F355819

General Info

Members Datasets Scaffolds Average Seq Length
243 133 243 167

Family's Representative Sequence

Representative Sequence 3300042003|Ga0439443_030860|Ga0439443_030860_146_724
Length 192
Sequence LIKFIPTPKKNFIQCRPEFKPPLFSEMSAINQLIQQYNLQPHPEGGWYCQTYKSNEQITSESLPQRFEGSRAFSTAIYFLLEQGNFSAFHRIKSDECWHFYAGDPLDIYIIEQNGELKIISLGNDFEKGLSFQYVVPANSWFASRPAPNSEYCFVGCTVSPGFEFEDFELANSTELSAIYPKHKKIIEQLCR

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
107 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
116 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
117 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
118 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
119 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
120 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
121 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
124 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
125 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
126 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
127 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
128 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 0.82
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10167266 3300003316 Bacteria 2046
2 JGI25160J50197_1001424 3300003354 Bacteria 11971
3 Ga0065712_10086498 3300005290 Bacteria 2617
4 Ga0065712_10188957 3300005290 Bacteria 1153
5 Ga0065712_10349123 3300005290 Unclassified 790
6 Ga0065712_10444096 3300005290 Unclassified 691
7 Ga0065712_10622623 3300005290 Bacteria 580
8 Ga0065715_10220300 3300005293 Bacteria 1270
9 Ga0065715_10415480 3300005293 Bacteria 864
10 Ga0065707_10108956 3300005295 Unclassified 2488
11 Ga0065707_10679294 3300005295 Unclassified 649
12 Ga0070670_100085767 3300005331 Bacteria 2706
13 Ga0070670_100537501 3300005331 Bacteria 1042
14 Ga0068869_100436513 3300005334 Bacteria 1083
15 Ga0068868_100392158 3300005338 Bacteria 1197
16 Ga0068868_100914000 3300005338 Unclassified 798
17 Ga0070689_100004057 3300005340 Bacteria 9853
18 Ga0070687_100157436 3300005343 Unclassified 1339
19 Ga0070668_100098410 3300005347 Bacteria 2315
20 Ga0070668_100196564 3300005347 Bacteria 1654
21 Ga0070668_101018143 3300005347 Bacteria 745
22 Ga0070669_100265984 3300005353 Unclassified 1370
23 Ga0070675_100035871 3300005354 Bacteria 4032
24 Ga0070675_100344461 3300005354 Bacteria 1321
25 Ga0070675_100628951 3300005354 Bacteria 975
26 Ga0070674_100155229 3300005356 Bacteria 1731
27 Ga0070673_100157211 3300005364 Bacteria 1930
28 Ga0070673_100678861 3300005364 Bacteria 945
29 Ga0070688_100028583 3300005365 Bacteria 3330
30 Ga0070688_100597024 3300005365 Unclassified 845
31 Ga0070700_100423049 3300005441 Bacteria 1007
32 Ga0068867_100859814 3300005459 Bacteria 813
33 Ga0070685_10031948 3300005466 Bacteria 2945
34 Ga0070707_100171197 3300005468 Bacteria 2116
35 Ga0070698_100001648 3300005471 Bacteria 24891
36 Ga0070698_100009165 3300005471 Bacteria 10623
37 Ga0070698_100017594 3300005471 Bacteria 7533
38 Ga0070698_100174881 3300005471 Unclassified 2087
39 Ga0068853_100012451 3300005539 Bacteria 6920
40 Ga0070672_100011645 3300005543 Bacteria 6138
41 Ga0070672_100063280 3300005543 Bacteria 2921
42 Ga0070686_100345933 3300005544 Bacteria 1116
43 Ga0070704_100268427 3300005549 Bacteria 1409
44 Ga0068857_100084603 3300005577 Bacteria 2835
45 Ga0068854_100269630 3300005578 Bacteria 1366
46 Ga0068852_100126374 3300005616 Unclassified 2349
47 Ga0068852_100287273 3300005616 Bacteria 1588
48 Ga0068852_101034194 3300005616 Unclassified 841
49 Ga0068859_100012459 3300005617 Bacteria 8556
50 Ga0068859_100055060 3300005617 Bacteria 4002
51 Ga0068859_100398845 3300005617 Bacteria 1471
52 Ga0068859_100442702 3300005617 Unclassified 1396
53 Ga0068859_100920566 3300005617 Unclassified 958
54 Ga0068859_101106379 3300005617 Bacteria 871
55 Ga0068864_100302801 3300005618 Unclassified 1497
56 Ga0068861_100006081 3300005719 Bacteria 8212
57 Ga0068861_101482432 3300005719 Bacteria 665
58 Ga0068851_10192373 3300005834 Unclassified 1135
59 Ga0068870_10012117 3300005840 Bacteria 4020
60 Ga0068863_100082685 3300005841 Bacteria 3043
61 Ga0068863_100275399 3300005841 Bacteria 1629
62 Ga0068863_100641289 3300005841 Bacteria 1053
63 Ga0068860_100135679 3300005843 Unclassified 2363
64 Ga0068860_100267845 3300005843 Bacteria 1667
65 Ga0068860_100270493 3300005843 Bacteria 1658
66 Ga0068860_100293900 3300005843 Bacteria 1590
67 Ga0068860_100463771 3300005843 Unclassified 1261
68 Ga0068862_100443398 3300005844 Bacteria 1222
69 Ga0068862_100701309 3300005844 Bacteria 981
70 Ga0068862_101285156 3300005844 Unclassified 732
71 Ga0081539_10000147 3300005985 Bacteria 164274
72 Ga0070715_10101438 3300006163 Unclassified 1343
73 Ga0097621_100050896 3300006237 Unclassified 3369
74 Ga0097621_100607953 3300006237 Bacteria 1000
75 Ga0068871_100004221 3300006358 Bacteria 9950
76 Ga0068871_100203112 3300006358 Unclassified 1712
77 Ga0068871_100212287 3300006358 Bacteria 1674
78 Ga0068871_101822208 3300006358 Unclassified 578
79 Ga0075428_100005197 3300006844 Bacteria 14461
80 Ga0075428_100073295 3300006844 Unclassified 3739
81 Ga0075428_100073625 3300006844 Unclassified 3731
82 Ga0075428_100403580 3300006844 Bacteria 1465
83 Ga0075430_100027135 3300006846 Bacteria 4868
84 Ga0075430_100126784 3300006846 Unclassified 2128
85 Ga0075431_100610247 3300006847 Bacteria 1074
86 Ga0075429_100066540 3300006880 Unclassified 3137
87 Ga0097620_100012459 3300006931 Bacteria 8556
88 Ga0097620_100055059 3300006931 Bacteria 4002
89 Ga0097620_100398845 3300006931 Bacteria 1471
90 Ga0097620_100442694 3300006931 Unclassified 1396
91 Ga0097620_100920616 3300006931 Unclassified 958
92 Ga0097620_101106391 3300006931 Bacteria 871
93 Ga0111539_10070995 3300009094 Bacteria 4110
94 Ga0111539_10786805 3300009094 Bacteria 1107
95 Ga0111539_11924680 3300009094 Unclassified 686
96 Ga0105247_10126432 3300009101 Bacteria 1662
97 Ga0114129_10072551 3300009147 Bacteria 4798
98 Ga0114129_10581750 3300009147 Bacteria 1453
99 Ga0105241_10417535 3300009174 Bacteria 1180
100 Ga0105242_10061404 3300009176 Unclassified 3091
101 Ga0105242_10124408 3300009176 Bacteria 2218
102 Ga0105242_10243498 3300009176 Bacteria 1618
103 Ga0105242_10265086 3300009176 Bacteria 1553
104 Ga0105242_11460819 3300009176 Bacteria 713
105 Ga0105242_11644635 3300009176 Bacteria 677
106 Ga0105237_10027460 3300009545 Bacteria 5811
107 Ga0105249_10001878 3300009553 Bacteria 18200
108 Ga0105249_10256736 3300009553 Bacteria 1735
109 Ga0105239_10039687 3300010375 Bacteria 5158
110 Ga0105246_10340020 3300011119 Bacteria 1226
111 Ga0157371_10323542 3300013102 Bacteria 1119
112 Ga0157371_10499204 3300013102 Unclassified 898
113 Ga0157370_10201952 3300013104 Bacteria 1844
114 Ga0157374_12291045 3300013296 Bacteria 567
115 Ga0157378_10007504 3300013297 Bacteria 9523
116 Ga0163162_10005237 3300013306 Bacteria 12498
117 Ga0163162_10026963 3300013306 Bacteria 5682
118 Ga0163162_10035877 3300013306 Bacteria 4940
119 Ga0163162_10299226 3300013306 Bacteria 1741
120 Ga0163162_11433952 3300013306 Unclassified 786
121 Ga0157372_10143945 3300013307 Bacteria 2749
122 Ga0157372_10185112 3300013307 Bacteria 2412
123 Ga0157372_11089992 3300013307 Unclassified 924
124 Ga0157375_10228037 3300013308 Unclassified 2022
125 Ga0157375_10296762 3300013308 Bacteria 1779
126 Ga0157375_12420839 3300013308 Bacteria 627
127 Ga0163163_10565423 3300014325 Bacteria 1200
128 Ga0157380_10029978 3300014326 Bacteria 4163
129 Ga0157380_10257316 3300014326 Bacteria 1584
130 Ga0157380_10315163 3300014326 Bacteria 1448
131 Ga0157380_10436815 3300014326 Bacteria 1253
132 Ga0157377_10047490 3300014745 Bacteria 2405
133 Ga0157377_10129021 3300014745 Bacteria 1542
134 Ga0157377_10976677 3300014745 Unclassified 639
135 Ga0157377_11307817 3300014745 Unclassified 567
136 Ga0157377_11319104 3300014745 Bacteria 565
137 Ga0157376_10218611 3300014969 Unclassified 1763
138 Ga0157376_10376649 3300014969 Unclassified 1366
139 Ga0157376_12301778 3300014969 Bacteria 578
140 Ga0163161_10171999 3300017792 Unclassified 1657
141 Ga0163161_10211527 3300017792 Unclassified 1498
142 Ga0163161_10379998 3300017792 Bacteria 1129
143 Ga0207426_1000023 3300025302 Bacteria 545465
144 Ga0207682_10011772 3300025893 Bacteria 3417
145 Ga0207710_10009223 3300025900 Bacteria 4149
146 Ga0207647_10066574 3300025904 Bacteria 2184
147 Ga0207643_10004491 3300025908 Bacteria 7498
148 Ga0207671_10021067 3300025914 Bacteria 4952
149 Ga0207662_10024697 3300025918 Bacteria 3459
150 Ga0207646_10139125 3300025922 Bacteria 2186
151 Ga0207681_10074580 3300025923 Bacteria 2377
152 Ga0207681_10157274 3300025923 Bacteria 1709
153 Ga0207681_10824998 3300025923 Unclassified 775
154 Ga0207650_10194063 3300025925 Bacteria 1624
155 Ga0207650_10524478 3300025925 Bacteria 991
156 Ga0207659_10006818 3300025926 Bacteria 7021
157 Ga0207659_10476482 3300025926 Bacteria 1054
158 Ga0207659_10754619 3300025926 Bacteria 835
159 Ga0207659_10755578 3300025926 Bacteria 834
160 Ga0207686_10000175 3300025934 Bacteria 49208
161 Ga0207686_10271109 3300025934 Unclassified 1248
162 Ga0207686_10551205 3300025934 Bacteria 901
163 Ga0207670_10011684 3300025936 Bacteria 5109
164 Ga0207670_10394979 3300025936 Bacteria 1104
165 Ga0207670_10709850 3300025936 Unclassified 833
166 Ga0207691_10013389 3300025940 Bacteria 7852
167 Ga0207689_10131518 3300025942 Bacteria 2059
168 Ga0207689_11228311 3300025942 Bacteria 631
169 Ga0207651_10073380 3300025960 Unclassified 2433
170 Ga0207651_10197705 3300025960 Bacteria 1608
171 Ga0207712_10001398 3300025961 Bacteria 16497
172 Ga0207712_10086990 3300025961 Unclassified 2291
173 Ga0207712_10190350 3300025961 Unclassified 1619
174 Ga0207668_10098798 3300025972 Bacteria 2164
175 Ga0207640_10191514 3300025981 Bacteria 1542
176 Ga0207677_10284718 3300026023 Bacteria 1358
177 Ga0207703_11593431 3300026035 Bacteria 628
178 Ga0207639_10008496 3300026041 Bacteria 7039
179 Ga0207639_10314930 3300026041 Unclassified 1387
180 Ga0207708_10088163 3300026075 Unclassified 2390
181 Ga0207708_10336745 3300026075 Bacteria 1235
182 Ga0207708_10704242 3300026075 Bacteria 863
183 Ga0207641_10005276 3300026088 Bacteria 11037
184 Ga0207641_10022092 3300026088 Bacteria 5234
185 Ga0207641_10068248 3300026088 Bacteria 3048
186 Ga0207648_10265282 3300026089 Unclassified 1533
187 Ga0207676_10149456 3300026095 Bacteria 2010
188 Ga0207676_10275791 3300026095 Bacteria 1525
189 Ga0207674_10474996 3300026116 Unclassified 1208
190 Ga0207675_100011632 3300026118 Bacteria 8229
191 Ga0207675_100255018 3300026118 Unclassified 1699
192 Ga0207675_100339332 3300026118 Bacteria 1470
193 Ga0207675_100892462 3300026118 Bacteria 905
194 Ga0207683_10190748 3300026121 Bacteria 1861
195 Ga0207683_10937609 3300026121 Unclassified 804
196 Ga0207698_10623418 3300026142 Unclassified 1065
197 Ga0207698_10891957 3300026142 Bacteria 896
198 Ga0207428_10247268 3300027907 Unclassified 1331
199 Ga0207428_10480049 3300027907 Bacteria 904
200 Ga0268265_10237447 3300028380 Bacteria 1606
201 Ga0268264_10041950 3300028381 Bacteria 3786
202 Ga0268264_10108366 3300028381 Bacteria 2428
203 Ga0268264_10472369 3300028381 Unclassified 1218
204 Ga0268264_10912019 3300028381 Unclassified 882
205 Ga0265327_10093145 3300031251 Bacteria 1466
206 Ga0373937_1564049 3300036401 Bacteria 607
207 Ga0395905_0053789 3300037471 Bacteria 3768
208 Ga0395901_0030068 3300038443 Bacteria 5595
209 Ga0451800_0551985 3300041459 Bacteria 1736
210 Ga0451807_1972687 3300041486 Unclassified 591
211 Ga0439443_030860 3300042003 Bacteria 883
212 Ga0439446_0063756 3300042156 Unclassified 1117
213 Ga0439435_0164715 3300042436 Unclassified 717
214 Ga0439444_0005211 3300042437 Bacteria 1920
215 Ga0453684_0072009 3300044712 Bacteria 4366
216 Ga0453684_1071136 3300044712 Bacteria 853
217 Ga0495608_0730844 3300046511 Unclassified 587
218 Ga0495598_0008031 3300046537 Bacteria 2445
219 Ga0495621_0086134 3300046539 Bacteria 1178
220 Ga0495674_0492225 3300047319 Bacteria 982
221 Ga0501300_040175 3300049523 Unclassified 704
222 Ga0501201_000565 3300049651 Bacteria 3456
223 Ga0501206_001527 3300049653 Bacteria 2885
224 Ga0501217_005915 3300049661 Bacteria 2576
225 Ga0501223_000724 3300049663 Bacteria 7868
226 Ga0501224_000319 3300049664 Bacteria 5632
227 Ga0501233_004863 3300049668 Bacteria 2482
228 Ga0501235_019975 3300049669 Bacteria 1487
229 Ga0501243_100584 3300049675 Unclassified 583
230 Ga0501259_001368 3300049688 Bacteria 4076
231 Ga0501221_002154 3300049704 Bacteria 3270
232 Ga0501225_0000487 3300049705 Bacteria 12349
233 Ga0501234_000351 3300049707 Bacteria 6806
234 Ga0501245_003591 3300049708 Bacteria 2111
235 nmdc:mga05p37_104851_c1 3300050507 Bacteria 3478
236 nmdc:mga05p37_490056_c1 3300050507 Bacteria 1413
237 nmdc:mga09592_73615_c1 3300050508 Unclassified 2903
238 nmdc:mga09592_89328_c1 3300050508 Unclassified 2632
239 nmdc:mga0qj67_25082_c1 3300050509 Bacteria 4173
240 nmdc:mga0qj67_267747_c1 3300050509 Bacteria 1386
241 nmdc:mga06r32_681968_c1 3300050510 Bacteria 994
242 nmdc:mga08y16_139305_c1 3300050511 Bacteria 2522
243 nmdc:mga08y16_805340_c1 3300050511 Unclassified 932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100398845 Ga0068859_1003988453 160
2 3300005843 Ga0068860_100267845 Ga0068860_1002678452 160
3 3300006931 Ga0097620_100398845 Ga0097620_1003988451 160
4 3300025923 Ga0207681_10824998 Ga0207681_108249981 160
5 3300028381 Ga0268264_10108366 Ga0268264_101083663 160
6 3300005719 Ga0068861_101482432 Ga0068861_1014824321 163
7 3300026118 Ga0207675_100892462 Ga0207675_1008924621 163
8 3300005331 Ga0070670_100085767 Ga0070670_1000857672 164
9 3300005347 Ga0070668_101018143 Ga0070668_1010181432 164
10 3300005354 Ga0070675_100628951 Ga0070675_1006289512 164
11 3300005356 Ga0070674_100155229 Ga0070674_1001552292 164
12 3300014325 Ga0163163_10565423 Ga0163163_105654231 164
13 3300014326 Ga0157380_10029978 Ga0157380_100299783 164
14 3300025925 Ga0207650_10194063 Ga0207650_101940632 164
15 3300025926 Ga0207659_10476482 Ga0207659_104764822 164
16 3300049523 Ga0501300_040175 Ga0501300_040175_22_516 164
17 3300049651 Ga0501201_000565 Ga0501201_000565_1074_1568 164
18 3300049653 Ga0501206_001527 Ga0501206_001527_1281_1775 164
19 3300049661 Ga0501217_005915 Ga0501217_005915_1346_1840 164
20 3300049663 Ga0501223_000724 Ga0501223_000724_1056_1550 164
21 3300049664 Ga0501224_000319 Ga0501224_000319_3586_4080 164
22 3300049668 Ga0501233_004863 Ga0501233_004863_1231_1725 164
23 3300049669 Ga0501235_019975 Ga0501235_019975_697_1191 164
24 3300049675 Ga0501243_100584 Ga0501243_100584_17_511 164
25 3300049688 Ga0501259_001368 Ga0501259_001368_276_770 164
26 3300049704 Ga0501221_002154 Ga0501221_002154_922_1416 164
27 3300049705 Ga0501225_0000487 Ga0501225_0000487_4813_5307 164
28 3300049707 Ga0501234_000351 Ga0501234_000351_5655_6149 164
29 3300049708 Ga0501245_003591 Ga0501245_003591_1496_1990 164
30 3300005459 Ga0068867_100859814 Ga0068867_1008598141 165
31 3300005616 Ga0068852_100287273 Ga0068852_1002872733 165
32 3300005616 Ga0068852_101034194 Ga0068852_1010341941 165
33 3300013104 Ga0157370_10201952 Ga0157370_102019523 165
34 3300013307 Ga0157372_11089992 Ga0157372_110899922 165
35 3300036401 Ga0373937_1564049 Ga0373937_1564049_80_577 165
36 3300041459 Ga0451800_0551985 Ga0451800_0551985_210_707 165
37 3300041486 Ga0451807_1972687 Ga0451807_1972687_21_518 165
38 3300047319 Ga0495674_0492225 Ga0495674_0492225_393_890 165
39 3300005290 Ga0065712_10086498 Ga0065712_100864983 166
40 3300005290 Ga0065712_10188957 Ga0065712_101889572 166
41 3300005290 Ga0065712_10444096 Ga0065712_104440961 166
42 3300005290 Ga0065712_10622623 Ga0065712_106226231 166
43 3300005293 Ga0065715_10220300 Ga0065715_102203001 166
44 3300005295 Ga0065707_10108956 Ga0065707_101089562 166
45 3300005295 Ga0065707_10679294 Ga0065707_106792941 166
46 3300005331 Ga0070670_100537501 Ga0070670_1005375011 166
47 3300005338 Ga0068868_100392158 Ga0068868_1003921582 166
48 3300005340 Ga0070689_100004057 Ga0070689_10000405712 166
49 3300005343 Ga0070687_100157436 Ga0070687_1001574362 166
50 3300005347 Ga0070668_100098410 Ga0070668_1000984102 166
51 3300005347 Ga0070668_100196564 Ga0070668_1001965642 166
52 3300005353 Ga0070669_100265984 Ga0070669_1002659843 166
53 3300005354 Ga0070675_100035871 Ga0070675_1000358713 166
54 3300005354 Ga0070675_100344461 Ga0070675_1003444611 166
55 3300005364 Ga0070673_100157211 Ga0070673_1001572113 166
56 3300005364 Ga0070673_100678861 Ga0070673_1006788611 166
57 3300005365 Ga0070688_100028583 Ga0070688_1000285833 166
58 3300005365 Ga0070688_100597024 Ga0070688_1005970241 166
59 3300005441 Ga0070700_100423049 Ga0070700_1004230492 166
60 3300005466 Ga0070685_10031948 Ga0070685_100319483 166
61 3300005471 Ga0070698_100001648 Ga0070698_10000164813 166
62 3300005471 Ga0070698_100009165 Ga0070698_10000916512 166
63 3300005471 Ga0070698_100017594 Ga0070698_1000175948 166
64 3300005539 Ga0068853_100012451 Ga0068853_1000124515 166
65 3300005543 Ga0070672_100011645 Ga0070672_1000116459 166
66 3300005543 Ga0070672_100063280 Ga0070672_1000632805 166
67 3300005544 Ga0070686_100345933 Ga0070686_1003459332 166
68 3300005549 Ga0070704_100268427 Ga0070704_1002684272 166
69 3300005577 Ga0068857_100084603 Ga0068857_1000846033 166
70 3300005578 Ga0068854_100269630 Ga0068854_1002696302 166
71 3300005616 Ga0068852_100126374 Ga0068852_1001263742 166
72 3300005617 Ga0068859_100012459 Ga0068859_1000124592 166
73 3300005617 Ga0068859_100055060 Ga0068859_1000550602 166
74 3300005617 Ga0068859_100442702 Ga0068859_1004427022 166
75 3300005617 Ga0068859_100920566 Ga0068859_1009205662 166
76 3300005618 Ga0068864_100302801 Ga0068864_1003028011 166
77 3300005834 Ga0068851_10192373 Ga0068851_101923732 166
78 3300005840 Ga0068870_10012117 Ga0068870_100121172 166
79 3300005841 Ga0068863_100082685 Ga0068863_1000826854 166
80 3300005841 Ga0068863_100275399 Ga0068863_1002753993 166
81 3300005841 Ga0068863_100641289 Ga0068863_1006412892 166
82 3300005843 Ga0068860_100135679 Ga0068860_1001356792 166
83 3300005843 Ga0068860_100293900 Ga0068860_1002939002 166
84 3300005843 Ga0068860_100463771 Ga0068860_1004637713 166
85 3300005844 Ga0068862_100443398 Ga0068862_1004433982 166
86 3300005844 Ga0068862_100701309 Ga0068862_1007013092 166
87 3300005844 Ga0068862_101285156 Ga0068862_1012851561 166
88 3300006163 Ga0070715_10101438 Ga0070715_101014383 166
89 3300006237 Ga0097621_100050896 Ga0097621_1000508963 166
90 3300006237 Ga0097621_100607953 Ga0097621_1006079531 166
91 3300006358 Ga0068871_100004221 Ga0068871_1000042216 166
92 3300006358 Ga0068871_100203112 Ga0068871_1002031123 166
93 3300006358 Ga0068871_100212287 Ga0068871_1002122873 166
94 3300006358 Ga0068871_101822208 Ga0068871_1018222081 166
95 3300006844 Ga0075428_100005197 Ga0075428_10000519714 166
96 3300006844 Ga0075428_100073295 Ga0075428_1000732952 166
97 3300006844 Ga0075428_100073625 Ga0075428_1000736252 166
98 3300006844 Ga0075428_100403580 Ga0075428_1004035802 166
99 3300006846 Ga0075430_100027135 Ga0075430_1000271352 166
100 3300006846 Ga0075430_100126784 Ga0075430_1001267842 166
101 3300006847 Ga0075431_100610247 Ga0075431_1006102472 166
102 3300006880 Ga0075429_100066540 Ga0075429_1000665404 166
103 3300006931 Ga0097620_100012459 Ga0097620_10001245910 166
104 3300006931 Ga0097620_100055059 Ga0097620_1000550592 166
105 3300006931 Ga0097620_100442694 Ga0097620_1004426942 166
106 3300006931 Ga0097620_100920616 Ga0097620_1009206162 166
107 3300009094 Ga0111539_10070995 Ga0111539_100709956 166
108 3300009094 Ga0111539_11924680 Ga0111539_119246801 166
109 3300009147 Ga0114129_10072551 Ga0114129_100725513 166
110 3300009147 Ga0114129_10581750 Ga0114129_105817502 166
111 3300009176 Ga0105242_10061404 Ga0105242_100614044 166
112 3300009176 Ga0105242_10124408 Ga0105242_101244084 166
113 3300009176 Ga0105242_10243498 Ga0105242_102434982 166
114 3300009176 Ga0105242_10265086 Ga0105242_102650863 166
115 3300009176 Ga0105242_11460819 Ga0105242_114608191 166
116 3300009176 Ga0105242_11644635 Ga0105242_116446352 166
117 3300009553 Ga0105249_10256736 Ga0105249_102567362 166
118 3300011119 Ga0105246_10340020 Ga0105246_103400201 166
119 3300013296 Ga0157374_12291045 Ga0157374_122910451 166
120 3300013297 Ga0157378_10007504 Ga0157378_100075044 166
121 3300013306 Ga0163162_10005237 Ga0163162_100052372 166
122 3300013306 Ga0163162_10026963 Ga0163162_100269632 166
123 3300013306 Ga0163162_10035877 Ga0163162_100358772 166
124 3300013306 Ga0163162_11433952 Ga0163162_114339521 166
125 3300013307 Ga0157372_10143945 Ga0157372_101439451 166
126 3300013308 Ga0157375_10228037 Ga0157375_102280372 166
127 3300013308 Ga0157375_10296762 Ga0157375_102967621 166
128 3300013308 Ga0157375_12420839 Ga0157375_124208391 166
129 3300014326 Ga0157380_10257316 Ga0157380_102573162 166
130 3300014326 Ga0157380_10315163 Ga0157380_103151631 166
131 3300014326 Ga0157380_10436815 Ga0157380_104368152 166
132 3300014745 Ga0157377_10047490 Ga0157377_100474903 166
133 3300014745 Ga0157377_10976677 Ga0157377_109766771 166
134 3300014745 Ga0157377_11307817 Ga0157377_113078171 166
135 3300014745 Ga0157377_11319104 Ga0157377_113191041 166
136 3300014969 Ga0157376_10218611 Ga0157376_102186113 166
137 3300014969 Ga0157376_10376649 Ga0157376_103766493 166
138 3300014969 Ga0157376_12301778 Ga0157376_123017781 166
139 3300017792 Ga0163161_10171999 Ga0163161_101719993 166
140 3300017792 Ga0163161_10211527 Ga0163161_102115273 166
141 3300025893 Ga0207682_10011772 Ga0207682_100117723 166
142 3300025908 Ga0207643_10004491 Ga0207643_100044913 166
143 3300025923 Ga0207681_10157274 Ga0207681_101572741 166
144 3300025925 Ga0207650_10524478 Ga0207650_105244781 166
145 3300025926 Ga0207659_10006818 Ga0207659_100068185 166
146 3300025926 Ga0207659_10755578 Ga0207659_107555782 166
147 3300025934 Ga0207686_10000175 Ga0207686_1000017554 166
148 3300025934 Ga0207686_10271109 Ga0207686_102711091 166
149 3300025934 Ga0207686_10551205 Ga0207686_105512051 166
150 3300025936 Ga0207670_10011684 Ga0207670_100116845 166
151 3300025940 Ga0207691_10013389 Ga0207691_1001338910 166
152 3300025942 Ga0207689_10131518 Ga0207689_101315183 166
153 3300025960 Ga0207651_10073380 Ga0207651_100733803 166
154 3300025960 Ga0207651_10197705 Ga0207651_101977052 166
155 3300025961 Ga0207712_10190350 Ga0207712_101903502 166
156 3300025972 Ga0207668_10098798 Ga0207668_100987982 166
157 3300025981 Ga0207640_10191514 Ga0207640_101915142 166
158 3300026023 Ga0207677_10284718 Ga0207677_102847181 166
159 3300026041 Ga0207639_10008496 Ga0207639_100084965 166
160 3300026041 Ga0207639_10314930 Ga0207639_103149303 166
161 3300026075 Ga0207708_10088163 Ga0207708_100881631 166
162 3300026075 Ga0207708_10336745 Ga0207708_103367452 166
163 3300026075 Ga0207708_10704242 Ga0207708_107042422 166
164 3300026088 Ga0207641_10005276 Ga0207641_100052767 166
165 3300026088 Ga0207641_10022092 Ga0207641_100220923 166
166 3300026088 Ga0207641_10068248 Ga0207641_100682482 166
167 3300026089 Ga0207648_10265282 Ga0207648_102652823 166
168 3300026095 Ga0207676_10149456 Ga0207676_101494562 166
169 3300026116 Ga0207674_10474996 Ga0207674_104749961 166
170 3300026118 Ga0207675_100255018 Ga0207675_1002550183 166
171 3300026121 Ga0207683_10190748 Ga0207683_101907482 166
172 3300026121 Ga0207683_10937609 Ga0207683_109376091 166
173 3300026142 Ga0207698_10623418 Ga0207698_106234181 166
174 3300027907 Ga0207428_10247268 Ga0207428_102472683 166
175 3300027907 Ga0207428_10480049 Ga0207428_104800492 166
176 3300028380 Ga0268265_10237447 Ga0268265_102374472 166
177 3300028381 Ga0268264_10041950 Ga0268264_100419503 166
178 3300028381 Ga0268264_10472369 Ga0268264_104723693 166
179 3300028381 Ga0268264_10912019 Ga0268264_109120191 166
180 3300042003 Ga0439443_030860 Ga0439443_030860_146_724 166
181 3300042156 Ga0439446_0063756 Ga0439446_0063756_146_646 166
182 3300042436 Ga0439435_0164715 Ga0439435_0164715_168_668 166
183 3300042437 Ga0439444_0005211 Ga0439444_0005211_1179_1679 166
184 3300046511 Ga0495608_0730844 Ga0495608_0730844_53_553 166
185 3300046537 Ga0495598_0008031 Ga0495598_0008031_619_1119 166
186 3300046539 Ga0495621_0086134 Ga0495621_0086134_143_643 166
187 3300050507 nmdc:mga05p37_104851_c1 nmdc:mga05p37_104851_c1_1297_1797 166
188 3300050507 nmdc:mga05p37_490056_c1 nmdc:mga05p37_490056_c1_155_655 166
189 3300050508 nmdc:mga09592_73615_c1 nmdc:mga09592_73615_c1_422_922 166
190 3300050508 nmdc:mga09592_89328_c1 nmdc:mga09592_89328_c1_1028_1528 166
191 3300050509 nmdc:mga0qj67_25082_c1 nmdc:mga0qj67_25082_c1_492_992 166
192 3300050509 nmdc:mga0qj67_267747_c1 nmdc:mga0qj67_267747_c1_466_966 166
193 3300050510 nmdc:mga06r32_681968_c1 nmdc:mga06r32_681968_c1_69_569 166
194 3300050511 nmdc:mga08y16_139305_c1 nmdc:mga08y16_139305_c1_213_713 166
195 3300050511 nmdc:mga08y16_805340_c1 nmdc:mga08y16_805340_c1_193_693 166
196 3300005334 Ga0068869_100436513 Ga0068869_1004365131 167
197 3300005338 Ga0068868_100914000 Ga0068868_1009140002 167
198 3300005468 Ga0070707_100171197 Ga0070707_1001711971 167
199 3300005471 Ga0070698_100174881 Ga0070698_1001748813 167
200 3300005617 Ga0068859_101106379 Ga0068859_1011063791 167
201 3300005719 Ga0068861_100006081 Ga0068861_1000060818 167
202 3300005985 Ga0081539_10000147 Ga0081539_1000014782 167
203 3300006931 Ga0097620_101106391 Ga0097620_1011063912 167
204 3300009101 Ga0105247_10126432 Ga0105247_101264324 167
205 3300009553 Ga0105249_10001878 Ga0105249_100018782 167
206 3300013102 Ga0157371_10499204 Ga0157371_104992041 167
207 3300013306 Ga0163162_10299226 Ga0163162_102992263 167
208 3300014745 Ga0157377_10129021 Ga0157377_101290212 167
209 3300017792 Ga0163161_10379998 Ga0163161_103799982 167
210 3300025900 Ga0207710_10009223 Ga0207710_100092231 167
211 3300025918 Ga0207662_10024697 Ga0207662_100246972 167
212 3300025922 Ga0207646_10139125 Ga0207646_101391253 167
213 3300025923 Ga0207681_10074580 Ga0207681_100745804 167
214 3300025936 Ga0207670_10394979 Ga0207670_103949792 167
215 3300025936 Ga0207670_10709850 Ga0207670_107098502 167
216 3300025942 Ga0207689_11228311 Ga0207689_112283111 167
217 3300025961 Ga0207712_10001398 Ga0207712_1000139814 167
218 3300025961 Ga0207712_10086990 Ga0207712_100869903 167
219 3300026035 Ga0207703_11593431 Ga0207703_115934311 167
220 3300026095 Ga0207676_10275791 Ga0207676_102757912 167
221 3300026118 Ga0207675_100011632 Ga0207675_1000116328 167
222 3300026118 Ga0207675_100339332 Ga0207675_1003393322 167
223 3300031251 Ga0265327_10093145 Ga0265327_100931452 167
224 3300037471 Ga0395905_0053789 Ga0395905_0053789_2836_3339 167
225 3300038443 Ga0395901_0030068 Ga0395901_0030068_2444_2947 167
226 3300009094 Ga0111539_10786805 Ga0111539_107868052 168
227 3300013102 Ga0157371_10323542 Ga0157371_103235422 168
228 3300003316 rootH1_10167266 rootH1_101672663 169
229 3300003354 JGI25160J50197_1001424 JGI25160J50197_10014249 169
230 3300005290 Ga0065712_10349123 Ga0065712_103491231 169
231 3300005293 Ga0065715_10415480 Ga0065715_104154801 169
232 3300005843 Ga0068860_100270493 Ga0068860_1002704932 169
233 3300009174 Ga0105241_10417535 Ga0105241_104175352 169
234 3300009545 Ga0105237_10027460 Ga0105237_100274604 169
235 3300010375 Ga0105239_10039687 Ga0105239_100396872 169
236 3300013307 Ga0157372_10185112 Ga0157372_101851121 169
237 3300025302 Ga0207426_1000023 Ga0207426_1000023252 169
238 3300025904 Ga0207647_10066574 Ga0207647_100665742 169
239 3300025914 Ga0207671_10021067 Ga0207671_100210673 169
240 3300025926 Ga0207659_10754619 Ga0207659_107546191 169
241 3300026142 Ga0207698_10891957 Ga0207698_108919572 169
242 3300044712 Ga0453684_0072009 Ga0453684_0072009_3260_3799 169
243 3300044712 Ga0453684_1071136 Ga0453684_1071136_232_753 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06172

Cupin_5

Cupin superfamily (DUF985)

31

171

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.9476 7 169
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9443 4 168
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.9248 7 169
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9214 4 168
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.9161 4 148
ID Description Score Start End Superfamily
3loiA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9483 7 168 2.60.120.10
1yudF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9428 4 168 2.60.120.10
af_Q8GYZ3_2_189_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9425 2 167 2.60.120.10
1yudF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9368 4 168 2.60.120.10
3loiA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9254 7 168 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7J5TS17-F1-model_v4 DUF985 domain-containing protein 0.9916 4 168
AF-A0A3B7MHK2-F1-model_v4 Cupin domain-containing protein 0.9899 2 168
AF-A0A3D8Y8Y9-F1-model_v4 DUF985 domain-containing protein 0.9893 4 168
AF-A0A1J5SAD5-F1-model_v4 DUF985 domain-containing protein 0.9878 1 169
AF-A0A7C2JLT7-F1-model_v4 Cupin domain-containing protein 0.9862 32 169

Feature Viewer

pLDDT pTM Quality
95.26 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map