F355419

General Info

Members Datasets Scaffolds Average Seq Length
243 179 486 181

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100446175|Ga0070665_1004461753
Length 215
Sequence MVSTGCSMPPCRSTLESWRPAPLADEYIMTLLHALHASHRRRFLREGARLAVLGLPALAKPALAMVSGPRTLSMLHTHTLESIDLVYAVGEQYVPEALGALNRFLRDHYTGDVGRIDPQLFELLHHLQTTVGSSRPFEVISGYRCPTTNDRLRQTRGGGVASHSLHMEGRAIDVRLPGVPLATLREAALSLRAGGVGFYPHEQFVHVDNGRIRSW

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
174 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
177 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
178 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
179 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0.82
Rhizoplane 0.41
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100446175 3300005548 Bacteria 1303
2 JGI25151J46595_10068485 3300003187 Bacteria 1088
3 rootH2_10002316 3300003320 Bacteria 54390
4 Ga0055537_1021017 3300003773 Bacteria 978
5 Ga0055524_1012374 3300003775 Bacteria 3277
6 Ga0070670_100370310 3300005331 Bacteria 1261
7 Ga0070670_101066512 3300005331 Unclassified 736
8 Ga0068869_100154316 3300005334 Bacteria 1783
9 Ga0070666_10075626 3300005335 Bacteria 2296
10 Ga0070680_100024033 3300005336 Bacteria 4864
11 Ga0068868_100083575 3300005338 Bacteria 2563
12 Ga0070660_100208086 3300005339 Unclassified 1588
13 Ga0070660_100343215 3300005339 Unclassified 1229
14 Ga0070691_10091097 3300005341 Unclassified 1503
15 Ga0070687_100301970 3300005343 Unclassified 1016
16 Ga0070669_100326108 3300005353 Bacteria 1241
17 Ga0070675_100051843 3300005354 Bacteria 3372
18 Ga0070675_100255602 3300005354 Bacteria 1534
19 Ga0070675_101553058 3300005354 Bacteria 611
20 Ga0070674_100354976 3300005356 Bacteria 1185
21 Ga0070688_100428891 3300005365 Unclassified 984
22 Ga0070688_100749590 3300005365 Unclassified 760
23 Ga0070659_100340232 3300005366 Bacteria 1257
24 Ga0070667_100001227 3300005367 Bacteria 23326
25 Ga0070667_100001973 3300005367 Bacteria 18196
26 Ga0070713_100168598 3300005436 Bacteria 1960
27 Ga0070681_10037789 3300005458 Bacteria 4842
28 Ga0070679_100007092 3300005530 Bacteria 10457
29 Ga0070679_100122197 3300005530 Bacteria 2588
30 Ga0068855_100000157 3300005563 Bacteria 86631
31 Ga0068855_100220159 3300005563 Bacteria 2129
32 Ga0068855_100561017 3300005563 Unclassified 1235
33 Ga0068857_100079670 3300005577 Bacteria 2924
34 Ga0068857_100420560 3300005577 Bacteria 1246
35 Ga0068852_100006914 3300005616 Bacteria 8251
36 Ga0068852_100018731 3300005616 Bacteria 5460
37 Ga0068852_100165397 3300005616 Bacteria 2069
38 Ga0068859_100447321 3300005617 Bacteria 1388
39 Ga0068851_10102999 3300005834 Bacteria 1516
40 Ga0068870_10034556 3300005840 Bacteria 2588
41 Ga0068863_100764882 3300005841 Bacteria 962
42 Ga0068863_101640545 3300005841 Bacteria 652
43 Ga0068860_100066732 3300005843 Bacteria 3418
44 Ga0068862_100463631 3300005844 Unclassified 1196
45 Ga0097621_100411859 3300006237 Bacteria 1212
46 Ga0075370_10040077 3300006353 Unclassified 2641
47 Ga0068871_100040103 3300006358 Unclassified 3750
48 Ga0068865_100010497 3300006881 Bacteria 5766
49 Ga0068865_100460329 3300006881 Bacteria 1053
50 Ga0097620_100447334 3300006931 Bacteria 1388
51 Ga0099826_10000026 3300006948 Bacteria 146276
52 Ga0105240_10008384 3300009093 Bacteria 14794
53 Ga0105240_10626153 3300009093 Bacteria 1182
54 Ga0111539_10280157 3300009094 Bacteria 1940
55 Ga0105245_10035501 3300009098 Bacteria 4424
56 Ga0105241_10024546 3300009174 Plasmid 4476
57 Ga0105241_10481606 3300009174 Bacteria 1103
58 Ga0105242_11351353 3300009176 Bacteria 738
59 Ga0105248_10168774 3300009177 Bacteria 2466
60 Ga0105248_12519382 3300009177 Bacteria 586
61 Ga0105237_10288740 3300009545 Bacteria 1643
62 Ga0105238_10059955 3300009551 Bacteria 3811
63 Ga0105249_10134906 3300009553 Bacteria 2361
64 Ga0105239_10021234 3300010375 Bacteria 7159
65 Ga0105239_10461293 3300010375 Unclassified 1442
66 Ga0157370_10012572 3300013104 Bacteria 8771
67 Ga0157369_10004603 3300013105 Bacteria 16206
68 Ga0157378_10233321 3300013297 Bacteria 1754
69 Ga0157372_10069435 3300013307 Bacteria 3963
70 Ga0157380_10697665 3300014326 Bacteria 1019
71 Ga0157379_10001643 3300014968 Bacteria 18470
72 Ga0157379_10241853 3300014968 Bacteria 1637
73 Ga0157379_10418536 3300014968 Bacteria 1234
74 Ga0157376_10003842 3300014969 Bacteria 10385
75 Ga0157376_10007983 3300014969 Bacteria 7596
76 Ga0157376_10709008 3300014969 Bacteria 1012
77 Ga0209565_1002880 3300025263 Bacteria 5901
78 Ga0209675_1007670 3300025291 Bacteria 4091
79 Ga0209025_1000868 3300025294 Bacteria 47781
80 Ga0209256_1000127 3300025299 Bacteria 164393
81 Ga0207656_10090607 3300025321 Unclassified 1387
82 Ga0207692_10674800 3300025898 Bacteria 669
83 Ga0207680_10042915 3300025903 Bacteria 2649
84 Ga0207643_10041772 3300025908 Bacteria 2585
85 Ga0207654_10108182 3300025911 Bacteria 1725
86 Ga0207654_10205936 3300025911 Unclassified 1298
87 Ga0207707_10013075 3300025912 Bacteria 7230
88 Ga0207707_10076581 3300025912 Bacteria 2919
89 Ga0207695_10000004 3300025913 Bacteria 1288665
90 Ga0207695_10168940 3300025913 Bacteria 2114
91 Ga0207695_10497851 3300025913 Unclassified 1101
92 Ga0207671_10226710 3300025914 Bacteria 1465
93 Ga0207660_10003712 3300025917 Bacteria 9946
94 Ga0207657_10066480 3300025919 Bacteria 3068
95 Ga0207652_10014582 3300025921 Bacteria 6371
96 Ga0207652_10165405 3300025921 Unclassified 1983
97 Ga0207694_10000015 3300025924 Bacteria 363898
98 Ga0207659_10032757 3300025926 Unclassified 3570
99 Ga0207659_10038227 3300025926 Bacteria 3337
100 Ga0207659_10161220 3300025926 Unclassified 1761
101 Ga0207687_10198103 3300025927 Bacteria 1567
102 Ga0207686_10112024 3300025934 Bacteria 1842
103 Ga0207704_10009688 3300025938 Bacteria 4661
104 Ga0207689_10078917 3300025942 Bacteria 2705
105 Ga0207689_10148412 3300025942 Bacteria 1932
106 Ga0207689_10207952 3300025942 Unclassified 1616
107 Ga0207661_10134919 3300025944 Bacteria 2119
108 Ga0207667_10000160 3300025949 Bacteria 99695
109 Ga0207667_11221164 3300025949 Unclassified 731
110 Ga0207651_11020210 3300025960 Unclassified 740
111 Ga0207658_10000414 3300025986 Bacteria 40548
112 Ga0207658_10003135 3300025986 Bacteria 11829
113 Ga0207677_10080050 3300026023 Bacteria 2339
114 Ga0207677_10871710 3300026023 Unclassified 810
115 Ga0207639_10038503 3300026041 Bacteria 3557
116 Ga0207702_10412091 3300026078 Bacteria 1305
117 Ga0207641_10275735 3300026088 Bacteria 1580
118 Ga0207674_10022624 3300026116 Bacteria 6746
119 Ga0207683_10162395 3300026121 Bacteria 2020
120 Ga0207698_10011083 3300026142 Bacteria 5829
121 Ga0207698_10012880 3300026142 Bacteria 5494
122 Ga0207698_10383732 3300026142 Unclassified 1337
123 Ga0209282_1000044 3300027666 Bacteria 119005
124 Ga0268266_10775927 3300028379 Bacteria 925
125 Ga0268265_10159095 3300028380 Bacteria 1916
126 Ga0268265_10445397 3300028380 Unclassified 1208
127 Ga0268264_10048707 3300028381 Bacteria 3525
128 Ga0265338_10012367 3300028800 Bacteria 9731
129 Ga0265340_10027290 3300031247 Unclassified 2880
130 Ga0307513_10603229 3300031456 Unclassified 807
131 Ga0307408_100579720 3300031548 Bacteria 994
132 Ga0316575_10023044 3300031665 Bacteria 2405
133 Ga0316579_10000237 3300031691 Bacteria 16867
134 Ga0265342_10280412 3300031712 Bacteria 882
135 Ga0316578_10060511 3300031728 Bacteria 2229
136 Ga0307516_10008333 3300031730 Bacteria 11750
137 Ga0307405_10035237 3300031731 Bacteria 2987
138 Ga0307410_10360935 3300031852 Bacteria 1163
139 Ga0307406_10023935 3300031901 Bacteria 3641
140 Ga0307407_10075542 3300031903 Bacteria 2020
141 Ga0307412_10037732 3300031911 Bacteria 3106
142 Ga0307409_100464570 3300031995 Bacteria 1224
143 Ga0307416_100015949 3300032002 Bacteria 5206
144 Ga0307416_100139913 3300032002 Bacteria 2198
145 Ga0307414_10690955 3300032004 Bacteria 923
146 Ga0307411_10032233 3300032005 Bacteria 3235
147 Ga0307411_10137435 3300032005 Bacteria 1797
148 Ga0307411_10279017 3300032005 Bacteria 1329
149 Ga0307415_100359220 3300032126 Bacteria 1229
150 Ga0316583_10023786 3300032133 Bacteria 2186
151 Ga0373937_0189221 3300036401 Bacteria 1934
152 Ga0316582_0033353 3300036647 Bacteria 3162
153 Ga0373925_0097941 3300037068 Bacteria 2250
154 Ga0395900_0104130 3300037418 Bacteria 2915
155 Ga0395898_0058487 3300037466 Bacteria 3752
156 Ga0316581_0017927 3300037588 Bacteria 2050
157 Ga0395901_0101299 3300038443 Bacteria 3022
158 Ga0451577_0144491 3300042876 Bacteria 2138
159 Ga0451577_0284496 3300042876 Bacteria 1498
160 Ga0451577_0331524 3300042876 Bacteria 1380
161 Ga0466969_0000100 3300044656 Bacteria 45570
162 Ga0453683_0003083 3300044673 Bacteria 12464
163 Ga0466965_0153471 3300044683 Bacteria 1204
164 Ga0466966_0014788 3300044684 Bacteria 5163
165 Ga0466961_0168778 3300044693 Bacteria 1361
166 Ga0453684_0106250 3300044712 Bacteria 3421
167 Ga0453684_0242612 3300044712 Bacteria 2073
168 Ga0453684_0524671 3300044712 Bacteria 1308
169 Ga0453684_0758101 3300044712 Bacteria 1050
170 Ga0466970_0378527 3300044765 Bacteria 805
171 Ga0466959_0054137 3300045049 Bacteria 2932
172 Ga0451576_0044327 3300045051 Bacteria 4689
173 Ga0451576_0126973 3300045051 Bacteria 2657
174 Ga0495592_0386932 3300046454 Bacteria 889
175 Ga0495580_0038540 3300046472 Bacteria 3422
176 Ga0495664_0113423 3300046477 Bacteria 1637
177 Ga0495664_0256072 3300046477 Bacteria 1058
178 Ga0495584_0067731 3300046491 Bacteria 1794
179 Ga0495610_0000112 3300046512 Bacteria 94977
180 Ga0495616_0022838 3300046513 Bacteria 3373
181 Ga0495648_0060927 3300046524 Bacteria 2243
182 Ga0495666_0056447 3300046526 Bacteria 1881
183 Ga0495642_0115277 3300046528 Bacteria 1151
184 Ga0495652_0143861 3300046529 Bacteria 1872
185 Ga0495665_0041599 3300046531 Bacteria 2447
186 Ga0495586_0278330 3300046535 Bacteria 957
187 Ga0495609_0000495 3300046538 Bacteria 31533
188 Ga0495645_0184535 3300046543 Bacteria 1426
189 Ga0495645_0250229 3300046543 Bacteria 1178
190 Ga0495661_0002827 3300046665 Bacteria 13153
191 Ga0495613_0824646 3300046689 Unclassified 604
192 Ga0495671_0001522 3300046692 Bacteria 15467
193 Ga0495649_0047448 3300046694 Bacteria 2336
194 Ga0495604_0017527 3300047317 Bacteria 5735
195 Ga0495675_0278086 3300047444 Bacteria 999
196 Ga0496100_0243424 3300048903 Bacteria 1328
197 Ga0496116_0001363 3300048919 Bacteria 27663
198 Ga0496121_0001757 3300048924 Bacteria 35327
199 Ga0496123_0000244 3300048926 Bacteria 109574
200 Ga0496125_0296279 3300048928 Bacteria 993
201 Ga0495682_0002310 3300049460 Bacteria 9083
202 Ga0501034_0091420 3300049571 Bacteria 3041
203 Ga0501036_0341966 3300049572 Bacteria 1250
204 Ga0501039_0681378 3300049575 Bacteria 804
205 Ga0501041_0662672 3300049577 Bacteria 667
206 Ga0501047_0002000 3300049581 Bacteria 19547
207 Ga0501047_0155869 3300049581 Bacteria 2157
208 Ga0501047_0295292 3300049581 Bacteria 1464
209 Ga0501067_0000095 3300049583 Bacteria 51128
210 Ga0501067_0015602 3300049583 Bacteria 4206
211 Ga0501069_0067836 3300049585 Bacteria 1996
212 Ga0501069_0077048 3300049585 Bacteria 1875
213 Ga0501070_0548639 3300049586 Bacteria 925
214 Ga0501072_0003957 3300049588 Bacteria 11210
215 Ga0501072_0575909 3300049588 Bacteria 888
216 Ga0501073_0018723 3300049589 Bacteria 5006
217 Ga0501073_0063820 3300049589 Bacteria 2568
218 Ga0501073_0348432 3300049589 Bacteria 1022
219 Ga0501073_0477584 3300049589 Bacteria 862
220 Ga0501074_0065992 3300049590 Bacteria 2604
221 Ga0501074_0186190 3300049590 Bacteria 1480
222 Ga0501074_0326991 3300049590 Bacteria 1088
223 Ga0501075_0756612 3300049591 Bacteria 740
224 Ga0501079_0083293 3300049741 Bacteria 2474
225 Ga0501080_0007537 3300049742 Bacteria 9834
226 Ga0501080_0160321 3300049742 Bacteria 2078
227 Ga0501080_0498453 3300049742 Bacteria 1088
228 Ga0501080_0498455 3300049742 Bacteria 1088
229 Ga0501083_0174510 3300049744 Bacteria 1405
230 Ga0501035_0021763 3300049822 Bacteria 5894
231 Ga0501044_0285007 3300049823 Bacteria 1584
232 Ga0501044_0662875 3300049823 Bacteria 931
233 Ga0501045_0023511 3300049824 Bacteria 4419
234 Ga0501045_0774974 3300049824 Bacteria 706
235 nmdc:mga08y16_776756_c1 3300050511 Unclassified 952
236 Ga0500650_0186077 3300053098 Unclassified 950
237 Ga0500619_001407 3300053154 Bacteria 4248
238 Ga0501084_0000042 3300054114 Bacteria 100450
239 Ga0501084_0735471 3300054114 Bacteria 831
240 2834644489 2834641062 Bacteria 5559922
241 2881928331 2881927736 Bacteria 3993927
242 2887378847 2887375801 Bacteria 5334027
243 8003404102 8003400568 Bacteria 5535898
244 Ga0070665_100446175
245 JGI25151J46595_10068485
246 rootH2_10002316
247 Ga0055537_1021017
248 Ga0055524_1012374
249 Ga0070670_100370310
250 Ga0070670_101066512
251 Ga0068869_100154316
252 Ga0070666_10075626
253 Ga0070680_100024033
254 Ga0068868_100083575
255 Ga0070660_100208086
256 Ga0070660_100343215
257 Ga0070691_10091097
258 Ga0070687_100301970
259 Ga0070669_100326108
260 Ga0070675_100051843
261 Ga0070675_100255602
262 Ga0070675_101553058
263 Ga0070674_100354976
264 Ga0070688_100428891
265 Ga0070688_100749590
266 Ga0070659_100340232
267 Ga0070667_100001227
268 Ga0070667_100001973
269 Ga0070713_100168598
270 Ga0070681_10037789
271 Ga0070679_100007092
272 Ga0070679_100122197
273 Ga0068855_100000157
274 Ga0068855_100220159
275 Ga0068855_100561017
276 Ga0068857_100079670
277 Ga0068857_100420560
278 Ga0068852_100006914
279 Ga0068852_100018731
280 Ga0068852_100165397
281 Ga0068859_100447321
282 Ga0068851_10102999
283 Ga0068870_10034556
284 Ga0068863_100764882
285 Ga0068863_101640545
286 Ga0068860_100066732
287 Ga0068862_100463631
288 Ga0097621_100411859
289 Ga0075370_10040077
290 Ga0068871_100040103
291 Ga0068865_100010497
292 Ga0068865_100460329
293 Ga0097620_100447334
294 Ga0099826_10000026
295 Ga0105240_10008384
296 Ga0105240_10626153
297 Ga0111539_10280157
298 Ga0105245_10035501
299 Ga0105241_10024546
300 Ga0105241_10481606
301 Ga0105242_11351353
302 Ga0105248_10168774
303 Ga0105248_12519382
304 Ga0105237_10288740
305 Ga0105238_10059955
306 Ga0105249_10134906
307 Ga0105239_10021234
308 Ga0105239_10461293
309 Ga0157370_10012572
310 Ga0157369_10004603
311 Ga0157378_10233321
312 Ga0157372_10069435
313 Ga0157380_10697665
314 Ga0157379_10001643
315 Ga0157379_10241853
316 Ga0157379_10418536
317 Ga0157376_10003842
318 Ga0157376_10007983
319 Ga0157376_10709008
320 Ga0209565_1002880
321 Ga0209675_1007670
322 Ga0209025_1000868
323 Ga0209256_1000127
324 Ga0207656_10090607
325 Ga0207692_10674800
326 Ga0207680_10042915
327 Ga0207643_10041772
328 Ga0207654_10108182
329 Ga0207654_10205936
330 Ga0207707_10013075
331 Ga0207707_10076581
332 Ga0207695_10000004
333 Ga0207695_10168940
334 Ga0207695_10497851
335 Ga0207671_10226710
336 Ga0207660_10003712
337 Ga0207657_10066480
338 Ga0207652_10014582
339 Ga0207652_10165405
340 Ga0207694_10000015
341 Ga0207659_10032757
342 Ga0207659_10038227
343 Ga0207659_10161220
344 Ga0207687_10198103
345 Ga0207686_10112024
346 Ga0207704_10009688
347 Ga0207689_10078917
348 Ga0207689_10148412
349 Ga0207689_10207952
350 Ga0207661_10134919
351 Ga0207667_10000160
352 Ga0207667_11221164
353 Ga0207651_11020210
354 Ga0207658_10000414
355 Ga0207658_10003135
356 Ga0207677_10080050
357 Ga0207677_10871710
358 Ga0207639_10038503
359 Ga0207702_10412091
360 Ga0207641_10275735
361 Ga0207674_10022624
362 Ga0207683_10162395
363 Ga0207698_10011083
364 Ga0207698_10012880
365 Ga0207698_10383732
366 Ga0209282_1000044
367 Ga0268266_10775927
368 Ga0268265_10159095
369 Ga0268265_10445397
370 Ga0268264_10048707
371 Ga0265338_10012367
372 Ga0265340_10027290
373 Ga0307513_10603229
374 Ga0307408_100579720
375 Ga0316575_10023044
376 Ga0316579_10000237
377 Ga0265342_10280412
378 Ga0316578_10060511
379 Ga0307516_10008333
380 Ga0307405_10035237
381 Ga0307410_10360935
382 Ga0307406_10023935
383 Ga0307407_10075542
384 Ga0307412_10037732
385 Ga0307409_100464570
386 Ga0307416_100015949
387 Ga0307416_100139913
388 Ga0307414_10690955
389 Ga0307411_10032233
390 Ga0307411_10137435
391 Ga0307411_10279017
392 Ga0307415_100359220
393 Ga0316583_10023786
394 Ga0373937_0189221
395 Ga0316582_0033353
396 Ga0373925_0097941
397 Ga0395900_0104130
398 Ga0395898_0058487
399 Ga0316581_0017927
400 Ga0395901_0101299
401 Ga0451577_0144491
402 Ga0451577_0284496
403 Ga0451577_0331524
404 Ga0466969_0000100
405 Ga0453683_0003083
406 Ga0466965_0153471
407 Ga0466966_0014788
408 Ga0466961_0168778
409 Ga0453684_0106250
410 Ga0453684_0242612
411 Ga0453684_0524671
412 Ga0453684_0758101
413 Ga0466970_0378527
414 Ga0466959_0054137
415 Ga0451576_0044327
416 Ga0451576_0126973
417 Ga0495592_0386932
418 Ga0495580_0038540
419 Ga0495664_0113423
420 Ga0495664_0256072
421 Ga0495584_0067731
422 Ga0495610_0000112
423 Ga0495616_0022838
424 Ga0495648_0060927
425 Ga0495666_0056447
426 Ga0495642_0115277
427 Ga0495652_0143861
428 Ga0495665_0041599
429 Ga0495586_0278330
430 Ga0495609_0000495
431 Ga0495645_0184535
432 Ga0495645_0250229
433 Ga0495661_0002827
434 Ga0495613_0824646
435 Ga0495671_0001522
436 Ga0495649_0047448
437 Ga0495604_0017527
438 Ga0495675_0278086
439 Ga0496100_0243424
440 Ga0496116_0001363
441 Ga0496121_0001757
442 Ga0496123_0000244
443 Ga0496125_0296279
444 Ga0495682_0002310
445 Ga0501034_0091420
446 Ga0501036_0341966
447 Ga0501039_0681378
448 Ga0501041_0662672
449 Ga0501047_0002000
450 Ga0501047_0155869
451 Ga0501047_0295292
452 Ga0501067_0000095
453 Ga0501067_0015602
454 Ga0501069_0067836
455 Ga0501069_0077048
456 Ga0501070_0548639
457 Ga0501072_0003957
458 Ga0501072_0575909
459 Ga0501073_0018723
460 Ga0501073_0063820
461 Ga0501073_0348432
462 Ga0501073_0477584
463 Ga0501074_0065992
464 Ga0501074_0186190
465 Ga0501074_0326991
466 Ga0501075_0756612
467 Ga0501079_0083293
468 Ga0501080_0007537
469 Ga0501080_0160321
470 Ga0501080_0498453
471 Ga0501080_0498455
472 Ga0501083_0174510
473 Ga0501035_0021763
474 Ga0501044_0285007
475 Ga0501044_0662875
476 Ga0501045_0023511
477 Ga0501045_0774974
478 nmdc:mga08y16_776756_c1
479 Ga0500650_0186077
480 Ga0500619_001407
481 Ga0501084_0000042
482 Ga0501084_0735471
483 2834644489
484 2881928331
485 2887378847
486 8003404102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05951

Peptidase_M15_2

Bacterial protein of unknown function (DUF882)

64

215

0.97

PF08291

Peptidase_M15_3

Peptidase M15

98

208

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbu-assembly1.cif.gz_A hydrolase metallo (zn) dd-peptidase 0.7956 96 188
7e2i-assembly1.cif.gz_G cryo-em structure of hdisp1nnn-shhn 0.6692 81 188
2wg3-assembly2.cif.gz_B crystal structure of the complex between human hedgehog-interacting protein hip and desert hedgehog without calcium 0.6523 87 185
5opz-assembly2.cif.gz_B crystal structure of serratia marcescens l-ala d-glu endopeptidase chix 0.6442 69 164
2wg4-assembly1.cif.gz_A crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog without calcium 0.6383 87 185
ID Description Score Start End Superfamily
af_P0AB06_63_182_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.9695 68 187 3.30.1380.10
af_P0AB06_63_182_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.9537 68 187 3.30.1380.10
af_C7G020_710_890_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.7784 85 148 3.30.1380.10
af_O53850_63_250_3.30.1380.10 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.7309 82 146 3.30.1380.10
1lbuA02 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2; 0.7242 66 188 3.30.1380.10
ID Description Score Start End GO Terms
AF-A0A7J5EJP2-F1-model_v4 DUF882 domain-containing protein 0.9945 143 188
AF-A0A512H3C8-F1-model_v4 Twin-arginine translocation pathway signal 0.9907 71 187
AF-A0A7W0EHV3-F1-model_v4 DUF882 domain-containing protein 0.9906 143 187
AF-A0A3N9UN59-F1-model_v4 DUF882 domain-containing protein 0.9902 136 187
AF-H1SJ62-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9854 58 182

Map