F355324

General Info

Members Datasets Scaffolds Average Seq Length
243 164 486 101

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100763719|Ga0068868_1007637191
Length 117
Sequence MTFVELFPKPIVSLTHGGLRMYCNYCGKVIQDDANLRVGGVSARERLVRPRADRKVAGVCAGVSEYFDIDVTLVRIVWLILALVPPTPGLIAYIICWIVMPEEPVEHAVPAAQQVPN

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
65 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
93 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
119 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
149 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
150 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
155 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
158 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.65
Metatranscriptomes 5.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.7
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 51.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100763719 3300005338 Unclassified 869
2 LJNas_1000050 3300000546 Bacteria 16152
3 rootH1_10375813 3300003323 Unclassified 1604
4 Ga0068869_100025474 3300005334 Bacteria 4108
5 Ga0070689_100944092 3300005340 Unclassified 765
6 Ga0070675_101079902 3300005354 Unclassified 738
7 Ga0070709_10100729 3300005434 Unclassified 1924
8 Ga0070709_10417489 3300005434 Bacteria 1005
9 Ga0070714_101163310 3300005435 Unclassified 752
10 Ga0070713_100027026 3300005436 Unclassified 4513
11 Ga0070713_100210857 3300005436 Unclassified 1758
12 Ga0070713_101056470 3300005436 Bacteria 784
13 Ga0070713_101392483 3300005436 Unclassified 680
14 Ga0070710_10012648 3300005437 Unclassified 4198
15 Ga0070710_10325882 3300005437 Bacteria 1010
16 Ga0070711_100018445 3300005439 Bacteria 4456
17 Ga0070711_101662494 3300005439 Unclassified 559
18 Ga0070708_100000585 3300005445 Bacteria 27348
19 Ga0070708_100016587 3300005445 Bacteria 6116
20 Ga0070708_100603184 3300005445 Unclassified 1035
21 Ga0070678_100730296 3300005456 Unclassified 894
22 Ga0068867_100021005 3300005459 Unclassified 4657
23 Ga0070706_100010376 3300005467 Bacteria 8652
24 Ga0070706_100299342 3300005467 Unclassified 1501
25 Ga0070706_100457210 3300005467 Unclassified 1188
26 Ga0070706_100663585 3300005467 Unclassified 968
27 Ga0070707_100001161 3300005468 Bacteria 25912
28 Ga0070707_100069560 3300005468 Bacteria 3389
29 Ga0070707_100692119 3300005468 Unclassified 982
30 Ga0070698_100007480 3300005471 Bacteria 11820
31 Ga0070698_100829927 3300005471 Unclassified 869
32 Ga0070699_100000032 3300005518 Bacteria 136937
33 Ga0070679_101184162 3300005530 Unclassified 709
34 Ga0070697_100000056 3300005536 Bacteria 86619
35 Ga0070697_100000206 3300005536 Bacteria 48570
36 Ga0070697_100008641 3300005536 Bacteria 7954
37 Ga0070697_101251242 3300005536 Unclassified 662
38 Ga0068853_101762020 3300005539 Bacteria 600
39 Ga0070693_100366178 3300005547 Bacteria 990
40 Ga0070665_100314780 3300005548 Unclassified 1569
41 Ga0070664_100714749 3300005564 Unclassified 934
42 Ga0068856_100726436 3300005614 Unclassified 1013
43 Ga0068852_101425831 3300005616 Unclassified 715
44 Ga0068859_100009937 3300005617 Bacteria 9601
45 Ga0068863_100471958 3300005841 Unclassified 1233
46 Ga0068863_100871632 3300005841 Unclassified 900
47 Ga0068858_100003384 3300005842 Bacteria 15871
48 Ga0068858_101631212 3300005842 Bacteria 637
49 Ga0068862_100052444 3300005844 Bacteria 3490
50 Ga0081455_10532194 3300005937 Bacteria 781
51 Ga0081540_1121425 3300005983 Unclassified 1083
52 Ga0070717_10032694 3300006028 Unclassified 4194
53 Ga0070717_10038624 3300006028 Bacteria 3881
54 Ga0070717_10153342 3300006028 Unclassified 1995
55 Ga0070717_10489362 3300006028 Bacteria 1111
56 Ga0070717_10623795 3300006028 Unclassified 978
57 Ga0070715_10309089 3300006163 Unclassified 849
58 Ga0070716_100000191 3300006173 Bacteria 24141
59 Ga0070716_100113139 3300006173 Unclassified 1686
60 Ga0070712_100002647 3300006175 Bacteria 11047
61 Ga0070712_100067835 3300006175 Unclassified 2539
62 Ga0075434_100002735 3300006871 Bacteria 15579
63 Ga0068865_100043596 3300006881 Unclassified 3067
64 Ga0097620_100009937 3300006931 Bacteria 9601
65 Ga0075435_100424467 3300007076 Unclassified 1145
66 Ga0099795_10151382 3300007788 Unclassified 950
67 Ga0099795_10471172 3300007788 Unclassified 581
68 Ga0105251_10618554 3300009011 Unclassified 515
69 Ga0105240_11577542 3300009093 Unclassified 687
70 Ga0105245_10046885 3300009098 Bacteria 3862
71 Ga0105247_10637352 3300009101 Unclassified 795
72 Ga0105247_11682173 3300009101 Unclassified 524
73 Ga0105243_11284842 3300009148 Unclassified 748
74 Ga0105242_12211228 3300009176 Unclassified 595
75 Ga0105248_10137214 3300009177 Bacteria 2759
76 Ga0105237_10070131 3300009545 Unclassified 3500
77 Ga0105238_10764356 3300009551 Bacteria 981
78 Ga0105249_12672978 3300009553 Unclassified 571
79 Ga0099796_10070339 3300010159 Unclassified 1262
80 Ga0099796_10440443 3300010159 Bacteria 578
81 Ga0105239_10045908 3300010375 Bacteria 4788
82 Ga0157374_10002547 3300013296 Bacteria 15373
83 Ga0157374_10102528 3300013296 Bacteria 2745
84 Ga0157374_11235506 3300013296 Bacteria 769
85 Ga0157378_10472024 3300013297 Unclassified 1249
86 Ga0163162_10177091 3300013306 Unclassified 2258
87 Ga0157372_10544221 3300013307 Unclassified 1353
88 Ga0157375_10048134 3300013308 Bacteria 4168
89 Ga0157375_10597358 3300013308 Bacteria 1263
90 Ga0163163_10166834 3300014325 Bacteria 2248
91 Ga0157377_10097234 3300014745 Bacteria 1748
92 Ga0157379_10198436 3300014968 Bacteria 1814
93 Ga0157376_10004594 3300014969 Bacteria 9614
94 Ga0157376_10430674 3300014969 Unclassified 1282
95 Ga0157376_10456205 3300014969 Unclassified 1248
96 Ga0213875_10071743 3300021388 Bacteria 1617
97 Ga0224570_101809 3300022730 Unclassified 1512
98 Ga0224570_115116 3300022730 Bacteria 507
99 Ga0224572_1010240 3300024225 Bacteria 1759
100 Ga0224572_1035161 3300024225 Bacteria 951
101 Ga0224572_1103492 3300024225 Unclassified 526
102 Ga0228598_1003264 3300024227 Unclassified 3498
103 Ga0228598_1006933 3300024227 Archaea 2326
104 Ga0228598_1034863 3300024227 Unclassified 992
105 Ga0228598_1038148 3300024227 Unclassified 947
106 Ga0207692_10080236 3300025898 Unclassified 1743
107 Ga0207692_10203438 3300025898 Unclassified 1165
108 Ga0207710_10305540 3300025900 Unclassified 804
109 Ga0207688_10132629 3300025901 Unclassified 1461
110 Ga0207647_10003342 3300025904 Bacteria 12036
111 Ga0207684_10000132 3300025910 Bacteria 134931
112 Ga0207684_10443613 3300025910 Unclassified 1114
113 Ga0207684_10669422 3300025910 Unclassified 883
114 Ga0207671_10535337 3300025914 Unclassified 934
115 Ga0207671_11164330 3300025914 Unclassified 604
116 Ga0207693_10004671 3300025915 Bacteria 11541
117 Ga0207693_10071747 3300025915 Unclassified 2711
118 Ga0207663_10008480 3300025916 Bacteria 5376
119 Ga0207663_10791010 3300025916 Bacteria 755
120 Ga0207663_11173543 3300025916 Unclassified 618
121 Ga0207646_10000301 3300025922 Bacteria 67088
122 Ga0207646_10098290 3300025922 Bacteria 2623
123 Ga0207694_10848476 3300025924 Unclassified 772
124 Ga0207687_10026818 3300025927 Bacteria 3860
125 Ga0207700_10901809 3300025928 Bacteria 791
126 Ga0207700_10904897 3300025928 Bacteria 790
127 Ga0207664_11224836 3300025929 Bacteria 669
128 Ga0207706_10071888 3300025933 Bacteria 3043
129 Ga0207704_10071909 3300025938 Bacteria 2197
130 Ga0207665_10003286 3300025939 Bacteria 10834
131 Ga0207665_10127798 3300025939 Unclassified 1801
132 Ga0207711_10407226 3300025941 Unclassified 1264
133 Ga0207711_10689776 3300025941 Bacteria 952
134 Ga0207689_10001588 3300025942 Bacteria 21537
135 Ga0207677_10320338 3300026023 Bacteria 1288
136 Ga0207703_10047505 3300026035 Bacteria 3461
137 Ga0207703_11019164 3300026035 Bacteria 794
138 Ga0207641_10514077 3300026088 Bacteria 1164
139 Ga0207648_10017687 3300026089 Bacteria 6476
140 Ga0207675_100155592 3300026118 Bacteria 2178
141 Ga0207698_12322105 3300026142 Unclassified 548
142 Ga0209971_1166833 3300027682 Unclassified 543
143 Ga0265356_1003126 3300028017 Bacteria 2117
144 Ga0265357_1048613 3300028023 Unclassified 505
145 Ga0268266_10709350 3300028379 Unclassified 970
146 Ga0268265_10169491 3300028380 Unclassified 1864
147 Ga0268264_10094572 3300028381 Bacteria 2584
148 Ga0265338_10108144 3300028800 Bacteria 2247
149 Ga0265762_1000232 3300030760 Bacteria 9037
150 Ga0265762_1001226 3300030760 Bacteria 4655
151 Ga0265762_1017326 3300030760 Bacteria 1310
152 Ga0265770_1029807 3300030878 Unclassified 908
153 Ga0265765_1007001 3300030879 Unclassified 1210
154 Ga0265760_10000400 3300031090 Bacteria 12177
155 Ga0265760_10004165 3300031090 Unclassified 4166
156 Ga0265760_10005985 3300031090 Unclassified 3475
157 Ga0265760_10023705 3300031090 Bacteria 1784
158 Ga0265760_10098091 3300031090 Bacteria 924
159 Ga0265760_10272218 3300031090 Unclassified 593
160 Ga0265329_10286158 3300031242 Unclassified 555
161 Ga0265339_10472885 3300031249 Bacteria 580
162 Ga0265316_10061460 3300031344 Bacteria 2918
163 Ga0307408_100027873 3300031548 Unclassified 3897
164 Ga0265342_10024347 3300031712 Bacteria 3823
165 Ga0307405_10128806 3300031731 Bacteria 1745
166 Ga0307413_10226736 3300031824 Unclassified 1369
167 Ga0307410_10072193 3300031852 Unclassified 2396
168 Ga0307410_10128391 3300031852 Unclassified 1859
169 Ga0307406_10025216 3300031901 Unclassified 3558
170 Ga0307406_10243202 3300031901 Unclassified 1351
171 Ga0307407_10836700 3300031903 Bacteria 702
172 Ga0307407_10865718 3300031903 Unclassified 691
173 Ga0307412_10101109 3300031911 Unclassified 2039
174 Ga0307412_10262767 3300031911 Unclassified 1347
175 Ga0307409_100143224 3300031995 Bacteria 2063
176 Ga0307416_100680761 3300032002 Unclassified 1116
177 Ga0307416_101224551 3300032002 Unclassified 856
178 Ga0307414_10569872 3300032004 Bacteria 1012
179 Ga0307414_11526065 3300032004 Bacteria 622
180 Ga0307411_10019725 3300032005 Unclassified 3902
181 Ga0307411_11153378 3300032005 Unclassified 701
182 Ga0307415_100002209 3300032126 Bacteria 9637
183 Ga0307415_100441494 3300032126 Unclassified 1122
184 Ga0316214_1030603 3300033545 Bacteria 764
185 Ga0316212_1017956 3300033547 Bacteria 995
186 Ga0373926_0127625 3300035083 Bacteria 962
187 Ga0373931_0028864 3300035691 Bacteria 2844
188 Ga0373935_0969928 3300035692 Bacteria 631
189 Ga0373927_0692546 3300035695 Unclassified 673
190 Ga0373933_0869047 3300035724 Bacteria 594
191 Ga0395905_0012653 3300037471 Bacteria 8118
192 Ga0395905_0458083 3300037471 Bacteria 1174
193 Ga0436364_0983460 3300037853 Bacteria 1669
194 Ga0395901_0980702 3300038443 Unclassified 822
195 Ga0395901_1171360 3300038443 Bacteria 736
196 Ga0436360_0745534 3300039438 Bacteria 1102
197 Ga0436363_1544636 3300039450 Unclassified 726
198 Ga0451577_0000325 3300042876 Bacteria 89199
199 Ga0451577_1255910 3300042876 Unclassified 660
200 Ga0453683_0260119 3300044673 Bacteria 1107
201 Ga0453683_0398972 3300044673 Bacteria 886
202 Ga0466963_0751879 3300044694 Unclassified 688
203 Ga0453684_0000545 3300044712 Bacteria 142482
204 Ga0453684_1432004 3300044712 Unclassified 715
205 Ga0466959_0246105 3300045049 Unclassified 1234
206 Ga0451576_0011947 3300045051 Bacteria 9812
207 Ga0451576_0123374 3300045051 Bacteria 2698
208 Ga0451576_0298573 3300045051 Unclassified 1684
209 Ga0451576_1271699 3300045051 Unclassified 767
210 Ga0466958_1050663 3300045836 Unclassified 532
211 Ga0466967_0004648 3300045976 Bacteria 9313
212 Ga0495580_0009465 3300046472 Bacteria 7664
213 Ga0495580_0081054 3300046472 Unclassified 2262
214 Ga0495580_0164397 3300046472 Unclassified 1535
215 Ga0495664_0661434 3300046477 Bacteria 619
216 Ga0495584_0254006 3300046491 Unclassified 894
217 Ga0495594_0213240 3300046499 Unclassified 1101
218 Ga0496101_0512189 3300048904 Unclassified 948
219 Ga0496104_0902094 3300048907 Unclassified 789
220 Ga0496104_1490717 3300048907 Unclassified 579
221 Ga0496108_0730991 3300048911 Unclassified 857
222 Ga0496108_0924020 3300048911 Unclassified 748
223 Ga0496111_0541334 3300048914 Unclassified 855
224 Ga0496112_0057545 3300048915 Bacteria 3827
225 Ga0496112_0126416 3300048915 Unclassified 2527
226 Ga0496114_0333861 3300048917 Unclassified 1340
227 Ga0501292_080566 3300049515 Unclassified 619
228 Ga0501297_056125 3300049520 Unclassified 591
229 Ga0501298_099338 3300049521 Bacteria 662
230 Ga0501067_0185461 3300049583 Bacteria 1158
231 Ga0501073_0018105 3300049589 Bacteria 5094
232 Ga0501077_0232613 3300049593 Bacteria 1171
233 Ga0501250_075145 3300049680 Bacteria 565
234 Ga0501221_134955 3300049704 Bacteria 642
235 Ga0501083_0204441 3300049744 Bacteria 1288
236 Ga0501265_113847 3300049762 Unclassified 508
237 Ga0501278_028150 3300049774 Unclassified 557
238 nmdc:mga0n895_8642_c1 3300050512 Bacteria 8839
239 nmdc:mga0rr50_938105_c1 3300050513 Unclassified 738
240 nmdc:mga0a205_14631_c1 3300050515 Bacteria 7322
241 Ga0501084_0058173 3300054114 Unclassified 3235
242 Ga0587094_086493 3300059513 Unclassified 587
243 Ga0587106_134612 3300059605 Unclassified 536
244 Ga0068868_100763719
245 LJNas_1000050
246 rootH1_10375813
247 Ga0068869_100025474
248 Ga0070689_100944092
249 Ga0070675_101079902
250 Ga0070709_10100729
251 Ga0070709_10417489
252 Ga0070714_101163310
253 Ga0070713_100027026
254 Ga0070713_100210857
255 Ga0070713_101056470
256 Ga0070713_101392483
257 Ga0070710_10012648
258 Ga0070710_10325882
259 Ga0070711_100018445
260 Ga0070711_101662494
261 Ga0070708_100000585
262 Ga0070708_100016587
263 Ga0070708_100603184
264 Ga0070678_100730296
265 Ga0068867_100021005
266 Ga0070706_100010376
267 Ga0070706_100299342
268 Ga0070706_100457210
269 Ga0070706_100663585
270 Ga0070707_100001161
271 Ga0070707_100069560
272 Ga0070707_100692119
273 Ga0070698_100007480
274 Ga0070698_100829927
275 Ga0070699_100000032
276 Ga0070679_101184162
277 Ga0070697_100000056
278 Ga0070697_100000206
279 Ga0070697_100008641
280 Ga0070697_101251242
281 Ga0068853_101762020
282 Ga0070693_100366178
283 Ga0070665_100314780
284 Ga0070664_100714749
285 Ga0068856_100726436
286 Ga0068852_101425831
287 Ga0068859_100009937
288 Ga0068863_100471958
289 Ga0068863_100871632
290 Ga0068858_100003384
291 Ga0068858_101631212
292 Ga0068862_100052444
293 Ga0081455_10532194
294 Ga0081540_1121425
295 Ga0070717_10032694
296 Ga0070717_10038624
297 Ga0070717_10153342
298 Ga0070717_10489362
299 Ga0070717_10623795
300 Ga0070715_10309089
301 Ga0070716_100000191
302 Ga0070716_100113139
303 Ga0070712_100002647
304 Ga0070712_100067835
305 Ga0075434_100002735
306 Ga0068865_100043596
307 Ga0097620_100009937
308 Ga0075435_100424467
309 Ga0099795_10151382
310 Ga0099795_10471172
311 Ga0105251_10618554
312 Ga0105240_11577542
313 Ga0105245_10046885
314 Ga0105247_10637352
315 Ga0105247_11682173
316 Ga0105243_11284842
317 Ga0105242_12211228
318 Ga0105248_10137214
319 Ga0105237_10070131
320 Ga0105238_10764356
321 Ga0105249_12672978
322 Ga0099796_10070339
323 Ga0099796_10440443
324 Ga0105239_10045908
325 Ga0157374_10002547
326 Ga0157374_10102528
327 Ga0157374_11235506
328 Ga0157378_10472024
329 Ga0163162_10177091
330 Ga0157372_10544221
331 Ga0157375_10048134
332 Ga0157375_10597358
333 Ga0163163_10166834
334 Ga0157377_10097234
335 Ga0157379_10198436
336 Ga0157376_10004594
337 Ga0157376_10430674
338 Ga0157376_10456205
339 Ga0213875_10071743
340 Ga0224570_101809
341 Ga0224570_115116
342 Ga0224572_1010240
343 Ga0224572_1035161
344 Ga0224572_1103492
345 Ga0228598_1003264
346 Ga0228598_1006933
347 Ga0228598_1034863
348 Ga0228598_1038148
349 Ga0207692_10080236
350 Ga0207692_10203438
351 Ga0207710_10305540
352 Ga0207688_10132629
353 Ga0207647_10003342
354 Ga0207684_10000132
355 Ga0207684_10443613
356 Ga0207684_10669422
357 Ga0207671_10535337
358 Ga0207671_11164330
359 Ga0207693_10004671
360 Ga0207693_10071747
361 Ga0207663_10008480
362 Ga0207663_10791010
363 Ga0207663_11173543
364 Ga0207646_10000301
365 Ga0207646_10098290
366 Ga0207694_10848476
367 Ga0207687_10026818
368 Ga0207700_10901809
369 Ga0207700_10904897
370 Ga0207664_11224836
371 Ga0207706_10071888
372 Ga0207704_10071909
373 Ga0207665_10003286
374 Ga0207665_10127798
375 Ga0207711_10407226
376 Ga0207711_10689776
377 Ga0207689_10001588
378 Ga0207677_10320338
379 Ga0207703_10047505
380 Ga0207703_11019164
381 Ga0207641_10514077
382 Ga0207648_10017687
383 Ga0207675_100155592
384 Ga0207698_12322105
385 Ga0209971_1166833
386 Ga0265356_1003126
387 Ga0265357_1048613
388 Ga0268266_10709350
389 Ga0268265_10169491
390 Ga0268264_10094572
391 Ga0265338_10108144
392 Ga0265762_1000232
393 Ga0265762_1001226
394 Ga0265762_1017326
395 Ga0265770_1029807
396 Ga0265765_1007001
397 Ga0265760_10000400
398 Ga0265760_10004165
399 Ga0265760_10005985
400 Ga0265760_10023705
401 Ga0265760_10098091
402 Ga0265760_10272218
403 Ga0265329_10286158
404 Ga0265339_10472885
405 Ga0265316_10061460
406 Ga0307408_100027873
407 Ga0265342_10024347
408 Ga0307405_10128806
409 Ga0307413_10226736
410 Ga0307410_10072193
411 Ga0307410_10128391
412 Ga0307406_10025216
413 Ga0307406_10243202
414 Ga0307407_10836700
415 Ga0307407_10865718
416 Ga0307412_10101109
417 Ga0307412_10262767
418 Ga0307409_100143224
419 Ga0307416_100680761
420 Ga0307416_101224551
421 Ga0307414_10569872
422 Ga0307414_11526065
423 Ga0307411_10019725
424 Ga0307411_11153378
425 Ga0307415_100002209
426 Ga0307415_100441494
427 Ga0316214_1030603
428 Ga0316212_1017956
429 Ga0373926_0127625
430 Ga0373931_0028864
431 Ga0373935_0969928
432 Ga0373927_0692546
433 Ga0373933_0869047
434 Ga0395905_0012653
435 Ga0395905_0458083
436 Ga0436364_0983460
437 Ga0395901_0980702
438 Ga0395901_1171360
439 Ga0436360_0745534
440 Ga0436363_1544636
441 Ga0451577_0000325
442 Ga0451577_1255910
443 Ga0453683_0260119
444 Ga0453683_0398972
445 Ga0466963_0751879
446 Ga0453684_0000545
447 Ga0453684_1432004
448 Ga0466959_0246105
449 Ga0451576_0011947
450 Ga0451576_0123374
451 Ga0451576_0298573
452 Ga0451576_1271699
453 Ga0466958_1050663
454 Ga0466967_0004648
455 Ga0495580_0009465
456 Ga0495580_0081054
457 Ga0495580_0164397
458 Ga0495664_0661434
459 Ga0495584_0254006
460 Ga0495594_0213240
461 Ga0496101_0512189
462 Ga0496104_0902094
463 Ga0496104_1490717
464 Ga0496108_0730991
465 Ga0496108_0924020
466 Ga0496111_0541334
467 Ga0496112_0057545
468 Ga0496112_0126416
469 Ga0496114_0333861
470 Ga0501292_080566
471 Ga0501297_056125
472 Ga0501298_099338
473 Ga0501067_0185461
474 Ga0501073_0018105
475 Ga0501077_0232613
476 Ga0501250_075145
477 Ga0501221_134955
478 Ga0501083_0204441
479 Ga0501265_113847
480 Ga0501278_028150
481 nmdc:mga0n895_8642_c1
482 nmdc:mga0rr50_938105_c1
483 nmdc:mga0a205_14631_c1
484 Ga0501084_0058173
485 Ga0587094_086493
486 Ga0587106_134612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04024

PspC

PspC domain

45

103

0.98

Map