F355047

General Info

Members Datasets Scaffolds Average Seq Length
242 184 484 120

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0109870|Ga0501034_0109870_25_447
Length 140
Sequence MPDAGALSVAAGRLGGMTPDELRAACLDLNGTAETFPFNPETSVFKVQGKVFALSALDARPLRVSLKCDPEIAVRLRAEHAAVAPGWHLNKRHWNTVTLDGSLPDRLVLDMVEDSYDLVVAGMPRRTRLLLDWPVGRYRA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
175 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
176 2643221647 Streptomyces sp. Root369 Isolate Unclassified
177 2867369537 Streptomyces sp. Z26 Isolate Unclassified
178 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
179 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
180 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
181 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
182 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
183 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
184 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.04
Metatranscriptomes 0.41
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 0.41
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0109870 3300049571 Bacteria 2748
2 rootH1_10006346 3300003316 Bacteria 8065
3 JGI25407J50210_10107971 3300003373 Bacteria 687
4 Ga0006562J51391_1033315 3300003578 Bacteria 1040
5 Ga0070674_101063139 3300005356 Bacteria 713
6 Ga0070667_100000841 3300005367 Bacteria 28447
7 Ga0070709_10001032 3300005434 Bacteria 15412
8 Ga0070709_10084926 3300005434 Bacteria 2075
9 Ga0070714_100013805 3300005435 Bacteria 6477
10 Ga0070714_100084550 3300005435 Bacteria 2769
11 Ga0070714_100303164 3300005435 Bacteria 1490
12 Ga0070713_100036245 3300005436 Bacteria 3979
13 Ga0070713_100043069 3300005436 Bacteria 3688
14 Ga0070710_10024383 3300005437 Bacteria 3190
15 Ga0070711_100001505 3300005439 Bacteria 12817
16 Ga0070711_100073376 3300005439 Bacteria 2417
17 Ga0070708_100021688 3300005445 Bacteria 5437
18 Ga0070708_100469307 3300005445 Bacteria 1187
19 Ga0070678_101043049 3300005456 Bacteria 753
20 Ga0068867_100494684 3300005459 Bacteria 1050
21 Ga0070706_100004578 3300005467 Bacteria 13279
22 Ga0070706_100020634 3300005467 Bacteria 6071
23 Ga0070706_100628965 3300005467 Bacteria 997
24 Ga0070707_100000225 3300005468 Bacteria 56340
25 Ga0070698_100007677 3300005471 Bacteria 11665
26 Ga0070698_100020116 3300005471 Bacteria 6997
27 Ga0070699_100109485 3300005518 Bacteria 2424
28 Ga0070665_100000490 3300005548 Bacteria 56603
29 Ga0070665_100448463 3300005548 Bacteria 1300
30 Ga0068859_101699652 3300005617 Bacteria 697
31 Ga0068863_100197876 3300005841 Bacteria 1932
32 Ga0068858_100001746 3300005842 Bacteria 22173
33 Ga0068858_100063319 3300005842 Bacteria 3422
34 Ga0068862_100001402 3300005844 Bacteria 22338
35 Ga0081455_10026136 3300005937 Bacteria 5377
36 Ga0081455_10059270 3300005937 Bacteria 3233
37 Ga0081538_10002711 3300005981 Bacteria 17020
38 Ga0081538_10053343 3300005981 Bacteria 2404
39 Ga0081538_10070501 3300005981 Bacteria 1929
40 Ga0081540_1001031 3300005983 Bacteria 24972
41 Ga0070717_10004830 3300006028 Bacteria 9809
42 Ga0070717_10049388 3300006028 Bacteria 3453
43 Ga0070717_10056895 3300006028 Bacteria 3232
44 Ga0070717_10240050 3300006028 Bacteria 1598
45 Ga0070715_10735496 3300006163 Bacteria 593
46 Ga0070716_100003321 3300006173 Bacteria 7565
47 Ga0070716_100367843 3300006173 Bacteria 1023
48 Ga0070712_100071307 3300006175 Bacteria 2485
49 Ga0070712_100232356 3300006175 Bacteria 1465
50 Ga0070712_100323965 3300006175 Bacteria 1254
51 Ga0070712_100846248 3300006175 Bacteria 787
52 Ga0070712_100859238 3300006175 Bacteria 781
53 Ga0070712_101522633 3300006175 Bacteria 585
54 Ga0075367_10043309 3300006178 Bacteria 2636
55 Ga0075428_100605795 3300006844 Bacteria 1170
56 Ga0075431_100105375 3300006847 Bacteria 2910
57 Ga0075433_10015472 3300006852 Bacteria 6259
58 Ga0075434_100094818 3300006871 Bacteria 2989
59 Ga0075436_100027791 3300006914 Bacteria 3894
60 Ga0075436_100571006 3300006914 Bacteria 832
61 Ga0097620_101699424 3300006931 Bacteria 697
62 Ga0075435_100062856 3300007076 Bacteria 3014
63 Ga0075435_100473899 3300007076 Bacteria 1081
64 Ga0111539_11230094 3300009094 Bacteria 870
65 Ga0105245_10035779 3300009098 Bacteria 4408
66 Ga0105247_10439695 3300009101 Bacteria 938
67 Ga0105238_10657465 3300009551 Bacteria 1058
68 Ga0105249_10009964 3300009553 Bacteria 8334
69 Ga0105239_11748895 3300010375 Bacteria 720
70 Ga0105239_11962351 3300010375 Bacteria 679
71 Ga0105239_12414018 3300010375 Bacteria 612
72 Ga0157375_12989064 3300013308 Bacteria 565
73 Ga0157379_10042173 3300014968 Bacteria 4074
74 Ga0183367_1009 3300015688 Bacteria 484598
75 Ga0213875_10264822 3300021388 Bacteria 811
76 Ga0207692_10039854 3300025898 Bacteria 2314
77 Ga0207647_10036769 3300025904 Bacteria 3109
78 Ga0207685_10670028 3300025905 Bacteria 562
79 Ga0207699_10038748 3300025906 Bacteria 2734
80 Ga0207684_10001589 3300025910 Bacteria 24160
81 Ga0207684_10022631 3300025910 Bacteria 5364
82 Ga0207684_10272455 3300025910 Bacteria 1460
83 Ga0207693_10007755 3300025915 Bacteria 8808
84 Ga0207693_10192921 3300025915 Bacteria 1603
85 Ga0207693_10445998 3300025915 Bacteria 1011
86 Ga0207693_10913119 3300025915 Bacteria 673
87 Ga0207663_10054887 3300025916 Bacteria 2497
88 Ga0207663_10365686 3300025916 Bacteria 1095
89 Ga0207646_10001144 3300025922 Bacteria 33793
90 Ga0207687_10048439 3300025927 Bacteria 2951
91 Ga0207700_10045667 3300025928 Bacteria 3234
92 Ga0207700_11427189 3300025928 Bacteria 615
93 Ga0207664_10001889 3300025929 Bacteria 13765
94 Ga0207664_10055433 3300025929 Bacteria 3145
95 Ga0207664_10100704 3300025929 Bacteria 2386
96 Ga0207664_10289379 3300025929 Bacteria 1439
97 Ga0207665_10017489 3300025939 Bacteria 4712
98 Ga0207665_10245061 3300025939 Bacteria 1322
99 Ga0207712_10002744 3300025961 Bacteria 11259
100 Ga0207668_10337325 3300025972 Bacteria 1256
101 Ga0207658_10007264 3300025986 Bacteria 7553
102 Ga0207703_10000597 3300026035 Bacteria 36654
103 Ga0207703_10102804 3300026035 Bacteria 2425
104 Ga0268266_10000076 3300028379 Bacteria 217644
105 Ga0268265_10033193 3300028380 Bacteria 3750
106 Ga0307509_10356409 3300031507 Bacteria 1184
107 Ga0307514_10394277 3300031649 Bacteria 711
108 Ga0307405_10211431 3300031731 Bacteria 1416
109 Ga0307413_10225293 3300031824 Bacteria 1372
110 Ga0307410_10302639 3300031852 Bacteria 1262
111 Ga0307407_10077160 3300031903 Bacteria 2003
112 Ga0307412_10239752 3300031911 Bacteria 1402
113 Ga0307409_100778813 3300031995 Bacteria 962
114 Ga0307416_100285400 3300032002 Bacteria 1630
115 Ga0307416_101242890 3300032002 Bacteria 850
116 Ga0307414_10406434 3300032004 Bacteria 1184
117 Ga0307411_10361675 3300032005 Bacteria 1187
118 Ga0307415_100144174 3300032126 Bacteria 1823
119 Ga0307415_100222785 3300032126 Bacteria 1513
120 Ga0373923_0003896 3300035111 Bacteria 4866
121 Ga0373936_0024924 3300035113 Bacteria 2337
122 Ga0373953_0023806 3300035117 Bacteria 2321
123 Ga0373954_0060336 3300035118 Bacteria 1788
124 Ga0373956_0024521 3300035119 Bacteria 2599
125 Ga0373957_0393531 3300035120 Bacteria 595
126 Ga0373946_0054802 3300035171 Bacteria 1679
127 Ga0373955_0037933 3300035172 Bacteria 2564
128 Ga0373924_0004952 3300035410 Bacteria 4689
129 Ga0373935_0023979 3300035692 Bacteria 3750
130 Ga0373935_0526238 3300035692 Bacteria 860
131 Ga0373933_0165725 3300035724 Bacteria 1404
132 Ga0373947_0592790 3300035725 Bacteria 755
133 Ga0373937_0078468 3300036401 Bacteria 3051
134 Ga0373925_0550901 3300037068 Bacteria 948
135 Ga0395898_0010348 3300037466 Bacteria 9756
136 Ga0436364_0437928 3300037853 Bacteria 15552
137 Ga0395901_1312870 3300038443 Bacteria 685
138 Ga0436365_1401137 3300039437 Bacteria 722
139 Ga0451847_0303608 3300041503 Bacteria 750
140 Ga0451853_2019826 3300041512 Bacteria 878
141 Ga0439448_0103731 3300042005 Bacteria 968
142 Ga0439444_0036042 3300042437 Bacteria 952
143 Ga0466969_0034546 3300044656 Bacteria 2561
144 Ga0466969_0039751 3300044656 Bacteria 2360
145 Ga0466969_0518741 3300044656 Bacteria 544
146 Ga0466966_0008660 3300044684 Bacteria 6734
147 Ga0466966_0074681 3300044684 Bacteria 2118
148 Ga0466961_0028934 3300044693 Bacteria 3562
149 Ga0466963_0234738 3300044694 Bacteria 1286
150 Ga0466963_1200443 3300044694 Bacteria 533
151 Ga0453684_0070058 3300044712 Bacteria 4443
152 Ga0466971_0075628 3300044719 Bacteria 1531
153 Ga0466971_0122011 3300044719 Bacteria 1207
154 Ga0466971_0711178 3300044719 Bacteria 505
155 Ga0466968_0302027 3300044735 Bacteria 770
156 Ga0466968_0499059 3300044735 Bacteria 606
157 Ga0466970_0135817 3300044765 Bacteria 1353
158 Ga0466970_0380357 3300044765 Bacteria 804
159 Ga0466957_0229279 3300044842 Bacteria 1229
160 Ga0466960_0049906 3300044901 Bacteria 2016
161 Ga0466959_0036585 3300045049 Bacteria 3627
162 Ga0466959_0112238 3300045049 Bacteria 1944
163 Ga0466959_0168280 3300045049 Bacteria 1538
164 Ga0451576_0011510 3300045051 Bacteria 10044
165 Ga0466967_0013461 3300045976 Bacteria 6322
166 Ga0466967_2089787 3300045976 Bacteria 563
167 Ga0495592_0223783 3300046454 Bacteria 1256
168 Ga0495629_0056448 3300046459 Bacteria 2745
169 Ga0495651_0090681 3300046462 Bacteria 2292
170 Ga0495653_0081308 3300046463 Bacteria 2394
171 Ga0495662_0060110 3300046476 Bacteria 1835
172 Ga0495664_0049422 3300046477 Bacteria 2496
173 Ga0495608_0089145 3300046511 Bacteria 1996
174 Ga0495618_0016176 3300046514 Bacteria 4559
175 Ga0495628_0124720 3300046516 Bacteria 1973
176 Ga0495652_0128304 3300046529 Bacteria 2011
177 Ga0495665_0029466 3300046531 Bacteria 2940
178 Ga0495587_0102747 3300046536 Bacteria 1645
179 Ga0495645_0077923 3300046543 Bacteria 2382
180 Ga0495667_0177535 3300046559 Bacteria 1367
181 Ga0495656_0096564 3300046615 Bacteria 1360
182 Ga0495656_0642875 3300046615 Bacteria 569
183 Ga0495668_0096051 3300046616 Bacteria 1622
184 Ga0495634_0016456 3300046642 Bacteria 5290
185 Ga0495657_0136398 3300046675 Bacteria 1532
186 Ga0495599_0003905 3300046678 Bacteria 8772
187 Ga0495623_0068442 3300046679 Bacteria 2214
188 Ga0495646_0019493 3300046680 Bacteria 4293
189 Ga0495658_0043481 3300046683 Bacteria 2513
190 Ga0495613_0053179 3300046689 Bacteria 2980
191 Ga0495613_0097560 3300046689 Bacteria 2124
192 Ga0495649_0003707 3300046694 Bacteria 10163
193 Ga0495589_0090707 3300046794 Bacteria 1484
194 Ga0495600_0103050 3300046809 Bacteria 1859
195 Ga0495604_0477768 3300047317 Bacteria 811
196 Ga0495674_0646004 3300047319 Bacteria 834
197 Ga0495672_0063123 3300047320 Bacteria 2127
198 Ga0495680_0077600 3300047322 Bacteria 2515
199 Ga0495687_002250 3300047443 Bacteria 15889
200 Ga0495675_0011752 3300047444 Bacteria 5500
201 Ga0495681_0083697 3300047470 Bacteria 1420
202 Ga0495684_0135450 3300047471 Bacteria 1848
203 Ga0495593_0646330 3300047673 Bacteria 531
204 Ga0495602_0117022 3300048088 Bacteria 2152
205 Ga0496102_0999119 3300048905 Bacteria 757
206 Ga0501033_0073187 3300049570 Bacteria 2515
207 Ga0501036_0083485 3300049572 Bacteria 2700
208 Ga0501037_0008776 3300049573 Bacteria 7412
209 Ga0501038_0121040 3300049574 Bacteria 2158
210 Ga0501039_0251588 3300049575 Bacteria 1389
211 Ga0501043_0033696 3300049579 Bacteria 4030
212 Ga0501047_0039980 3300049581 Bacteria 4535
213 Ga0501047_0372017 3300049581 Bacteria 1264
214 Ga0501067_0260829 3300049583 Bacteria 965
215 Ga0501068_1029369 3300049584 Bacteria 544
216 Ga0501070_0084635 3300049586 Bacteria 2625
217 Ga0501035_0007521 3300049822 Bacteria 10179
218 Ga0501044_0004018 3300049823 Bacteria 16487
219 Ga0501044_0085228 3300049823 Bacteria 3192
220 nmdc:mga06z11_517979_c1 3300050494 Bacteria 723
221 nmdc:mga04h51_415143_c1 3300050495 Bacteria 565
222 nmdc:mga09592_268716_c1 3300050508 Bacteria 1479
223 nmdc:mga0qj67_108550_c1 3300050509 Bacteria 2239
224 nmdc:mga06r32_1054679_c1 3300050510 Bacteria 763
225 nmdc:mga06r32_713629_c1 3300050510 Bacteria 968
226 nmdc:mga0rr50_469941_c1 3300050513 Bacteria 1067
227 nmdc:mga08x19_506888_c1 3300050514 Bacteria 852
228 Ga0495601_0101943 3300053077 Bacteria 1854
229 Ga0495595_0040774 3300053084 Bacteria 2122
230 Ga0495619_0012728 3300053085 Bacteria 5294
231 Ga0466962_0012954 3300061719 Bacteria 4011
232 2585304917 2582581313 Bacteria 10042643
233 2585318941 2582581314 Bacteria 11452267
234 2644269175 2643221647 Bacteria 10741251
235 2867371032 2867369537 Bacteria 6501581
236 2873156627 2873151551 Bacteria 8625867
237 2935392219 2935390628 Bacteria 7043367
238 2954387150 2954380949 Bacteria 10050426
239 2954697988 2954691527 Bacteria 10720516
240 2954704228 2954701450 Bacteria 10834262
241 2995471212 2995463766 Bacteria 8577691
242 2997459260 2997451912 Bacteria 8492419
243 Ga0501034_0109870
244 rootH1_10006346
245 JGI25407J50210_10107971
246 Ga0006562J51391_1033315
247 Ga0070674_101063139
248 Ga0070667_100000841
249 Ga0070709_10001032
250 Ga0070709_10084926
251 Ga0070714_100013805
252 Ga0070714_100084550
253 Ga0070714_100303164
254 Ga0070713_100036245
255 Ga0070713_100043069
256 Ga0070710_10024383
257 Ga0070711_100001505
258 Ga0070711_100073376
259 Ga0070708_100021688
260 Ga0070708_100469307
261 Ga0070678_101043049
262 Ga0068867_100494684
263 Ga0070706_100004578
264 Ga0070706_100020634
265 Ga0070706_100628965
266 Ga0070707_100000225
267 Ga0070698_100007677
268 Ga0070698_100020116
269 Ga0070699_100109485
270 Ga0070665_100000490
271 Ga0070665_100448463
272 Ga0068859_101699652
273 Ga0068863_100197876
274 Ga0068858_100001746
275 Ga0068858_100063319
276 Ga0068862_100001402
277 Ga0081455_10026136
278 Ga0081455_10059270
279 Ga0081538_10002711
280 Ga0081538_10053343
281 Ga0081538_10070501
282 Ga0081540_1001031
283 Ga0070717_10004830
284 Ga0070717_10049388
285 Ga0070717_10056895
286 Ga0070717_10240050
287 Ga0070715_10735496
288 Ga0070716_100003321
289 Ga0070716_100367843
290 Ga0070712_100071307
291 Ga0070712_100232356
292 Ga0070712_100323965
293 Ga0070712_100846248
294 Ga0070712_100859238
295 Ga0070712_101522633
296 Ga0075367_10043309
297 Ga0075428_100605795
298 Ga0075431_100105375
299 Ga0075433_10015472
300 Ga0075434_100094818
301 Ga0075436_100027791
302 Ga0075436_100571006
303 Ga0097620_101699424
304 Ga0075435_100062856
305 Ga0075435_100473899
306 Ga0111539_11230094
307 Ga0105245_10035779
308 Ga0105247_10439695
309 Ga0105238_10657465
310 Ga0105249_10009964
311 Ga0105239_11748895
312 Ga0105239_11962351
313 Ga0105239_12414018
314 Ga0157375_12989064
315 Ga0157379_10042173
316 Ga0183367_1009
317 Ga0213875_10264822
318 Ga0207692_10039854
319 Ga0207647_10036769
320 Ga0207685_10670028
321 Ga0207699_10038748
322 Ga0207684_10001589
323 Ga0207684_10022631
324 Ga0207684_10272455
325 Ga0207693_10007755
326 Ga0207693_10192921
327 Ga0207693_10445998
328 Ga0207693_10913119
329 Ga0207663_10054887
330 Ga0207663_10365686
331 Ga0207646_10001144
332 Ga0207687_10048439
333 Ga0207700_10045667
334 Ga0207700_11427189
335 Ga0207664_10001889
336 Ga0207664_10055433
337 Ga0207664_10100704
338 Ga0207664_10289379
339 Ga0207665_10017489
340 Ga0207665_10245061
341 Ga0207712_10002744
342 Ga0207668_10337325
343 Ga0207658_10007264
344 Ga0207703_10000597
345 Ga0207703_10102804
346 Ga0268266_10000076
347 Ga0268265_10033193
348 Ga0307509_10356409
349 Ga0307514_10394277
350 Ga0307405_10211431
351 Ga0307413_10225293
352 Ga0307410_10302639
353 Ga0307407_10077160
354 Ga0307412_10239752
355 Ga0307409_100778813
356 Ga0307416_100285400
357 Ga0307416_101242890
358 Ga0307414_10406434
359 Ga0307411_10361675
360 Ga0307415_100144174
361 Ga0307415_100222785
362 Ga0373923_0003896
363 Ga0373936_0024924
364 Ga0373953_0023806
365 Ga0373954_0060336
366 Ga0373956_0024521
367 Ga0373957_0393531
368 Ga0373946_0054802
369 Ga0373955_0037933
370 Ga0373924_0004952
371 Ga0373935_0023979
372 Ga0373935_0526238
373 Ga0373933_0165725
374 Ga0373947_0592790
375 Ga0373937_0078468
376 Ga0373925_0550901
377 Ga0395898_0010348
378 Ga0436364_0437928
379 Ga0395901_1312870
380 Ga0436365_1401137
381 Ga0451847_0303608
382 Ga0451853_2019826
383 Ga0439448_0103731
384 Ga0439444_0036042
385 Ga0466969_0034546
386 Ga0466969_0039751
387 Ga0466969_0518741
388 Ga0466966_0008660
389 Ga0466966_0074681
390 Ga0466961_0028934
391 Ga0466963_0234738
392 Ga0466963_1200443
393 Ga0453684_0070058
394 Ga0466971_0075628
395 Ga0466971_0122011
396 Ga0466971_0711178
397 Ga0466968_0302027
398 Ga0466968_0499059
399 Ga0466970_0135817
400 Ga0466970_0380357
401 Ga0466957_0229279
402 Ga0466960_0049906
403 Ga0466959_0036585
404 Ga0466959_0112238
405 Ga0466959_0168280
406 Ga0451576_0011510
407 Ga0466967_0013461
408 Ga0466967_2089787
409 Ga0495592_0223783
410 Ga0495629_0056448
411 Ga0495651_0090681
412 Ga0495653_0081308
413 Ga0495662_0060110
414 Ga0495664_0049422
415 Ga0495608_0089145
416 Ga0495618_0016176
417 Ga0495628_0124720
418 Ga0495652_0128304
419 Ga0495665_0029466
420 Ga0495587_0102747
421 Ga0495645_0077923
422 Ga0495667_0177535
423 Ga0495656_0096564
424 Ga0495656_0642875
425 Ga0495668_0096051
426 Ga0495634_0016456
427 Ga0495657_0136398
428 Ga0495599_0003905
429 Ga0495623_0068442
430 Ga0495646_0019493
431 Ga0495658_0043481
432 Ga0495613_0053179
433 Ga0495613_0097560
434 Ga0495649_0003707
435 Ga0495589_0090707
436 Ga0495600_0103050
437 Ga0495604_0477768
438 Ga0495674_0646004
439 Ga0495672_0063123
440 Ga0495680_0077600
441 Ga0495687_002250
442 Ga0495675_0011752
443 Ga0495681_0083697
444 Ga0495684_0135450
445 Ga0495593_0646330
446 Ga0495602_0117022
447 Ga0496102_0999119
448 Ga0501033_0073187
449 Ga0501036_0083485
450 Ga0501037_0008776
451 Ga0501038_0121040
452 Ga0501039_0251588
453 Ga0501043_0033696
454 Ga0501047_0039980
455 Ga0501047_0372017
456 Ga0501067_0260829
457 Ga0501068_1029369
458 Ga0501070_0084635
459 Ga0501035_0007521
460 Ga0501044_0004018
461 Ga0501044_0085228
462 nmdc:mga06z11_517979_c1
463 nmdc:mga04h51_415143_c1
464 nmdc:mga09592_268716_c1
465 nmdc:mga0qj67_108550_c1
466 nmdc:mga06r32_1054679_c1
467 nmdc:mga06r32_713629_c1
468 nmdc:mga0rr50_469941_c1
469 nmdc:mga08x19_506888_c1
470 Ga0495601_0101943
471 Ga0495595_0040774
472 Ga0495619_0012728
473 Ga0466962_0012954
474 2585304917
475 2585318941
476 2644269175
477 2867371032
478 2873156627
479 2935392219
480 2954387150
481 2954697988
482 2954704228
483 2995471212
484 2997459260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

27

118

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9167 2 119
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9022 2 119
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.8454 1 103
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.8231 1 119
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.8171 1 119
ID Description Score Start End Superfamily
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.926 1 118 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9185 1 118 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9167 2 119 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9096 4 119 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9022 2 119 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A250V7I2-F1-model_v4 DNA-binding protein 1 1 119 GO:0003677
AF-A0A6G2QMU0-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9997 1 119 GO:0003677
AF-A0A1Q4UZK8-F1-model_v4 MmcQ-like protein 0.9994 1 119
AF-A0A5N8VYT7-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9988 1 119 GO:0003677
AF-A0A6H0CK79-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9985 1 119 GO:0003677

Map