F354884

General Info

Members Datasets Scaffolds Average Seq Length
242 161 242 123

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0657960|Ga0436365_0657960_71_472
Length 133
Sequence MNGGPAAEREGTAMSTPKDPTYTDAEVAAKITELGLAGWYLEDGWLRKKFTTEGWPTTLMLVNAIGYLAEAAWHHPDLAVTWGKVWVKLKTHSAGGITDKDFALARKIEEAVLWRPPAGGPLEGTPNKFVRAG

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
86 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
98 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 2.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 2.48
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_12380579 3300004803 Bacteria 564
2 Ga0065704_10110403 3300005289 Bacteria 1981
3 Ga0065707_10085380 3300005295 Bacteria 6198
4 Ga0065707_10759911 3300005295 Bacteria 608
5 Ga0070676_10000526 3300005328 Bacteria 18409
6 Ga0070683_101708713 3300005329 Bacteria 605
7 Ga0068869_100013735 3300005334 Bacteria 5394
8 Ga0070680_100416446 3300005336 Unclassified 1146
9 Ga0070660_100454616 3300005339 Bacteria 1063
10 Ga0070692_10015785 3300005345 Bacteria 3579
11 Ga0070669_100006563 3300005353 Bacteria 8373
12 Ga0070659_100006884 3300005366 Bacteria 8235
13 Ga0070659_100457234 3300005366 Bacteria 1084
14 Ga0070667_100031132 3300005367 Bacteria 4447
15 Ga0070667_101297670 3300005367 Bacteria 682
16 Ga0070701_10045436 3300005438 Bacteria 2253
17 Ga0070705_100282939 3300005440 Bacteria 1180
18 Ga0070705_101796965 3300005440 Unclassified 520
19 Ga0070700_100012188 3300005441 Bacteria 4789
20 Ga0070700_100659664 3300005441 Unclassified 827
21 Ga0070694_100000204 3300005444 Bacteria 31438
22 Ga0070694_100041078 3300005444 Bacteria 3084
23 Ga0070694_101261822 3300005444 Bacteria 620
24 Ga0070663_101234383 3300005455 Bacteria 658
25 Ga0070678_100815884 3300005456 Bacteria 848
26 Ga0070662_100001148 3300005457 Bacteria 16239
27 Ga0070662_100096362 3300005457 Bacteria 2231
28 Ga0070685_10024849 3300005466 Bacteria 3294
29 Ga0070707_100366107 3300005468 Bacteria 1400
30 Ga0068853_100026953 3300005539 Bacteria 4828
31 Ga0070686_100209154 3300005544 Bacteria 1403
32 Ga0070695_100330874 3300005545 Bacteria 1135
33 Ga0070695_100364186 3300005545 Unclassified 1087
34 Ga0070696_100116573 3300005546 Bacteria 1929
35 Ga0070696_101582261 3300005546 Unclassified 563
36 Ga0070704_100007693 3300005549 Bacteria 6422
37 Ga0070664_100147180 3300005564 Bacteria 2078
38 Ga0070702_101345984 3300005615 Bacteria 582
39 Ga0068852_100180378 3300005616 Bacteria 1985
40 Ga0068852_101367302 3300005616 Bacteria 730
41 Ga0068866_10387124 3300005718 Bacteria 898
42 Ga0068860_100023584 3300005843 Bacteria 5947
43 Ga0068862_101385687 3300005844 Bacteria 706
44 Ga0081540_1062430 3300005983 Bacteria 1769
45 Ga0075432_10610415 3300006058 Unclassified 500
46 Ga0068871_101476262 3300006358 Bacteria 642
47 Ga0075428_100015338 3300006844 Bacteria 8499
48 Ga0075428_100177340 3300006844 Bacteria 2308
49 Ga0075431_100056365 3300006847 Bacteria 4054
50 Ga0075431_100423229 3300006847 Bacteria 1331
51 Ga0075431_101410261 3300006847 Unclassified 656
52 Ga0075433_10054610 3300006852 Bacteria 3485
53 Ga0075433_11369647 3300006852 Bacteria 612
54 Ga0075434_100198479 3300006871 Bacteria 2026
55 Ga0105240_10538491 3300009093 Bacteria 1293
56 Ga0105240_10593220 3300009093 Bacteria 1221
57 Ga0105245_10033811 3300009098 Bacteria 4531
58 Ga0114129_10023385 3300009147 Bacteria 8762
59 Ga0114129_11467960 3300009147 Unclassified 839
60 Ga0114129_13523511 3300009147 Unclassified 500
61 Ga0105243_10748332 3300009148 Bacteria 958
62 Ga0105248_10685386 3300009177 Bacteria 1156
63 Ga0105237_10183205 3300009545 Bacteria 2094
64 Ga0105249_10007374 3300009553 Bacteria 9592
65 Ga0105249_10311270 3300009553 Bacteria 1583
66 Ga0105239_10086715 3300010375 Bacteria 3451
67 Ga0157374_10027260 3300013296 Bacteria 5150
68 Ga0157378_11626398 3300013297 Bacteria 692
69 Ga0163162_10004690 3300013306 Bacteria 13183
70 Ga0157372_10237723 3300013307 Bacteria 2113
71 Ga0157372_10527118 3300013307 Bacteria 1377
72 Ga0157375_10241375 3300013308 Bacteria 1966
73 Ga0157375_12671201 3300013308 Unclassified 597
74 Ga0163163_11378844 3300014325 Bacteria 767
75 Ga0157380_10054590 3300014326 Bacteria 3171
76 Ga0182008_10889713 3300014497 Bacteria 523
77 Ga0157377_10005102 3300014745 Bacteria 6137
78 Ga0157377_10488007 3300014745 Bacteria 858
79 Ga0157379_10026658 3300014968 Bacteria 5144
80 Ga0157379_10099175 3300014968 Bacteria 2615
81 Ga0157379_11089745 3300014968 Bacteria 765
82 Ga0206356_10021595 3300020070 Bacteria 547
83 Ga0224712_10554679 3300022467 Bacteria 559
84 Ga0207642_10513200 3300025899 Bacteria 735
85 Ga0207688_10627514 3300025901 Bacteria 678
86 Ga0207705_10200880 3300025909 Bacteria 1510
87 Ga0207695_10531729 3300025913 Bacteria 1057
88 Ga0207649_10949879 3300025920 Bacteria 675
89 Ga0207646_10108220 3300025922 Bacteria 2494
90 Ga0207706_10025222 3300025933 Bacteria 5330
91 Ga0207670_10683561 3300025936 Bacteria 848
92 Ga0207669_10497382 3300025937 Bacteria 975
93 Ga0207704_10189644 3300025938 Bacteria 1494
94 Ga0207712_10003743 3300025961 Bacteria 9601
95 Ga0207712_10504959 3300025961 Bacteria 1034
96 Ga0207668_10675969 3300025972 Bacteria 906
97 Ga0207640_10605877 3300025981 Bacteria 928
98 Ga0207639_10980691 3300026041 Bacteria 791
99 Ga0207678_10630645 3300026067 Bacteria 941
100 Ga0207708_10379606 3300026075 Unclassified 1165
101 Ga0207676_11287634 3300026095 Bacteria 726
102 Ga0207675_100000932 3300026118 Bacteria 29223
103 Ga0265338_10761226 3300028800 Unclassified 665
104 Ga0265762_1006046 3300030760 Unclassified 2169
105 Ga0265762_1051017 3300030760 Bacteria 831
106 Ga0265770_1026468 3300030878 Bacteria 949
107 Ga0265760_10001511 3300031090 Bacteria 6847
108 Ga0265331_10191284 3300031250 Unclassified 923
109 Ga0307406_11053317 3300031901 Bacteria 700
110 Ga0307415_100126931 3300032126 Bacteria 1924
111 Ga0373959_0090105 3300034820 Bacteria 718
112 Ga0373942_0274259 3300035207 Bacteria 579
113 Ga0373961_0087450 3300035241 Bacteria 990
114 Ga0373947_0895685 3300035725 Unclassified 606
115 Ga0395905_0946474 3300037471 Unclassified 764
116 Ga0436364_0112284 3300037853 Bacteria 632
117 Ga0436364_0241001 3300037853 Bacteria 650
118 Ga0436364_0529210 3300037853 Bacteria 653
119 Ga0436364_1068516 3300037853 Bacteria 1164
120 Ga0436364_1359830 3300037853 Bacteria 705
121 Ga0395901_0571124 3300038443 Bacteria 1144
122 Ga0436365_0657960 3300039437 Bacteria 548
123 Ga0436365_1805470 3300039437 Bacteria 811
124 Ga0436360_0686521 3300039438 Bacteria 517
125 Ga0436360_0762781 3300039438 Bacteria 643
126 Ga0436360_1025191 3300039438 Bacteria 979
127 Ga0436361_0025143 3300039447 Bacteria 886
128 Ga0436361_0227590 3300039447 Bacteria 724
129 Ga0436363_0187359 3300039450 Bacteria 555
130 Ga0436363_0611015 3300039450 Bacteria 509
131 Ga0436362_0160500 3300039453 Bacteria 525
132 Ga0451800_0635223 3300041459 Bacteria 575
133 Ga0439434_0096295 3300042435 Unclassified 950
134 Ga0439459_0146847 3300042438 Bacteria 614
135 Ga0451577_1043577 3300042876 Bacteria 733
136 Ga0466972_0373151 3300044658 Bacteria 668
137 Ga0466963_0370708 3300044694 Bacteria 1009
138 Ga0466963_1256714 3300044694 Bacteria 520
139 Ga0451576_0433403 3300045051 Bacteria 1379
140 Ga0466967_1643185 3300045976 Bacteria 640
141 Ga0495629_0000009 3300046459 Bacteria 348242
142 Ga0495582_0324756 3300046473 Bacteria 885
143 Ga0495644_0143938 3300046523 Bacteria 911
144 Ga0495598_0159587 3300046537 Bacteria 792
145 Ga0495600_0660919 3300046809 Bacteria 631
146 Ga0495636_0663032 3300047318 Bacteria 513
147 Ga0495593_0388362 3300047673 Bacteria 698
148 Ga0496104_0015769 3300048907 Bacteria 6853
149 Ga0496109_0222055 3300048912 Bacteria 1777
150 Ga0496109_0260305 3300048912 Bacteria 1634
151 Ga0496110_0440376 3300048913 Bacteria 1188
152 Ga0496115_0146938 3300048918 Bacteria 1946
153 Ga0501031_0117792 3300049568 Bacteria 1735
154 Ga0501032_0191946 3300049569 Bacteria 1335
155 Ga0501032_0206046 3300049569 Unclassified 1283
156 Ga0501033_0225782 3300049570 Bacteria 1332
157 Ga0501033_0642618 3300049570 Bacteria 725
158 Ga0501034_0123605 3300049571 Bacteria 2574
159 Ga0501034_0284764 3300049571 Bacteria 1592
160 Ga0501036_0037340 3300049572 Bacteria 4110
161 Ga0501036_0554906 3300049572 Unclassified 954
162 Ga0501037_0249213 3300049573 Bacteria 1243
163 Ga0501038_0168772 3300049574 Bacteria 1773
164 Ga0501038_0328170 3300049574 Bacteria 1196
165 Ga0501038_0382347 3300049574 Unclassified 1092
166 Ga0501039_0405925 3300049575 Bacteria 1070
167 Ga0501040_0027344 3300049576 Bacteria 3840
168 Ga0501040_0035268 3300049576 Bacteria 3392
169 Ga0501040_0178822 3300049576 Bacteria 1503
170 Ga0501040_1117344 3300049576 Unclassified 572
171 Ga0501041_0082907 3300049577 Bacteria 1976
172 Ga0501041_0221135 3300049577 Bacteria 1188
173 Ga0501041_0231549 3300049577 Bacteria 1160
174 Ga0501041_0299809 3300049577 Bacteria 1013
175 Ga0501042_0023919 3300049578 Bacteria 4280
176 Ga0501042_0183571 3300049578 Bacteria 1509
177 Ga0501042_0229243 3300049578 Bacteria 1340
178 Ga0501043_0467377 3300049579 Bacteria 946
179 Ga0501046_0110519 3300049580 Bacteria 2100
180 Ga0501046_0335183 3300049580 Bacteria 1100
181 Ga0501047_0030197 3300049581 Bacteria 5226
182 Ga0501047_0396292 3300049581 Bacteria 1214
183 Ga0501047_0851190 3300049581 Unclassified 726
184 Ga0501048_0044550 3300049582 Bacteria 3172
185 Ga0501068_0186442 3300049584 Bacteria 1313
186 Ga0501069_0136505 3300049585 Unclassified 1406
187 Ga0501069_0437147 3300049585 Bacteria 777
188 Ga0501070_1219397 3300049586 Bacteria 577
189 Ga0501071_0169537 3300049587 Bacteria 1634
190 Ga0501072_0120290 3300049588 Bacteria 2092
191 Ga0501072_0566441 3300049588 Unclassified 897
192 Ga0501072_0797895 3300049588 Bacteria 740
193 Ga0501073_0153709 3300049589 Unclassified 1595
194 Ga0501074_0094863 3300049590 Bacteria 2137
195 Ga0501074_0326065 3300049590 Bacteria 1090
196 Ga0501075_0043475 3300049591 Bacteria 3370
197 Ga0501075_0051571 3300049591 Bacteria 3094
198 Ga0501075_0071093 3300049591 Bacteria 2630
199 Ga0501075_0708488 3300049591 Unclassified 767
200 Ga0501076_0103663 3300049592 Unclassified 2295
201 Ga0501076_0155509 3300049592 Bacteria 1861
202 Ga0501076_0499573 3300049592 Bacteria 1002
203 Ga0501077_0076380 3300049593 Bacteria 2122
204 Ga0501077_0344694 3300049593 Unclassified 950
205 Ga0501077_0440435 3300049593 Unclassified 834
206 Ga0501079_0154709 3300049741 Bacteria 1787
207 Ga0501079_0321713 3300049741 Unclassified 1211
208 Ga0501079_0447411 3300049741 Bacteria 1014
209 Ga0501079_0448120 3300049741 Bacteria 1014
210 Ga0501080_0504105 3300049742 Bacteria 1081
211 Ga0501080_0581559 3300049742 Bacteria 995
212 Ga0501081_0024474 3300049743 Bacteria 4054
213 Ga0501081_0044208 3300049743 Bacteria 3057
214 Ga0501081_0174924 3300049743 Bacteria 1551
215 Ga0501083_0287127 3300049744 Bacteria 1070
216 Ga0501083_0806555 3300049744 Bacteria 611
217 Ga0501035_0161395 3300049822 Bacteria 1940
218 Ga0501035_0165143 3300049822 Bacteria 1915
219 Ga0501044_0038694 3300049823 Bacteria 4980
220 Ga0501044_0890582 3300049823 Bacteria 765
221 Ga0501045_0067419 3300049824 Bacteria 2628
222 nmdc:mga0yw44_836122_c1 3300050492 Unclassified 625
223 nmdc:mga05p37_46401_c1 3300050507 Bacteria 5342
224 nmdc:mga09592_957053_c1 3300050508 Bacteria 717
225 nmdc:mga06r32_25022_c1 3300050510 Bacteria 5547
226 nmdc:mga06r32_427029_c1 3300050510 Bacteria 1306
227 nmdc:mga06r32_520207_c1 3300050510 Bacteria 1165
228 nmdc:mga0n895_23717_c1 3300050512 Bacteria 5770
229 nmdc:mga0rr50_241907_c1 3300050513 Unclassified 1496
230 nmdc:mga08x19_154336_c1 3300050514 Unclassified 1556
231 nmdc:mga0a205_162868_c1 3300050515 Bacteria 2126
232 nmdc:mga0a205_64482_c1 3300050515 Bacteria 3538
233 Ga0495601_0000323 3300053077 Bacteria 25347
234 Ga0495619_0067652 3300053085 Bacteria 2385
235 Ga0500566_0012321 3300053094 Bacteria 5035
236 Ga0501084_0046391 3300054114 Bacteria 3640
237 Ga0501084_0176564 3300054114 Bacteria 1803
238 Ga0501084_0276844 3300054114 Bacteria 1417
239 Ga0501084_0692177 3300054114 Bacteria 860
240 Ga0501082_0164740 3300060353 Bacteria 1926
241 Ga0501082_0347482 3300060353 Unclassified 1293
242 Ga0530510_0041502 3300061734 Bacteria 3322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10110403 Ga0065704_101104032 112
2 3300005295 Ga0065707_10085380 Ga0065707_100853806 112
3 3300006847 Ga0075431_101410261 Ga0075431_1014102611 112
4 3300037471 Ga0395905_0946474 Ga0395905_0946474_338_706 112
5 3300050510 nmdc:mga06r32_520207_c1 nmdc:mga06r32_520207_c1_594_935 112
6 3300005295 Ga0065707_10759911 Ga0065707_107599111 113
7 3300005444 Ga0070694_101261822 Ga0070694_1012618221 113
8 3300005544 Ga0070686_100209154 Ga0070686_1002091542 113
9 3300006852 Ga0075433_11369647 Ga0075433_113696472 113
10 3300009093 Ga0105240_10538491 Ga0105240_105384911 113
11 3300009147 Ga0114129_11467960 Ga0114129_114679602 113
12 3300025913 Ga0207695_10531729 Ga0207695_105317292 113
13 3300028800 Ga0265338_10761226 Ga0265338_107612262 113
14 3300030760 Ga0265762_1006046 Ga0265762_10060462 113
15 3300030760 Ga0265762_1051017 Ga0265762_10510172 113
16 3300030878 Ga0265770_1026468 Ga0265770_10264682 113
17 3300031090 Ga0265760_10001511 Ga0265760_100015116 113
18 3300039437 Ga0436365_1805470 Ga0436365_1805470_240_605 114
19 3300049571 Ga0501034_0284764 Ga0501034_0284764_647_1009 114
20 3300039447 Ga0436361_0025143 Ga0436361_0025143_215_580 115
21 3300005329 Ga0070683_101708713 Ga0070683_1017087131 117
22 3300042435 Ga0439434_0096295 Ga0439434_0096295_61_414 117
23 3300046809 Ga0495600_0660919 Ga0495600_0660919_89_442 117
24 3300049568 Ga0501031_0117792 Ga0501031_0117792_530_883 117
25 3300049569 Ga0501032_0191946 Ga0501032_0191946_867_1220 117
26 3300049572 Ga0501036_0037340 Ga0501036_0037340_2460_2813 117
27 3300049575 Ga0501039_0405925 Ga0501039_0405925_303_656 117
28 3300049576 Ga0501040_0027344 Ga0501040_0027344_1739_2092 117
29 3300049577 Ga0501041_0082907 Ga0501041_0082907_234_587 117
30 3300049578 Ga0501042_0229243 Ga0501042_0229243_940_1293 117
31 3300049580 Ga0501046_0335183 Ga0501046_0335183_701_1054 117
32 3300049588 Ga0501072_0797895 Ga0501072_0797895_21_374 117
33 3300049590 Ga0501074_0326065 Ga0501074_0326065_107_460 117
34 3300049591 Ga0501075_0043475 Ga0501075_0043475_140_493 117
35 3300049592 Ga0501076_0155509 Ga0501076_0155509_1085_1438 117
36 3300049593 Ga0501077_0076380 Ga0501077_0076380_1322_1675 117
37 3300049741 Ga0501079_0448120 Ga0501079_0448120_88_441 117
38 3300049742 Ga0501080_0504105 Ga0501080_0504105_82_435 117
39 3300049744 Ga0501083_0287127 Ga0501083_0287127_604_957 117
40 3300049824 Ga0501045_0067419 Ga0501045_0067419_33_386 117
41 3300054114 Ga0501084_0276844 Ga0501084_0276844_945_1298 117
42 3300060353 Ga0501082_0164740 Ga0501082_0164740_1079_1432 117
43 3300005336 Ga0070680_100416446 Ga0070680_1004164462 118
44 3300005345 Ga0070692_10015785 Ga0070692_100157854 118
45 3300005440 Ga0070705_100282939 Ga0070705_1002829392 118
46 3300005444 Ga0070694_100000204 Ga0070694_10000020426 118
47 3300005545 Ga0070695_100330874 Ga0070695_1003308742 118
48 3300005546 Ga0070696_101582261 Ga0070696_1015822611 118
49 3300005549 Ga0070704_100007693 Ga0070704_1000076936 118
50 3300005844 Ga0068862_101385687 Ga0068862_1013856871 118
51 3300006844 Ga0075428_100177340 Ga0075428_1001773401 118
52 3300006847 Ga0075431_100056365 Ga0075431_1000563655 118
53 3300009147 Ga0114129_10023385 Ga0114129_100233855 118
54 3300014968 Ga0157379_10099175 Ga0157379_100991752 118
55 3300037853 Ga0436364_0112284 Ga0436364_0112284_152_508 118
56 3300037853 Ga0436364_1068516 Ga0436364_1068516_138_494 118
57 3300046459 Ga0495629_0000009 Ga0495629_0000009_32145_32501 118
58 3300046473 Ga0495582_0324756 Ga0495582_0324756_38_394 118
59 3300047673 Ga0495593_0388362 Ga0495593_0388362_109_465 118
60 3300049744 Ga0501083_0806555 Ga0501083_0806555_45_404 118
61 3300050507 nmdc:mga05p37_46401_c1 nmdc:mga05p37_46401_c1_3996_4352 118
62 3300050510 nmdc:mga06r32_25022_c1 nmdc:mga06r32_25022_c1_3768_4124 118
63 3300050514 nmdc:mga08x19_154336_c1 nmdc:mga08x19_154336_c1_559_915 118
64 3300053094 Ga0500566_0012321 Ga0500566_0012321_3453_3809 118
65 3300005616 Ga0068852_101367302 Ga0068852_1013673021 119
66 3300006871 Ga0075434_100198479 Ga0075434_1001984792 119
67 3300013308 Ga0157375_12671201 Ga0157375_126712012 119
68 3300014968 Ga0157379_11089745 Ga0157379_110897452 119
69 3300039450 Ga0436363_0611015 Ga0436363_0611015_13_372 119
70 3300045976 Ga0466967_1643185 Ga0466967_1643185_125_487 119
71 3300048907 Ga0496104_0015769 Ga0496104_0015769_3926_4285 119
72 3300048912 Ga0496109_0260305 Ga0496109_0260305_1130_1489 119
73 3300048913 Ga0496110_0440376 Ga0496110_0440376_528_887 119
74 3300048918 Ga0496115_0146938 Ga0496115_0146938_471_830 119
75 3300049577 Ga0501041_0231549 Ga0501041_0231549_362_724 119
76 3300049580 Ga0501046_0110519 Ga0501046_0110519_672_1031 119
77 3300049581 Ga0501047_0030197 Ga0501047_0030197_3794_4153 119
78 3300049741 Ga0501079_0447411 Ga0501079_0447411_51_413 119
79 3300054114 Ga0501084_0046391 Ga0501084_0046391_1765_2127 119
80 3300005328 Ga0070676_10000526 Ga0070676_100005267 120
81 3300005334 Ga0068869_100013735 Ga0068869_1000137356 120
82 3300005339 Ga0070660_100454616 Ga0070660_1004546162 120
83 3300005353 Ga0070669_100006563 Ga0070669_1000065632 120
84 3300005366 Ga0070659_100006884 Ga0070659_1000068848 120
85 3300005366 Ga0070659_100457234 Ga0070659_1004572342 120
86 3300005367 Ga0070667_100031132 Ga0070667_1000311322 120
87 3300005367 Ga0070667_101297670 Ga0070667_1012976702 120
88 3300005438 Ga0070701_10045436 Ga0070701_100454363 120
89 3300005441 Ga0070700_100012188 Ga0070700_1000121884 120
90 3300005441 Ga0070700_100659664 Ga0070700_1006596641 120
91 3300005444 Ga0070694_100041078 Ga0070694_1000410783 120
92 3300005455 Ga0070663_101234383 Ga0070663_1012343832 120
93 3300005456 Ga0070678_100815884 Ga0070678_1008158841 120
94 3300005457 Ga0070662_100001148 Ga0070662_10000114813 120
95 3300005457 Ga0070662_100096362 Ga0070662_1000963622 120
96 3300005466 Ga0070685_10024849 Ga0070685_100248493 120
97 3300005539 Ga0068853_100026953 Ga0068853_1000269535 120
98 3300005564 Ga0070664_100147180 Ga0070664_1001471801 120
99 3300005615 Ga0070702_101345984 Ga0070702_1013459841 120
100 3300005616 Ga0068852_100180378 Ga0068852_1001803783 120
101 3300005718 Ga0068866_10387124 Ga0068866_103871241 120
102 3300005843 Ga0068860_100023584 Ga0068860_1000235842 120
103 3300006058 Ga0075432_10610415 Ga0075432_106104151 120
104 3300006358 Ga0068871_101476262 Ga0068871_1014762621 120
105 3300006847 Ga0075431_100423229 Ga0075431_1004232292 120
106 3300006852 Ga0075433_10054610 Ga0075433_100546105 120
107 3300009093 Ga0105240_10593220 Ga0105240_105932202 120
108 3300009098 Ga0105245_10033811 Ga0105245_100338113 120
109 3300009147 Ga0114129_13523511 Ga0114129_135235111 120
110 3300009148 Ga0105243_10748332 Ga0105243_107483322 120
111 3300009177 Ga0105248_10685386 Ga0105248_106853862 120
112 3300009545 Ga0105237_10183205 Ga0105237_101832052 120
113 3300009553 Ga0105249_10007374 Ga0105249_100073743 120
114 3300010375 Ga0105239_10086715 Ga0105239_100867152 120
115 3300013296 Ga0157374_10027260 Ga0157374_100272602 120
116 3300013297 Ga0157378_11626398 Ga0157378_116263981 120
117 3300013306 Ga0163162_10004690 Ga0163162_100046902 120
118 3300013307 Ga0157372_10237723 Ga0157372_102377232 120
119 3300013307 Ga0157372_10527118 Ga0157372_105271182 120
120 3300013308 Ga0157375_10241375 Ga0157375_102413752 120
121 3300014325 Ga0163163_11378844 Ga0163163_113788441 120
122 3300014326 Ga0157380_10054590 Ga0157380_100545902 120
123 3300014745 Ga0157377_10005102 Ga0157377_100051022 120
124 3300014745 Ga0157377_10488007 Ga0157377_104880071 120
125 3300014968 Ga0157379_10026658 Ga0157379_100266582 120
126 3300020070 Ga0206356_10021595 Ga0206356_100215951 120
127 3300022467 Ga0224712_10554679 Ga0224712_105546791 120
128 3300025899 Ga0207642_10513200 Ga0207642_105132002 120
129 3300025901 Ga0207688_10627514 Ga0207688_106275141 120
130 3300025909 Ga0207705_10200880 Ga0207705_102008802 120
131 3300025920 Ga0207649_10949879 Ga0207649_109498791 120
132 3300025933 Ga0207706_10025222 Ga0207706_100252225 120
133 3300025936 Ga0207670_10683561 Ga0207670_106835611 120
134 3300025937 Ga0207669_10497382 Ga0207669_104973822 120
135 3300025938 Ga0207704_10189644 Ga0207704_101896442 120
136 3300025961 Ga0207712_10003743 Ga0207712_100037438 120
137 3300025972 Ga0207668_10675969 Ga0207668_106759692 120
138 3300025981 Ga0207640_10605877 Ga0207640_106058772 120
139 3300026041 Ga0207639_10980691 Ga0207639_109806912 120
140 3300026067 Ga0207678_10630645 Ga0207678_106306452 120
141 3300026075 Ga0207708_10379606 Ga0207708_103796062 120
142 3300026095 Ga0207676_11287634 Ga0207676_112876342 120
143 3300026118 Ga0207675_100000932 Ga0207675_10000093213 120
144 3300031901 Ga0307406_11053317 Ga0307406_110533171 120
145 3300034820 Ga0373959_0090105 Ga0373959_0090105_22_417 120
146 3300035207 Ga0373942_0274259 Ga0373942_0274259_11_406 120
147 3300035241 Ga0373961_0087450 Ga0373961_0087450_85_480 120
148 3300035725 Ga0373947_0895685 Ga0373947_0895685_30_392 120
149 3300037853 Ga0436364_0241001 Ga0436364_0241001_217_579 120
150 3300037853 Ga0436364_1359830 Ga0436364_1359830_147_536 120
151 3300039437 Ga0436365_0657960 Ga0436365_0657960_71_472 120
152 3300041459 Ga0451800_0635223 Ga0451800_0635223_154_519 120
153 3300045051 Ga0451576_0433403 Ga0451576_0433403_162_557 120
154 3300046523 Ga0495644_0143938 Ga0495644_0143938_344_712 120
155 3300046537 Ga0495598_0159587 Ga0495598_0159587_405_773 120
156 3300047318 Ga0495636_0663032 Ga0495636_0663032_34_402 120
157 3300048912 Ga0496109_0222055 Ga0496109_0222055_312_707 120
158 3300050492 nmdc:mga0yw44_836122_c1 nmdc:mga0yw44_836122_c1_203_568 120
159 3300050510 nmdc:mga06r32_427029_c1 nmdc:mga06r32_427029_c1_696_1058 120
160 3300050512 nmdc:mga0n895_23717_c1 nmdc:mga0n895_23717_c1_718_1113 120
161 3300050513 nmdc:mga0rr50_241907_c1 nmdc:mga0rr50_241907_c1_268_663 120
162 3300050515 nmdc:mga0a205_64482_c1 nmdc:mga0a205_64482_c1_3117_3512 120
163 3300053077 Ga0495601_0000323 Ga0495601_0000323_9347_9712 120
164 3300053085 Ga0495619_0067652 Ga0495619_0067652_122_487 120
165 3300005440 Ga0070705_101796965 Ga0070705_1017969651 121
166 3300005468 Ga0070707_100366107 Ga0070707_1003661072 121
167 3300005545 Ga0070695_100364186 Ga0070695_1003641862 121
168 3300005546 Ga0070696_100116573 Ga0070696_1001165731 121
169 3300006844 Ga0075428_100015338 Ga0075428_10001533812 121
170 3300009553 Ga0105249_10311270 Ga0105249_103112702 121
171 3300014497 Ga0182008_10889713 Ga0182008_108897131 121
172 3300025922 Ga0207646_10108220 Ga0207646_101082202 121
173 3300025961 Ga0207712_10504959 Ga0207712_105049592 121
174 3300031250 Ga0265331_10191284 Ga0265331_101912841 121
175 3300037853 Ga0436364_0529210 Ga0436364_0529210_273_638 121
176 3300038443 Ga0395901_0571124 Ga0395901_0571124_718_1089 121
177 3300039438 Ga0436360_0762781 Ga0436360_0762781_42_407 121
178 3300039450 Ga0436363_0187359 Ga0436363_0187359_98_463 121
179 3300039453 Ga0436362_0160500 Ga0436362_0160500_138_503 121
180 3300042876 Ga0451577_1043577 Ga0451577_1043577_59_451 121
181 3300044658 Ga0466972_0373151 Ga0466972_0373151_124_498 121
182 3300044694 Ga0466963_0370708 Ga0466963_0370708_608_973 121
183 3300049569 Ga0501032_0206046 Ga0501032_0206046_234_614 121
184 3300049570 Ga0501033_0225782 Ga0501033_0225782_33_413 121
185 3300049570 Ga0501033_0642618 Ga0501033_0642618_217_582 121
186 3300049571 Ga0501034_0123605 Ga0501034_0123605_336_701 121
187 3300049572 Ga0501036_0554906 Ga0501036_0554906_327_707 121
188 3300049573 Ga0501037_0249213 Ga0501037_0249213_140_520 121
189 3300049574 Ga0501038_0168772 Ga0501038_0168772_70_450 121
190 3300049574 Ga0501038_0328170 Ga0501038_0328170_140_505 121
191 3300049574 Ga0501038_0382347 Ga0501038_0382347_198_578 121
192 3300049576 Ga0501040_0035268 Ga0501040_0035268_436_816 121
193 3300049576 Ga0501040_0178822 Ga0501040_0178822_63_443 121
194 3300049576 Ga0501040_1117344 Ga0501040_1117344_166_546 121
195 3300049577 Ga0501041_0221135 Ga0501041_0221135_197_577 121
196 3300049577 Ga0501041_0299809 Ga0501041_0299809_560_928 121
197 3300049578 Ga0501042_0023919 Ga0501042_0023919_246_626 121
198 3300049578 Ga0501042_0183571 Ga0501042_0183571_76_456 121
199 3300049579 Ga0501043_0467377 Ga0501043_0467377_360_725 121
200 3300049581 Ga0501047_0396292 Ga0501047_0396292_141_506 121
201 3300049582 Ga0501048_0044550 Ga0501048_0044550_400_780 121
202 3300049584 Ga0501068_0186442 Ga0501068_0186442_446_826 121
203 3300049585 Ga0501069_0136505 Ga0501069_0136505_846_1226 121
204 3300049585 Ga0501069_0437147 Ga0501069_0437147_282_662 121
205 3300049586 Ga0501070_1219397 Ga0501070_1219397_28_393 121
206 3300049587 Ga0501071_0169537 Ga0501071_0169537_641_1021 121
207 3300049588 Ga0501072_0120290 Ga0501072_0120290_1581_1961 121
208 3300049588 Ga0501072_0566441 Ga0501072_0566441_389_775 121
209 3300049589 Ga0501073_0153709 Ga0501073_0153709_1008_1388 121
210 3300049590 Ga0501074_0094863 Ga0501074_0094863_671_1051 121
211 3300049591 Ga0501075_0051571 Ga0501075_0051571_641_1021 121
212 3300049591 Ga0501075_0071093 Ga0501075_0071093_2083_2463 121
213 3300049591 Ga0501075_0708488 Ga0501075_0708488_70_456 121
214 3300049592 Ga0501076_0103663 Ga0501076_0103663_1740_2120 121
215 3300049592 Ga0501076_0499573 Ga0501076_0499573_59_439 121
216 3300049593 Ga0501077_0344694 Ga0501077_0344694_134_514 121
217 3300049593 Ga0501077_0440435 Ga0501077_0440435_223_603 121
218 3300049741 Ga0501079_0154709 Ga0501079_0154709_824_1204 121
219 3300049741 Ga0501079_0321713 Ga0501079_0321713_126_506 121
220 3300049742 Ga0501080_0581559 Ga0501080_0581559_10_390 121
221 3300049743 Ga0501081_0024474 Ga0501081_0024474_3589_3969 121
222 3300049743 Ga0501081_0044208 Ga0501081_0044208_2385_2765 121
223 3300049743 Ga0501081_0174924 Ga0501081_0174924_946_1326 121
224 3300049822 Ga0501035_0161395 Ga0501035_0161395_520_900 121
225 3300049822 Ga0501035_0165143 Ga0501035_0165143_109_474 121
226 3300049823 Ga0501044_0038694 Ga0501044_0038694_754_1119 121
227 3300049823 Ga0501044_0890582 Ga0501044_0890582_142_507 121
228 3300050508 nmdc:mga09592_957053_c1 nmdc:mga09592_957053_c1_117_497 121
229 3300050515 nmdc:mga0a205_162868_c1 nmdc:mga0a205_162868_c1_203_583 121
230 3300054114 Ga0501084_0176564 Ga0501084_0176564_1051_1431 121
231 3300054114 Ga0501084_0692177 Ga0501084_0692177_48_428 121
232 3300060353 Ga0501082_0347482 Ga0501082_0347482_685_1065 121
233 3300061734 Ga0530510_0041502 Ga0530510_0041502_1065_1445 121
234 3300005983 Ga0081540_1062430 Ga0081540_10624302 122
235 3300032126 Ga0307415_100126931 Ga0307415_1001269312 122
236 3300042438 Ga0439459_0146847 Ga0439459_0146847_207_578 122
237 3300044694 Ga0466963_1256714 Ga0466963_1256714_36_410 122
238 3300039438 Ga0436360_1025191 Ga0436360_1025191_408_791 123
239 3300039447 Ga0436361_0227590 Ga0436361_0227590_208_579 123
240 3300049581 Ga0501047_0851190 Ga0501047_0851190_81_455 123
241 3300004803 Ga0058862_12380579 Ga0058862_123805791 124
242 3300039438 Ga0436360_0686521 Ga0436360_0686521_25_489 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

20

111

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9557 28 100
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.925 27 103
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9045 9 100
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9027 27 103
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.8968 28 100
ID Description Score Start End Superfamily
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.949 27 100 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9285 9 98 3.30.1360.20
af_O42658_1_95_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9246 28 98 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9074 10 102 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9045 9 100 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A530M1S7-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9898 25 105 GO:0006729
GO:0008124
AF-A0A2E0UL18-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9716 9 99 GO:0006729
GO:0008124
AF-A0A2S8MXE9-F1-model_v4 deleted 0.9704 27 98
AF-A0A2V7T660-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9695 6 91 GO:0006729
GO:0008124
AF-A0A7J4TP39-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9687 27 100 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
91.3 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map