 | Ga0070688_1005970241 | 166 |
| 59 | 3300005441 | Ga0070700_100423049 | Ga0070700_1004230492 | 166 |
| 60 | 3300005466 | Ga0070685_10031948 | Ga0070685_100319483 | 166 |
| 61 | 3300005471 | Ga0070698_100001648 | Ga0070698_10000164813 | 166 |
| 62 | 3300005471 | Ga0070698_100009165 | Ga0070698_10000916512 | 166 |
| 63 | 3300005471 | Ga0070698_100017594 | Ga0070698_1000175948 | 166 |
| 64 | 3300005539 | Ga0068853_100012451 | Ga0068853_1000124515 | 166 |
| 65 | 3300005543 | Ga0070672_100011645 | Ga0070672_1000116459 | 166 |
| 66 | 3300005543 | Ga0070672_100063280 | Ga0070672_1000632805 | 166 |
| 67 | 3300005544 | Ga0070686_100345933 | Ga0070686_1003459332 | 166 |
| 68 | 3300005549 | Ga0070704_100268427 | Ga0070704_1002684272 | 166 |
| 69 | 3300005577 | Ga0068857_100084603 | Ga0068857_1000846033 | 166 |
| 70 | 3300005578 | Ga0068854_100269630 | Ga0068854_1002696302 | 166 |
| 71 | 3300005616 | Ga0068852_100126374 | Ga0068852_1001263742 | 166 |
| 72 | 3300005617 | Ga0068859_100012459 | Ga0068859_1000124592 | 166 |
| 73 | 3300005617 | Ga0068859_100055060 | Ga0068859_1000550602 | 166 |
| 74 | 3300005617 | Ga0068859_100442702 | Ga0068859_1004427022 | 166 |
| 75 | 3300005617 | Ga0068859_100920566 | Ga0068859_1009205662 | 166 |
| 76 | 3300005618 | Ga0068864_100302801 | Ga0068864_1003028011 | 166 |
| 77 | 3300005834 | Ga0068851_10192373 | Ga0068851_101923732 | 166 |
| 78 | 3300005840 | Ga0068870_10012117 | Ga0068870_100121172 | 166 |
| 79 | 3300005841 | Ga0068863_100082685 | Ga0068863_1000826854 | 166 |
| 80 | 3300005841 | Ga0068863_100275399 | Ga0068863_1002753993 | 166 |
| 81 | 3300005841 | Ga0068863_100641289 | Ga0068863_1006412892 | 166 |
| 82 | 3300005843 | Ga0068860_100135679 | Ga0068860_1001356792 | 166 |
| 83 | 3300005843 | Ga0068860_100293900 | Ga0068860_1002939002 | 166 |
| 84 | 3300005843 | Ga0068860_100463771 | Ga0068860_1004637713 | 166 |
| 85 | 3300005844 | Ga0068862_100443398 | Ga0068862_1004433982 | 166 |
| 86 | 3300005844 | Ga0068862_100701309 | Ga0068862_1007013092 | 166 |
| 87 | 3300005844 | Ga0068862_101285156 | Ga0068862_1012851561 | 166 |
| 88 | 3300006163 | Ga0070715_10101438 | Ga0070715_101014383 | 166 |
| 89 | 3300006237 | Ga0097621_100050896 | Ga0097621_1000508963 | 166 |
| 90 | 3300006237 | Ga0097621_100607953 | Ga0097621_1006079531 | 166 |
| 91 | 3300006358 | Ga0068871_100004221 | Ga0068871_1000042216 | 166 |
| 92 | 3300006358 | Ga0068871_100203112 | Ga0068871_1002031123 | 166 |
| 93 | 3300006358 | Ga0068871_100212287 | Ga0068871_1002122873 | 166 |
| 94 | 3300006358 | Ga0068871_101822208 | Ga0068871_1018222081 | 166 |
| 95 | 3300006844 | Ga0075428_100005197 | Ga0075428_10000519714 | 166 |
| 96 | 3300006844 | Ga0075428_100073295 | Ga0075428_1000732952 | 166 |
| 97 | 3300006844 | Ga0075428_100073625 | Ga0075428_1000736252 | 166 |
| 98 | 3300006844 | Ga0075428_100403580 | Ga0075428_1004035802 | 166 |
| 99 | 3300006846 | Ga0075430_100027135 | Ga0075430_1000271352 | 166 |
| 100 | 3300006846 | Ga0075430_100126784 | Ga0075430_1001267842 | 166 |
| 101 | 3300006847 | Ga0075431_100610247 | Ga0075431_1006102472 | 166 |
| 102 | 3300006880 | Ga0075429_100066540 | Ga0075429_1000665404 | 166 |
| 103 | 3300006931 | Ga0097620_100012459 | Ga0097620_10001245910 | 166 |
| 104 | 3300006931 | Ga0097620_100055059 | Ga0097620_1000550592 | 166 |
| 105 | 3300006931 | Ga0097620_100442694 | Ga0097620_1004426942 | 166 |
| 106 | 3300006931 | Ga0097620_100920616 | Ga0097620_1009206162 | 166 |
| 107 | 3300009094 | Ga0111539_10070995 | Ga0111539_100709956 | 166 |
| 108 | 3300009094 | Ga0111539_11924680 | Ga0111539_119246801 | 166 |
| 109 | 3300009147 | Ga0114129_10072551 | Ga0114129_100725513 | 166 |
| 110 | 3300009147 | Ga0114129_10581750 | Ga0114129_105817502 | 166 |
| 111 | 3300009176 | Ga0105242_10061404 | Ga0105242_100614044 | 166 |
| 112 | 3300009176 | Ga0105242_10124408 | Ga0105242_101244084 | 166 |
| 113 | 3300009176 | Ga0105242_10243498 | Ga0105242_102434982 | 166 |
| 114 | 3300009176 | Ga0105242_10265086 | Ga0105242_102650863 | 166 |
| 115 | 3300009176 | Ga0105242_11460819 | Ga0105242_114608191 | 166 |
| 116 | 3300009176 | Ga0105242_11644635 | Ga0105242_116446352 | 166 |
| 117 | 3300009553 | Ga0105249_10256736 | Ga0105249_102567362 | 166 |
| 118 | 3300011119 | Ga0105246_10340020 | Ga0105246_103400201 | 166 |
| 119 | 3300013296 | Ga0157374_12291045 | Ga0157374_122910451 | 166 |
| 120 | 3300013297 | Ga0157378_10007504 | Ga0157378_100075044 | 166 |
| 121 | 3300013306 | Ga0163162_10005237 | Ga0163162_100052372 | 166 |
| 122 | 3300013306 | Ga0163162_10026963 | Ga0163162_100269632 | 166 |
| 123 | 3300013306 | Ga0163162_10035877 | Ga0163162_100358772 | 166 |
| 124 | 3300013306 | Ga0163162_11433952 | Ga0163162_114339521 | 166 |
| 125 | 3300013307 | Ga0157372_10143945 | Ga0157372_101439451 | 166 |
| 126 | 3300013308 | Ga0157375_10228037 | Ga0157375_102280372 | 166 |
| 127 | 3300013308 | Ga0157375_10296762 | Ga0157375_102967621 | 166 |
| 128 | 3300013308 | Ga0157375_12420839 | Ga0157375_124208391 | 166 |
| 129 | 3300014326 | Ga0157380_10257316 | Ga0157380_102573162 | 166 |
| 130 | 3300014326 | Ga0157380_10315163 | Ga0157380_103151631 | 166 |
| 131 | 3300014326 | Ga0157380_10436815 | Ga0157380_104368152 | 166 |
| 132 | 3300014745 | Ga0157377_10047490 | Ga0157377_100474903 | 166 |
| 133 | 3300014745 | Ga0157377_10976677 | Ga0157377_109766771 | 166 |
| 134 | 3300014745 | Ga0157377_11307817 | Ga0157377_113078171 | 166 |
| 135 | 3300014745 | Ga0157377_11319104 | Ga0157377_113191041 | 166 |
| 136 | 3300014969 | Ga0157376_10218611 | Ga0157376_102186113 | 166 |
| 137 | 3300014969 | Ga0157376_10376649 | Ga0157376_103766493 | 166 |
| 138 | 3300014969 | Ga0157376_12301778 | Ga0157376_123017781 | 166 |
| 139 | 3300017792 | Ga0163161_10171999 | Ga0163161_101719993 | 166 |
| 140 | 3300017792 | Ga0163161_10211527 | Ga0163161_102115273 | 166 |
| 141 | 3300025893 | Ga0207682_10011772 | Ga0207682_100117723 | 166 |
| 142 | 3300025908 | Ga0207643_10004491 | Ga0207643_100044913 | 166 |
| 143 | 3300025923 | Ga0207681_10157274 | Ga0207681_101572741 | 166 |
| 144 | 3300025925 | Ga0207650_10524478 | Ga0207650_105244781 | 166 |
| 145 | 3300025926 | Ga0207659_10006818 | Ga0207659_100068185 | 166 |
| 146 | 3300025926 | Ga0207659_10755578 | Ga0207659_107555782 | 166 |
| 147 | 3300025934 | Ga0207686_10000175 | Ga0207686_1000017554 | 166 |
| 148 | 3300025934 | Ga0207686_10271109 | Ga0207686_102711091 | 166 |
| 149 | 3300025934 | Ga0207686_10551205 | Ga0207686_105512051 | 166 |
| 150 | 3300025936 | Ga0207670_10011684 | Ga0207670_100116845 | 166 |
| 151 | 3300025940 | Ga0207691_10013389 | Ga0207691_1001338910 | 166 |
| 152 | 3300025942 | Ga0207689_10131518 | Ga0207689_101315183 | 166 |
| 153 | 3300025960 | Ga0207651_10073380 | Ga0207651_100733803 | 166 |
| 154 | 3300025960 | Ga0207651_10197705 | Ga0207651_101977052 | 166 |
| 155 | 3300025961 | Ga0207712_10190350 | Ga0207712_101903502 | 166 |
| 156 | 3300025972 | Ga0207668_10098798 | Ga0207668_100987982 | 166 |
| 157 | 3300025981 | Ga0207640_10191514 | Ga0207640_101915142 | 166 |
| 158 | 3300026023 | Ga0207677_10284718 | Ga0207677_102847181 | 166 |
| 159 | 3300026041 | Ga0207639_10008496 | Ga0207639_100084965 | 166 |
| 160 | 3300026041 | Ga0207639_10314930 | Ga0207639_103149303 | 166 |
| 161 | 3300026075 | Ga0207708_10088163 | Ga0207708_100881631 | 166 |
| 162 | 3300026075 | Ga0207708_10336745 | Ga0207708_103367452 | 166 |
| 163 | 3300026075 | Ga0207708_10704242 | Ga0207708_107042422 | 166 |
| 164 | 3300026088 | Ga0207641_10005276 | Ga0207641_100052767 | 166 |
| 165 | 3300026088 | Ga0207641_10022092 | Ga0207641_100220923 | 166 |
| 166 | 3300026088 | Ga0207641_10068248 | Ga0207641_100682482 | 166 |
| 167 | 3300026089 | Ga0207648_10265282 | Ga0207648_102652823 | 166 |
| 168 | 3300026095 | Ga0207676_10149456 | Ga0207676_101494562 | 166 |
| 169 | 3300026116 | Ga0207674_10474996 | Ga0207674_104749961 | 166 |
| 170 | 3300026118 | Ga0207675_100255018 | Ga0207675_1002550183 | 166 |
| 171 | 3300026121 | Ga0207683_10190748 | Ga0207683_101907482 | 166 |
| 172 | 3300026121 | Ga0207683_10937609 | Ga0207683_109376091 | 166 |
| 173 | 3300026142 | Ga0207698_10623418 | Ga0207698_106234181 | 166 |
| 174 | 3300027907 | Ga0207428_10247268 | Ga0207428_102472683 | 166 |
| 175 | 3300027907 | Ga0207428_10480049 | Ga0207428_104800492 | 166 |
| 176 | 3300028380 | Ga0268265_10237447 | Ga0268265_102374472 | 166 |
| 177 | 3300028381 | Ga0268264_10041950 | Ga0268264_100419503 | 166 |
| 178 | 3300028381 | Ga0268264_10472369 | Ga0268264_104723693 | 166 |
| 179 | 3300028381 | Ga0268264_10912019 | Ga0268264_109120191 | 166 |
| 180 | 3300042003 | Ga0439443_030860 | Ga0439443_030860_146_724 | 166 |
| 181 | 3300042156 | Ga0439446_0063756 | Ga0439446_0063756_146_646 | 166 |
| 182 | 3300042436 | Ga0439435_0164715 | Ga0439435_0164715_168_668 | 166 |
| 183 | 3300042437 | Ga0439444_0005211 | Ga0439444_0005211_1179_1679 | 166 |
| 184 | 3300046511 | Ga0495608_0730844 | Ga0495608_0730844_53_553 | 166 |
| 185 | 3300046537 | Ga0495598_0008031 | Ga0495598_0008031_619_1119 | 166 |
| 186 | 3300046539 | Ga0495621_0086134 | Ga0495621_0086134_143_643 | 166 |
| 187 | 3300050507 | nmdc:mga05p37_104851_c1 | nmdc:mga05p37_104851_c1_1297_1797 | 166 |
| 188 | 3300050507 | nmdc:mga05p37_490056_c1 | nmdc:mga05p37_490056_c1_155_655 | 166 |
| 189 | 3300050508 | nmdc:mga09592_73615_c1 | nmdc:mga09592_73615_c1_422_922 | 166 |
| 190 | 3300050508 | nmdc:mga09592_89328_c1 | nmdc:mga09592_89328_c1_1028_1528 | 166 |
| 191 | 3300050509 | nmdc:mga0qj67_25082_c1 | nmdc:mga0qj67_25082_c1_492_992 | 166 |
| 192 | 3300050509 | nmdc:mga0qj67_267747_c1 | nmdc:mga0qj67_267747_c1_466_966 | 166 |
| 193 | 3300050510 | nmdc:mga06r32_681968_c1 | nmdc:mga06r32_681968_c1_69_569 | 166 |
| 194 | 3300050511 | nmdc:mga08y16_139305_c1 | nmdc:mga08y16_139305_c1_213_713 | 166 |
| 195 | 3300050511 | nmdc:mga08y16_805340_c1 | nmdc:mga08y16_805340_c1_193_693 | 166 |
| 196 | 3300005334 | Ga0068869_100436513 | Ga0068869_1004365131 | 167 |
| 197 | 3300005338 | Ga0068868_100914000 | Ga0068868_1009140002 | 167 |
| 198 | 3300005468 | Ga0070707_100171197 | Ga0070707_1001711971 | 167 |
| 199 | 3300005471 | Ga0070698_100174881 | Ga0070698_1001748813 | 167 |
| 200 | 3300005617 | Ga0068859_101106379 | Ga0068859_1011063791 | 167 |
| 201 | 3300005719 | Ga0068861_100006081 | Ga0068861_1000060818 | 167 |
| 202 | 3300005985 | Ga0081539_10000147 | Ga0081539_1000014782 | 167 |
| 203 | 3300006931 | Ga0097620_101106391 | Ga0097620_1011063912 | 167 |
| 204 | 3300009101 | Ga0105247_10126432 | Ga0105247_101264324 | 167 |
| 205 | 3300009553 | Ga0105249_10001878 | Ga0105249_100018782 | 167 |
| 206 | 3300013102 | Ga0157371_10499204 | Ga0157371_104992041 | 167 |
| 207 | 3300013306 | Ga0163162_10299226 | Ga0163162_102992263 | 167 |
| 208 | 3300014745 | Ga0157377_10129021 | Ga0157377_101290212 | 167 |
| 209 | 3300017792 | Ga0163161_10379998 | Ga0163161_103799982 | 167 |
| 210 | 3300025900 | Ga0207710_10009223 | Ga0207710_100092231 | 167 |
| 211 | 3300025918 | Ga0207662_10024697 | Ga0207662_100246972 | 167 |
| 212 | 3300025922 | Ga0207646_10139125 | Ga0207646_101391253 | 167 |
| 213 | 3300025923 | Ga0207681_10074580 | Ga0207681_100745804 | 167 |
| 214 | 3300025936 | Ga0207670_10394979 | Ga0207670_103949792 | 167 |
| 215 | 3300025936 | Ga0207670_10709850 | Ga0207670_107098502 | 167 |
| 216 | 3300025942 | Ga0207689_11228311 | Ga0207689_112283111 | 167 |
| 217 | 3300025961 | Ga0207712_10001398 | Ga0207712_1000139814 | 167 |
| 218 | 3300025961 | Ga0207712_10086990 | Ga0207712_100869903 | 167 |
| 219 | 3300026035 | Ga0207703_11593431 | Ga0207703_115934311 | 167 |
| 220 | 3300026095 | Ga0207676_10275791 | Ga0207676_102757912 | 167 |
| 221 | 3300026118 | Ga0207675_100011632 | Ga0207675_1000116328 | 167 |
| 222 | 3300026118 | Ga0207675_100339332 | Ga0207675_1003393322 | 167 |
| 223 | 3300031251 | Ga0265327_10093145 | Ga0265327_100931452 | 167 |
| 224 | 3300037471 | Ga0395905_0053789 | Ga0395905_0053789_2836_3339 | 167 |
| 225 | 3300038443 | Ga0395901_0030068 | Ga0395901_0030068_2444_2947 | 167 |
| 226 | 3300009094 | Ga0111539_10786805 | Ga0111539_107868052 | 168 |
| 227 | 3300013102 | Ga0157371_10323542 | Ga0157371_103235422 | 168 |
| 228 | 3300003316 | rootH1_10167266 | rootH1_101672663 | 169 |
| 229 | 3300003354 | JGI25160J50197_1001424 | JGI25160J50197_10014249 | 169 |
| 230 | 3300005290 | Ga0065712_10349123 | Ga0065712_103491231 | 169 |
| 231 | 3300005293 | Ga0065715_10415480 | Ga0065715_104154801 | 169 |
| 232 | 3300005843 | Ga0068860_100270493 | Ga0068860_1002704932 | 169 |
| 233 | 3300009174 | Ga0105241_10417535 | Ga0105241_104175352 | 169 |
| 234 | 3300009545 | Ga0105237_10027460 | Ga0105237_100274604 | 169 |
| 235 | 3300010375 | Ga0105239_10039687 | Ga0105239_100396872 | 169 |
| 236 | 3300013307 | Ga0157372_10185112 | Ga0157372_101851121 | 169 |
| 237 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023252 | 169 |
| 238 | 3300025904 | Ga0207647_10066574 | Ga0207647_100665742 | 169 |
| 239 | 3300025914 | Ga0207671_10021067 | Ga0207671_100210673 | 169 |
| 240 | 3300025926 | Ga0207659_10754619 | Ga0207659_107546191 | 169 |
| 241 | 3300026142 | Ga0207698_10891957 | Ga0207698_108919572 | 169 |
| 242 | 3300044712 | Ga0453684_0072009 | Ga0453684_0072009_3260_3799 | 169 |
| 243 | 3300044712 | Ga0453684_1071136 | Ga0453684_1071136_232_753 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3loi-assembly1.cif.gz_A | crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms | 0.9476 | 7 | 169 |
| 1yud-assembly5.cif.gz_I | x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. | 0.9443 | 4 | 168 |
| 3loi-assembly1.cif.gz_A | crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms | 0.9248 | 7 | 169 |
| 1yud-assembly5.cif.gz_I | x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. | 0.9214 | 4 | 168 |
| 1znp-assembly3.cif.gz_F-2 | x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. | 0.9161 | 4 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3loiA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9483 | 7 | 168 | 2.60.120.10 |
| 1yudF01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9428 | 4 | 168 | 2.60.120.10 |
| af_Q8GYZ3_2_189_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9425 | 2 | 167 | 2.60.120.10 |
| 1yudF01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9368 | 4 | 168 | 2.60.120.10 |
| 3loiA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9254 | 7 | 168 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5TS17-F1-model_v4 | DUF985 domain-containing protein | 0.9916 | 4 | 168 |
|
| AF-A0A3B7MHK2-F1-model_v4 | Cupin domain-containing protein | 0.9899 | 2 | 168 |
|
| AF-A0A3D8Y8Y9-F1-model_v4 | DUF985 domain-containing protein | 0.9893 | 4 | 168 |
|
| AF-A0A1J5SAD5-F1-model_v4 | DUF985 domain-containing protein | 0.9878 | 1 | 169 |
|
| AF-A0A7C2JLT7-F1-model_v4 | Cupin domain-containing protein | 0.9862 | 32 | 169 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar