F355373

General Info

Members Datasets Scaffolds Average Seq Length
243 174 486 328

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100001031|Ga0070705_10000103111
Length 374
Sequence MGEAGSGDPLALDVEAMVERLTAELRAAVRELGRRGAVVAVSGGVDSGVCAALAVRALGPQRVLLLRLPERDIGGAASDLGLELAQALGAPTEEESITAALEGLGCYRRRDAAIRMVFPDYEPSWRHKLVRSPPSGGIIVFSLVVERPDGTTEERVLPSAAYRALIAATNMKQRVRKLIEYTWADQLGYAVIGTPNLLEFDQGFFVKGGDGLADVKPIAHLYKTQVYALAQALGLPDAIASRAPTTETFSLPQTQEEFYFGHPYERMDLLVWGRDGGVPADALAPQVGLSPDAVEAAYWEIDRRRVATRYLHAPAVMLDAPLDSAESEPGRRAGPVGSGCAHTALRAAHVHPHRHPPDQRALSSPDPPRCPPAA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
155 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 7
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100001031 3300005440 Bacteria 15524
2 JGI24737J22298_10048504 3300001990 Bacteria 1293
3 Ga0065712_10000634 3300005290 Bacteria 17623
4 Ga0065707_10008115 3300005295 Bacteria 4106
5 Ga0070658_10024355 3300005327 Bacteria 4856
6 Ga0070658_10083699 3300005327 Bacteria 2623
7 Ga0070683_100057788 3300005329 Bacteria 3604
8 Ga0070683_100062184 3300005329 Bacteria 3471
9 Ga0070683_100459671 3300005329 Bacteria 1215
10 Ga0070683_100501513 3300005329 Bacteria 1159
11 Ga0068869_100253001 3300005334 Bacteria 1408
12 Ga0070680_100025974 3300005336 Bacteria 4684
13 Ga0070680_100154557 3300005336 Bacteria 1927
14 Ga0070680_100237281 3300005336 Bacteria 1541
15 Ga0070682_100153015 3300005337 Bacteria 1585
16 Ga0068868_100020563 3300005338 Bacteria 4963
17 Ga0070660_100017553 3300005339 Bacteria 5218
18 Ga0070692_10005007 3300005345 Bacteria 5597
19 Ga0070668_100279833 3300005347 Bacteria 1393
20 Ga0070668_100318334 3300005347 Bacteria 1309
21 Ga0070671_100064284 3300005355 Bacteria 3056
22 Ga0070673_100000433 3300005364 Bacteria 22114
23 Ga0070688_100060208 3300005365 Bacteria 2397
24 Ga0070688_100354244 3300005365 Bacteria 1075
25 Ga0070659_100009296 3300005366 Bacteria 7216
26 Ga0070714_100004530 3300005435 Bacteria 10475
27 Ga0070710_10000001 3300005437 Bacteria 552187
28 Ga0070700_100015012 3300005441 Bacteria 4382
29 Ga0070694_100026692 3300005444 Bacteria 3745
30 Ga0070708_100295980 3300005445 Bacteria 1524
31 Ga0070663_100124655 3300005455 Bacteria 1950
32 Ga0070678_100111432 3300005456 Bacteria 2141
33 Ga0070662_100134525 3300005457 Bacteria 1910
34 Ga0070684_100067350 3300005535 Bacteria 3144
35 Ga0070684_100184246 3300005535 Bacteria 1899
36 Ga0070672_100031453 3300005543 Bacteria 3995
37 Ga0070672_100112373 3300005543 Bacteria 2222
38 Ga0070686_100009777 3300005544 Bacteria 5390
39 Ga0070696_100001870 3300005546 Bacteria 13807
40 Ga0070696_100069557 3300005546 Bacteria 2474
41 Ga0070696_100095919 3300005546 Bacteria 2119
42 Ga0070665_100002179 3300005548 Bacteria 21835
43 Ga0068855_100158564 3300005563 Bacteria 2569
44 Ga0070702_100005426 3300005615 Bacteria 5934
45 Ga0068859_100223206 3300005617 Bacteria 1972
46 Ga0068864_100051222 3300005618 Bacteria 3556
47 Ga0068861_100227343 3300005719 Bacteria 1580
48 Ga0068851_10036416 3300005834 Bacteria 2463
49 Ga0068870_10042284 3300005840 Bacteria 2372
50 Ga0068870_10200213 3300005840 Bacteria 1210
51 Ga0081455_10117644 3300005937 Bacteria 2100
52 Ga0081538_10000043 3300005981 Bacteria 115532
53 Ga0081539_10002564 3300005985 Bacteria 25179
54 Ga0081539_10013823 3300005985 Bacteria 6042
55 Ga0070717_10000010 3300006028 Bacteria 283501
56 Ga0075365_10001647 3300006038 Bacteria 10312
57 Ga0075365_10083715 3300006038 Bacteria 2164
58 Ga0075365_10173521 3300006038 Bacteria 1505
59 Ga0075363_100032811 3300006048 Bacteria 2699
60 Ga0075364_10014089 3300006051 Bacteria 4933
61 Ga0070712_100000108 3300006175 Bacteria 42900
62 Ga0097621_100004327 3300006237 Bacteria 9863
63 Ga0075428_100035333 3300006844 Bacteria 5510
64 Ga0075428_100188349 3300006844 Bacteria 2232
65 Ga0075430_100001348 3300006846 Bacteria 19857
66 Ga0075430_100023930 3300006846 Bacteria 5201
67 Ga0075430_100033002 3300006846 Bacteria 4394
68 Ga0075434_100216305 3300006871 Bacteria 1936
69 Ga0075429_100042782 3300006880 Bacteria 3942
70 Ga0075429_100101330 3300006880 Bacteria 2514
71 Ga0068865_100137821 3300006881 Bacteria 1836
72 Ga0097620_100223226 3300006931 Bacteria 1972
73 Ga0111539_10001264 3300009094 Bacteria 33736
74 Ga0111539_10009084 3300009094 Bacteria 12582
75 Ga0111539_10019932 3300009094 Bacteria 8261
76 Ga0111539_10249412 3300009094 Bacteria 2067
77 Ga0105245_10278850 3300009098 Bacteria 1633
78 Ga0105247_10092983 3300009101 Bacteria 1917
79 Ga0114129_10001533 3300009147 Bacteria 31301
80 Ga0114129_10109348 3300009147 Bacteria 3816
81 Ga0114129_10292298 3300009147 Bacteria 2174
82 Ga0105243_10041253 3300009148 Bacteria 3609
83 Ga0105243_10230853 3300009148 Bacteria 1642
84 Ga0105242_10033086 3300009176 Bacteria 4138
85 Ga0105248_10003765 3300009177 Bacteria 16798
86 Ga0105248_10015719 3300009177 Bacteria 8342
87 Ga0157374_10201119 3300013296 Bacteria 1951
88 Ga0157378_10005034 3300013297 Bacteria 11604
89 Ga0157375_10037413 3300013308 Bacteria 4650
90 Ga0157375_10084856 3300013308 Bacteria 3216
91 Ga0157375_10120725 3300013308 Bacteria 2730
92 Ga0157377_10006705 3300014745 Bacteria 5512
93 Ga0157376_10084554 3300014969 Bacteria 2732
94 Ga0207653_10026587 3300025885 Bacteria 1856
95 Ga0207692_10000004 3300025898 Bacteria 413600
96 Ga0207642_10012019 3300025899 Bacteria 3111
97 Ga0207688_10066656 3300025901 Bacteria 2037
98 Ga0207705_10206270 3300025909 Bacteria 1490
99 Ga0207693_10000036 3300025915 Bacteria 109562
100 Ga0207657_10108910 3300025919 Bacteria 2290
101 Ga0207659_10002850 3300025926 Bacteria 10309
102 Ga0207664_10004746 3300025929 Bacteria 9234
103 Ga0207644_10037271 3300025931 Bacteria 3420
104 Ga0207690_10012329 3300025932 Bacteria 5115
105 Ga0207690_10411166 3300025932 Bacteria 1081
106 Ga0207706_10053748 3300025933 Bacteria 3555
107 Ga0207670_10227663 3300025936 Bacteria 1430
108 Ga0207691_10020786 3300025940 Bacteria 6205
109 Ga0207691_10045675 3300025940 Bacteria 4025
110 Ga0207711_10114953 3300025941 Bacteria 2397
111 Ga0207711_10178087 3300025941 Bacteria 1932
112 Ga0207679_10057422 3300025945 Bacteria 2878
113 Ga0207667_10108889 3300025949 Bacteria 2858
114 Ga0207651_10030180 3300025960 Bacteria 3447
115 Ga0207668_10168544 3300025972 Bacteria 1715
116 Ga0207658_10074612 3300025986 Bacteria 2578
117 Ga0207677_10065540 3300026023 Bacteria 2535
118 Ga0207703_10485887 3300026035 Bacteria 1157
119 Ga0207678_10051242 3300026067 Bacteria 3563
120 Ga0207678_10091793 3300026067 Bacteria 2596
121 Ga0207678_10304103 3300026067 Bacteria 1371
122 Ga0207708_10008393 3300026075 Bacteria 7646
123 Ga0207641_10125218 3300026088 Bacteria 2300
124 Ga0207676_10246714 3300026095 Bacteria 1605
125 Ga0207675_100061581 3300026118 Bacteria 3503
126 Ga0207675_100187384 3300026118 Bacteria 1984
127 Ga0207675_100447948 3300026118 Bacteria 1279
128 Ga0207683_10000093 3300026121 Bacteria 72361
129 Ga0207683_10218735 3300026121 Bacteria 1735
130 Ga0207698_10112683 3300026142 Bacteria 2284
131 Ga0207698_10418471 3300026142 Bacteria 1285
132 Ga0207428_10025667 3300027907 Bacteria 4929
133 Ga0207428_10121959 3300027907 Bacteria 1998
134 Ga0268266_10015915 3300028379 Bacteria 6436
135 Ga0268266_10208713 3300028379 Bacteria 1791
136 Ga0268265_10042358 3300028380 Bacteria 3378
137 Ga0265319_1006815 3300028563 Bacteria 5226
138 Ga0265319_1009731 3300028563 Bacteria 4066
139 Ga0265324_10000032 3300029957 Bacteria 125653
140 Ga0265324_10002228 3300029957 Bacteria 10117
141 Ga0265320_10009538 3300031240 Bacteria 5849
142 Ga0265339_10000157 3300031249 Bacteria 56306
143 Ga0265331_10000151 3300031250 Bacteria 89218
144 Ga0307513_10013771 3300031456 Bacteria 9918
145 Ga0307509_10005031 3300031507 Bacteria 18628
146 Ga0265314_10067848 3300031711 Bacteria 2400
147 Ga0265342_10004759 3300031712 Bacteria 10552
148 Ga0316576_10286891 3300031727 Bacteria 1232
149 Ga0307516_10226613 3300031730 Bacteria 1575
150 Ga0307406_10099521 3300031901 Bacteria 1977
151 Ga0307409_100118949 3300031995 Bacteria 2233
152 Ga0373936_0185092 3300035113 Bacteria 915
153 Ga0373937_0146309 3300036401 Bacteria 2212
154 Ga0395899_0014926 3300037312 Bacteria 5924
155 Ga0395900_0025756 3300037418 Bacteria 6020
156 Ga0395900_0033462 3300037418 Bacteria 5290
157 Ga0395898_0098042 3300037466 Bacteria 2814
158 Ga0395905_0092101 3300037471 Bacteria 2842
159 Ga0395901_0015006 3300038443 Bacteria 7875
160 Ga0395901_0033676 3300038443 Bacteria 5290
161 Ga0400486_05632 3300038742 Unclassified 3258
162 Ga0451577_0048091 3300042876 Bacteria 3812
163 Ga0451577_0279755 3300042876 Bacteria 1512
164 Ga0466972_0114285 3300044658 Bacteria 1275
165 Ga0453683_0077150 3300044673 Bacteria 2087
166 Ga0453684_0007392 3300044712 Bacteria 20236
167 Ga0453684_0009905 3300044712 Bacteria 16452
168 Ga0453684_0010166 3300044712 Bacteria 16149
169 Ga0453684_0011287 3300044712 Bacteria 15027
170 Ga0453684_0316148 3300044712 Bacteria 1770
171 Ga0466970_0008982 3300044765 Bacteria 5041
172 Ga0451576_0287167 3300045051 Bacteria 1720
173 Ga0451576_0352848 3300045051 Bacteria 1540
174 Ga0466967_0106066 3300045976 Bacteria 2575
175 Ga0495582_0065544 3300046473 Bacteria 2007
176 Ga0495659_0183244 3300046664 Bacteria 853
177 Ga0495669_0006314 3300046684 Bacteria 4950
178 Ga0495615_0023907 3300048090 Bacteria 1405
179 Ga0496100_0000258 3300048903 Bacteria 27078
180 Ga0496101_0007940 3300048904 Bacteria 6913
181 Ga0496102_0016875 3300048905 Bacteria 6388
182 Ga0496104_0009704 3300048907 Bacteria 8579
183 Ga0496105_0150600 3300048908 Bacteria 1912
184 Ga0496106_0012409 3300048909 Bacteria 6292
185 Ga0496107_0001632 3300048910 Bacteria 13982
186 Ga0496107_0078261 3300048910 Bacteria 2409
187 Ga0496108_0036307 3300048911 Bacteria 4100
188 Ga0496109_0002782 3300048912 Bacteria 14664
189 Ga0496109_0171000 3300048912 Bacteria 2038
190 Ga0496111_0130972 3300048914 Bacteria 1856
191 Ga0496112_0000543 3300048915 Bacteria 25838
192 Ga0496112_0034314 3300048915 Bacteria 4937
193 Ga0496113_0067768 3300048916 Bacteria 2707
194 Ga0496113_0099206 3300048916 Bacteria 2255
195 Ga0496114_0078206 3300048917 Bacteria 2791
196 Ga0501034_0017850 3300049571 Bacteria 7278
197 Ga0501036_0030558 3300049572 Bacteria 4549
198 Ga0501040_0089788 3300049576 Bacteria 2135
199 Ga0501041_0159531 3300049577 Bacteria 1410
200 Ga0501042_0221682 3300049578 Bacteria 1364
201 Ga0501042_0242448 3300049578 Bacteria 1300
202 Ga0501046_0015087 3300049580 Bacteria 6497
203 Ga0501046_0197277 3300049580 Bacteria 1499
204 Ga0501047_0013278 3300049581 Bacteria 7802
205 Ga0501048_0052408 3300049582 Bacteria 2904
206 Ga0501048_0100196 3300049582 Bacteria 2044
207 Ga0501048_0115787 3300049582 Bacteria 1894
208 Ga0501068_0070820 3300049584 Bacteria 2128
209 Ga0501074_0116077 3300049590 Bacteria 1915
210 Ga0501074_0239343 3300049590 Bacteria 1291
211 Ga0501075_0001059 3300049591 Bacteria 17686
212 Ga0501075_0002560 3300049591 Bacteria 12120
213 Ga0501076_0016387 3300049592 Bacteria 5620
214 Ga0501198_000027 3300049649 Bacteria 65442
215 Ga0501222_000026 3300049662 Bacteria 63988
216 Ga0501079_0012931 3300049741 Bacteria 6369
217 Ga0501045_0024352 3300049824 Bacteria 4346
218 nmdc:mga03n38_63396_c1 3300050490 Bacteria 1689
219 nmdc:mga00v17_12696_c1 3300050491 Bacteria 4652
220 nmdc:mga0yw44_18683_c1 3300050492 Bacteria 3804
221 nmdc:mga05p37_51231_c1 3300050507 Bacteria 5077
222 nmdc:mga09592_10424_c1 3300050508 Bacteria 7563
223 nmdc:mga09592_329590_c1 3300050508 Bacteria 1322
224 nmdc:mga09592_70841_c1 3300050508 Bacteria 2959
225 nmdc:mga0qj67_213323_c1 3300050509 Bacteria 1567
226 nmdc:mga0qj67_334_c1 3300050509 Bacteria 32457
227 nmdc:mga0qj67_55977_c1 3300050509 Bacteria 3126
228 nmdc:mga06r32_53690_c1 3300050510 Bacteria 3861
229 nmdc:mga08y16_23251_c1 3300050511 Bacteria 6544
230 nmdc:mga08y16_3036_c1 3300050511 Bacteria 17333
231 nmdc:mga08y16_5786_c1 3300050511 Bacteria 12950
232 nmdc:mga0n895_85258_c1 3300050512 Bacteria 3153
233 nmdc:mga0a205_142000_c1 3300050515 Bacteria 2301
234 nmdc:mga0a205_96939_c1 3300050515 Bacteria 2848
235 Ga0500644_0058479 3300053088 Bacteria 1349
236 Ga0500583_0128820 3300053092 Bacteria 1255
237 Ga0500652_087680 3300053131 Bacteria 1299
238 Ga0500577_0146961 3300053142 Bacteria 998
239 Ga0501084_0029706 3300054114 Bacteria 4573
240 Ga0501082_0025359 3300060353 Bacteria 5109
241 Ga0501082_0104216 3300060353 Bacteria 2454
242 Ga0530510_0001311 3300061734 Bacteria 16625
243 Ga0530510_0254978 3300061734 Bacteria 1307
244 Ga0070705_100001031
245 JGI24737J22298_10048504
246 Ga0065712_10000634
247 Ga0065707_10008115
248 Ga0070658_10024355
249 Ga0070658_10083699
250 Ga0070683_100057788
251 Ga0070683_100062184
252 Ga0070683_100459671
253 Ga0070683_100501513
254 Ga0068869_100253001
255 Ga0070680_100025974
256 Ga0070680_100154557
257 Ga0070680_100237281
258 Ga0070682_100153015
259 Ga0068868_100020563
260 Ga0070660_100017553
261 Ga0070692_10005007
262 Ga0070668_100279833
263 Ga0070668_100318334
264 Ga0070671_100064284
265 Ga0070673_100000433
266 Ga0070688_100060208
267 Ga0070688_100354244
268 Ga0070659_100009296
269 Ga0070714_100004530
270 Ga0070710_10000001
271 Ga0070700_100015012
272 Ga0070694_100026692
273 Ga0070708_100295980
274 Ga0070663_100124655
275 Ga0070678_100111432
276 Ga0070662_100134525
277 Ga0070684_100067350
278 Ga0070684_100184246
279 Ga0070672_100031453
280 Ga0070672_100112373
281 Ga0070686_100009777
282 Ga0070696_100001870
283 Ga0070696_100069557
284 Ga0070696_100095919
285 Ga0070665_100002179
286 Ga0068855_100158564
287 Ga0070702_100005426
288 Ga0068859_100223206
289 Ga0068864_100051222
290 Ga0068861_100227343
291 Ga0068851_10036416
292 Ga0068870_10042284
293 Ga0068870_10200213
294 Ga0081455_10117644
295 Ga0081538_10000043
296 Ga0081539_10002564
297 Ga0081539_10013823
298 Ga0070717_10000010
299 Ga0075365_10001647
300 Ga0075365_10083715
301 Ga0075365_10173521
302 Ga0075363_100032811
303 Ga0075364_10014089
304 Ga0070712_100000108
305 Ga0097621_100004327
306 Ga0075428_100035333
307 Ga0075428_100188349
308 Ga0075430_100001348
309 Ga0075430_100023930
310 Ga0075430_100033002
311 Ga0075434_100216305
312 Ga0075429_100042782
313 Ga0075429_100101330
314 Ga0068865_100137821
315 Ga0097620_100223226
316 Ga0111539_10001264
317 Ga0111539_10009084
318 Ga0111539_10019932
319 Ga0111539_10249412
320 Ga0105245_10278850
321 Ga0105247_10092983
322 Ga0114129_10001533
323 Ga0114129_10109348
324 Ga0114129_10292298
325 Ga0105243_10041253
326 Ga0105243_10230853
327 Ga0105242_10033086
328 Ga0105248_10003765
329 Ga0105248_10015719
330 Ga0157374_10201119
331 Ga0157378_10005034
332 Ga0157375_10037413
333 Ga0157375_10084856
334 Ga0157375_10120725
335 Ga0157377_10006705
336 Ga0157376_10084554
337 Ga0207653_10026587
338 Ga0207692_10000004
339 Ga0207642_10012019
340 Ga0207688_10066656
341 Ga0207705_10206270
342 Ga0207693_10000036
343 Ga0207657_10108910
344 Ga0207659_10002850
345 Ga0207664_10004746
346 Ga0207644_10037271
347 Ga0207690_10012329
348 Ga0207690_10411166
349 Ga0207706_10053748
350 Ga0207670_10227663
351 Ga0207691_10020786
352 Ga0207691_10045675
353 Ga0207711_10114953
354 Ga0207711_10178087
355 Ga0207679_10057422
356 Ga0207667_10108889
357 Ga0207651_10030180
358 Ga0207668_10168544
359 Ga0207658_10074612
360 Ga0207677_10065540
361 Ga0207703_10485887
362 Ga0207678_10051242
363 Ga0207678_10091793
364 Ga0207678_10304103
365 Ga0207708_10008393
366 Ga0207641_10125218
367 Ga0207676_10246714
368 Ga0207675_100061581
369 Ga0207675_100187384
370 Ga0207675_100447948
371 Ga0207683_10000093
372 Ga0207683_10218735
373 Ga0207698_10112683
374 Ga0207698_10418471
375 Ga0207428_10025667
376 Ga0207428_10121959
377 Ga0268266_10015915
378 Ga0268266_10208713
379 Ga0268265_10042358
380 Ga0265319_1006815
381 Ga0265319_1009731
382 Ga0265324_10000032
383 Ga0265324_10002228
384 Ga0265320_10009538
385 Ga0265339_10000157
386 Ga0265331_10000151
387 Ga0307513_10013771
388 Ga0307509_10005031
389 Ga0265314_10067848
390 Ga0265342_10004759
391 Ga0316576_10286891
392 Ga0307516_10226613
393 Ga0307406_10099521
394 Ga0307409_100118949
395 Ga0373936_0185092
396 Ga0373937_0146309
397 Ga0395899_0014926
398 Ga0395900_0025756
399 Ga0395900_0033462
400 Ga0395898_0098042
401 Ga0395905_0092101
402 Ga0395901_0015006
403 Ga0395901_0033676
404 Ga0400486_05632
405 Ga0451577_0048091
406 Ga0451577_0279755
407 Ga0466972_0114285
408 Ga0453683_0077150
409 Ga0453684_0007392
410 Ga0453684_0009905
411 Ga0453684_0010166
412 Ga0453684_0011287
413 Ga0453684_0316148
414 Ga0466970_0008982
415 Ga0451576_0287167
416 Ga0451576_0352848
417 Ga0466967_0106066
418 Ga0495582_0065544
419 Ga0495659_0183244
420 Ga0495669_0006314
421 Ga0495615_0023907
422 Ga0496100_0000258
423 Ga0496101_0007940
424 Ga0496102_0016875
425 Ga0496104_0009704
426 Ga0496105_0150600
427 Ga0496106_0012409
428 Ga0496107_0001632
429 Ga0496107_0078261
430 Ga0496108_0036307
431 Ga0496109_0002782
432 Ga0496109_0171000
433 Ga0496111_0130972
434 Ga0496112_0000543
435 Ga0496112_0034314
436 Ga0496113_0067768
437 Ga0496113_0099206
438 Ga0496114_0078206
439 Ga0501034_0017850
440 Ga0501036_0030558
441 Ga0501040_0089788
442 Ga0501041_0159531
443 Ga0501042_0221682
444 Ga0501042_0242448
445 Ga0501046_0015087
446 Ga0501046_0197277
447 Ga0501047_0013278
448 Ga0501048_0052408
449 Ga0501048_0100196
450 Ga0501048_0115787
451 Ga0501068_0070820
452 Ga0501074_0116077
453 Ga0501074_0239343
454 Ga0501075_0001059
455 Ga0501075_0002560
456 Ga0501076_0016387
457 Ga0501198_000027
458 Ga0501222_000026
459 Ga0501079_0012931
460 Ga0501045_0024352
461 nmdc:mga03n38_63396_c1
462 nmdc:mga00v17_12696_c1
463 nmdc:mga0yw44_18683_c1
464 nmdc:mga05p37_51231_c1
465 nmdc:mga09592_10424_c1
466 nmdc:mga09592_329590_c1
467 nmdc:mga09592_70841_c1
468 nmdc:mga0qj67_213323_c1
469 nmdc:mga0qj67_334_c1
470 nmdc:mga0qj67_55977_c1
471 nmdc:mga06r32_53690_c1
472 nmdc:mga08y16_23251_c1
473 nmdc:mga08y16_3036_c1
474 nmdc:mga08y16_5786_c1
475 nmdc:mga0n895_85258_c1
476 nmdc:mga0a205_142000_c1
477 nmdc:mga0a205_96939_c1
478 Ga0500644_0058479
479 Ga0500583_0128820
480 Ga0500652_087680
481 Ga0500577_0146961
482 Ga0501084_0029706
483 Ga0501082_0025359
484 Ga0501082_0104216
485 Ga0530510_0001311
486 Ga0530510_0254978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

17

114

0.94

PF02540

NAD_synthase

NAD synthase

148

302

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.8892 12 322
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.8821 12 322
3p52-assembly1.cif.gz_A nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8774 11 319
3p52-assembly1.cif.gz_A nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8738 11 319
3p52-assembly1.cif.gz_B nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8659 12 319
ID Description Score Start End Superfamily
3fiuC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8893 12 322 3.40.50.620
3fiuC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8822 12 322 3.40.50.620
2e18A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8643 12 319 3.40.50.620
af_Q58747_4_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8462 11 321 3.40.50.620
1xnhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8444 17 306 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A160V266-F1-model_v4 deleted 0.9809 18 194
AF-A0A7W0Y782-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9804 46 320 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A1Q3QMU1-F1-model_v4 deleted 0.9804 95 320
AF-A0A514BRK7-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9785 7 322 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
GO:0046872
AF-A0A7V7WZL6-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9783 12 320 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
GO:0046872

Map