F354859

General Info

Members Datasets Scaffolds Average Seq Length
242 198 484 340

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0001675|Ga0395899_0001675_3827_4948
Length 373
Sequence LTTRLGVLDNLYRFDRNTREWLKIVKWLSFARLGSAATVAVVTAASLGLAACGXXDDSGGPVTLRLGYFPNLTHAPAIVGVEKGIFAEKLGGAARLETKTFNAGPSAIEAIFSGALDATYVGPNPTINAYSQSGGKAIKVISGAASGGVALVVKPGINSAQDLEGKKIGTPQLGNTQDVAVRYWLEEHGLTTTKEGGGDVSIVPQENAQNLATFRSGAIDGAWVPEPWASQLVNAGGKVLVDERTLWPGGQFVITNLIVRTEFLKQHPDVVRKLVEGAVAANAFVNTQPDEAKQAVSAHIAKISGKPLDPKLIDQAWPRIEFLNDPLASSLKTGLDHAVAVGLTKPVDLAGLYDLSILNQVLKAQGKTELPQP

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 2501939600 Micromonospora sp. L5 Isolate Unclassified
164 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
165 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
166 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
167 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
168 2855683550 Micromonospora sp. RP3T Isolate Unclassified
169 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
170 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
171 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
172 2858868258 Micromonospora sp. MH33 Isolate Unclassified
173 2858882152 Micromonospora noduli MED15 Isolate Nodule
174 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
175 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
176 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
177 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
178 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
179 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
180 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
181 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
182 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
183 2902582711 Micromonospora sp. AP08 Isolate Unclassified
184 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
185 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
186 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
187 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
188 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
189 649633069 Micromonospora sp. L5 Isolate Unclassified
190 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
191 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
192 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
193 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
194 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
195 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
196 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
197 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
198 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.12
Metatranscriptomes 0
Isolates 14.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 2.48
Rhizoplane 4.96
Rhizosphere 80.99
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0001675 3300037312 Bacteria 18472
2 Ga0070683_100145498 3300005329 Archaea 2245
3 Ga0070682_100142897 3300005337 Archaea 1633
4 Ga0068868_100027587 3300005338 Archaea 4332
5 Ga0070687_100198668 3300005343 Unclassified 1213
6 Ga0070703_10047507 3300005406 Bacteria 1360
7 Ga0070709_10001916 3300005434 Archaea 11307
8 Ga0070710_10103344 3300005437 Archaea 1701
9 Ga0070711_100002098 3300005439 Archaea 11268
10 Ga0070711_100087824 3300005439 Archaea 2233
11 Ga0070705_100077647 3300005440 Bacteria 2029
12 Ga0070708_100053502 3300005445 Bacteria 3582
13 Ga0070708_100087994 3300005445 Bacteria 2823
14 Ga0070681_10025898 3300005458 Bacteria 5896
15 Ga0070681_10071748 3300005458 Bacteria 3428
16 Ga0070681_10085868 3300005458 Bacteria 3100
17 Ga0070706_100244145 3300005467 Bacteria 1677
18 Ga0070707_100006274 3300005468 Archaea 11062
19 Ga0070707_100246817 3300005468 Bacteria 1737
20 Ga0070698_100271879 3300005471 Bacteria 1626
21 Ga0070698_100476591 3300005471 Archaea 1185
22 Ga0070699_100046115 3300005518 Bacteria 3772
23 Ga0070679_100370146 3300005530 Bacteria 1380
24 Ga0070684_100026702 3300005535 Archaea 4867
25 Ga0070695_100026327 3300005545 Bacteria 3597
26 Ga0070695_100033177 3300005545 Bacteria 3229
27 Ga0070695_100146266 3300005545 Bacteria 1644
28 Ga0070693_100104788 3300005547 Bacteria 1729
29 Ga0070704_100016797 3300005549 Bacteria 4635
30 Ga0070664_100164463 3300005564 Unclassified 1965
31 Ga0081455_10215127 3300005937 Bacteria 1429
32 Ga0081540_1015326 3300005983 Bacteria 4857
33 Ga0081539_10006184 3300005985 Bacteria 11637
34 Ga0081539_10007384 3300005985 Bacteria 10048
35 Ga0081539_10027602 3300005985 Bacteria 3591
36 Ga0081539_10091600 3300005985 Bacteria 1570
37 Ga0070717_10054644 3300006028 Archaea 3293
38 Ga0070715_10019062 3300006163 Archaea 2625
39 Ga0070716_100000574 3300006173 Archaea 15391
40 Ga0070716_100006841 3300006173 Archaea 5590
41 Ga0070712_100000573 3300006175 Archaea 21416
42 Ga0075428_100000728 3300006844 Bacteria 34185
43 Ga0075430_100002599 3300006846 Bacteria 15073
44 Ga0075430_100068942 3300006846 Bacteria 2967
45 Ga0075430_100083482 3300006846 Bacteria 2676
46 Ga0075430_100213905 3300006846 Bacteria 1599
47 Ga0075431_100019700 3300006847 Bacteria 6884
48 Ga0075431_100050256 3300006847 Bacteria 4299
49 Ga0075431_100129626 3300006847 Bacteria 2602
50 Ga0075429_100001092 3300006880 Bacteria 21833
51 Ga0075429_100009214 3300006880 Bacteria 8572
52 Ga0075436_100058601 3300006914 Unclassified 2659
53 Ga0075435_100100344 3300007076 Unclassified 2398
54 Ga0111539_10092137 3300009094 Bacteria 3561
55 Ga0105245_10012207 3300009098 Bacteria 7473
56 Ga0105247_10030312 3300009101 Archaea 3278
57 Ga0114129_10000988 3300009147 Bacteria 37163
58 Ga0114129_10007525 3300009147 Bacteria 15515
59 Ga0114129_10363475 3300009147 Bacteria 1914
60 Ga0105241_10192466 3300009174 Archaea 1699
61 Ga0105242_10049237 3300009176 Bacteria 3428
62 Ga0105237_10305870 3300009545 Unclassified 1593
63 Ga0105246_10003251 3300011119 Archaea 9859
64 Ga0157374_10111521 3300013296 Archaea 2631
65 Ga0157378_10054941 3300013297 Archaea 3547
66 Ga0157378_10062948 3300013297 Bacteria 3314
67 Ga0157375_10092034 3300013308 Bacteria 3095
68 Ga0157377_10096858 3300014745 Archaea 1751
69 Ga0157376_10256766 3300014969 Bacteria 1635
70 Ga0207692_10059923 3300025898 Archaea 1967
71 Ga0207699_10018016 3300025906 Archaea 3733
72 Ga0207684_10012602 3300025910 Bacteria 7349
73 Ga0207654_10159620 3300025911 Archaea 1455
74 Ga0207707_10191185 3300025912 Bacteria 1786
75 Ga0207693_10000665 3300025915 Archaea 30918
76 Ga0207663_10002200 3300025916 Archaea 9324
77 Ga0207646_10009330 3300025922 Bacteria 9702
78 Ga0207646_10011106 3300025922 Archaea 8743
79 Ga0207646_10043149 3300025922 Bacteria 4051
80 Ga0207687_10004169 3300025927 Bacteria 9681
81 Ga0207687_10410880 3300025927 Bacteria 1115
82 Ga0207664_10131817 3300025929 Archaea 2104
83 Ga0207644_10403563 3300025931 Bacteria 1118
84 Ga0207690_10138275 3300025932 Bacteria 1792
85 Ga0207686_10100949 3300025934 Bacteria 1926
86 Ga0207665_10000379 3300025939 Archaea 30624
87 Ga0207665_10008245 3300025939 Archaea 6877
88 Ga0207665_10127900 3300025939 Bacteria 1800
89 Ga0207661_10193166 3300025944 Unclassified 1786
90 Ga0207677_10005510 3300026023 Archaea 6876
91 Ga0207639_10310984 3300026041 Bacteria 1395
92 Ga0207702_10082491 3300026078 Archaea 2795
93 Ga0207683_10124239 3300026121 Bacteria 2318
94 Ga0307515_10032923 3300028794 Bacteria 8559
95 Ga0307513_10012995 3300031456 Bacteria 10240
96 Ga0307408_100056624 3300031548 Bacteria 2844
97 Ga0307516_10110717 3300031730 Bacteria 2549
98 Ga0307413_10074336 3300031824 Bacteria 2152
99 Ga0307413_10135787 3300031824 Bacteria 1691
100 Ga0307410_10015461 3300031852 Bacteria 4528
101 Ga0307410_10143130 3300031852 Bacteria 1771
102 Ga0307406_10016257 3300031901 Bacteria 4321
103 Ga0307407_10002817 3300031903 Bacteria 6944
104 Ga0307409_100004129 3300031995 Bacteria 8079
105 Ga0307409_100004732 3300031995 Bacteria 7709
106 Ga0307416_100007634 3300032002 Bacteria 6901
107 Ga0307416_100049656 3300032002 Bacteria 3338
108 Ga0307411_10006249 3300032005 Bacteria 5940
109 Ga0307415_100093206 3300032126 Bacteria 2186
110 Ga0307507_10061806 3300033179 Bacteria 3485
111 Ga0373923_0007258 3300035111 Archaea 3888
112 Ga0373953_0000229 3300035117 Archaea 15460
113 Ga0373954_0005437 3300035118 Archaea 5511
114 Ga0373957_0001442 3300035120 Archaea 6437
115 Ga0373955_0000273 3300035172 Archaea 21545
116 Ga0373935_0012106 3300035692 Bacteria 5188
117 Ga0373935_0130322 3300035692 Archaea 1689
118 Ga0373933_0000667 3300035724 Archaea 21248
119 Ga0373937_0000481 3300036401 Archaea 36562
120 Ga0373937_0044836 3300036401 Bacteria 4040
121 Ga0373925_0075910 3300037068 Archaea 2548
122 Ga0395900_0003124 3300037418 Bacteria 17982
123 Ga0395898_0003058 3300037466 Bacteria 18956
124 Ga0395905_0003289 3300037471 Bacteria 17361
125 Ga0395901_0013737 3300038443 Bacteria 8229
126 Ga0436360_1040276 3300039438 Bacteria 1641
127 Ga0436360_1311242 3300039438 Bacteria 3845
128 Ga0436361_0784781 3300039447 Bacteria 1399
129 Ga0436362_0227983 3300039453 Bacteria 2743
130 Ga0436362_1192036 3300039453 Bacteria 8755
131 Ga0439439_0005832 3300041406 Bacteria 2831
132 Ga0451577_0012134 3300042876 Bacteria 8105
133 Ga0466966_0046927 3300044684 Bacteria 2756
134 Ga0453684_0022104 3300044712 Bacteria 9459
135 Ga0466970_0007200 3300044765 Bacteria 5572
136 Ga0466957_0037521 3300044842 Bacteria 2918
137 Ga0466960_0026133 3300044901 Bacteria 2649
138 Ga0466959_0231765 3300045049 Bacteria 1278
139 Ga0466967_0292122 3300045976 Unclassified 1566
140 Ga0495592_0004373 3300046454 Archaea 10336
141 Ga0495629_0094187 3300046459 Bacteria 2090
142 Ga0495651_0000904 3300046462 Archaea 23013
143 Ga0495653_0061525 3300046463 Archaea 2841
144 Ga0495653_0101436 3300046463 Bacteria 2085
145 Ga0495664_0046340 3300046477 Archaea 2580
146 Ga0495628_0013826 3300046516 Archaea 6782
147 Ga0495652_0000822 3300046529 Bacteria 35715
148 Ga0495652_0175499 3300046529 Bacteria 1650
149 Ga0495640_0201553 3300046533 Archaea 1261
150 Ga0495587_0006052 3300046536 Archaea 7891
151 Ga0495645_0061656 3300046543 Archaea 2717
152 Ga0495667_0019272 3300046559 Archaea 4604
153 Ga0495635_0095953 3300046663 Archaea 2027
154 Ga0495657_0025570 3300046675 Bacteria 4191
155 Ga0495599_0024866 3300046678 Archaea 3745
156 Ga0495623_0016762 3300046679 Archaea 4734
157 Ga0495646_0109886 3300046680 Archaea 1571
158 Ga0495647_0030747 3300046681 Bacteria 1994
159 Ga0495600_0158055 3300046809 Archaea 1466
160 Ga0495604_0029056 3300047317 Archaea 4400
161 Ga0495674_0169487 3300047319 Bacteria 1823
162 Ga0495684_0156025 3300047471 Bacteria 1705
163 Ga0495602_0001858 3300048088 Archaea 21149
164 Ga0495614_0090951 3300048089 Bacteria 1327
165 Ga0496101_0139028 3300048904 Unclassified 1850
166 Ga0496102_0093457 3300048905 Archaea 2786
167 Ga0496103_0125629 3300048906 Unclassified 1636
168 Ga0496104_0107459 3300048907 Archaea 2674
169 Ga0496107_0143177 3300048910 Unclassified 1767
170 Ga0496108_0306496 3300048911 Unclassified 1384
171 Ga0496108_0327392 3300048911 Bacteria 1336
172 Ga0496109_0254574 3300048912 Unclassified 1653
173 Ga0496110_0034620 3300048913 Archaea 4376
174 Ga0496111_0031415 3300048914 Bacteria 3783
175 Ga0496112_0554895 3300048915 Unclassified 1082
176 Ga0496115_0207135 3300048918 Archaea 1620
177 Ga0501034_0028956 3300049571 Bacteria 5632
178 Ga0501036_0159421 3300049572 Bacteria 1903
179 Ga0501037_0068470 3300049573 Bacteria 2584
180 Ga0501039_0023893 3300049575 Bacteria 4693
181 Ga0501042_0043356 3300049578 Bacteria 3204
182 Ga0501043_0037837 3300049579 Bacteria 3795
183 Ga0501046_0120303 3300049580 Bacteria 1998
184 Ga0501047_0009770 3300049581 Bacteria 9068
185 Ga0501048_0011610 3300049582 Bacteria 6569
186 Ga0501073_0035608 3300049589 Bacteria 3537
187 Ga0501074_0001506 3300049590 Bacteria 15714
188 Ga0501081_0226151 3300049743 Bacteria 1362
189 Ga0501044_0024798 3300049823 Bacteria 6362
190 Ga0501044_0308961 3300049823 Bacteria 1508
191 nmdc:mga05p37_1362_c1 3300050507 Bacteria 21254
192 nmdc:mga05p37_259501_c1 3300050507 Bacteria 2080
193 nmdc:mga09592_72_c1 3300050508 Bacteria 56957
194 nmdc:mga09592_79273_c1 3300050508 Bacteria 2796
195 nmdc:mga0qj67_204082_c1 3300050509 Bacteria 1606
196 nmdc:mga0qj67_48_c1 3300050509 Bacteria 85487
197 nmdc:mga0qj67_51244_c1 3300050509 Bacteria 3264
198 nmdc:mga06r32_436_c1 3300050510 Bacteria 35325
199 nmdc:mga06r32_64849_c1 3300050510 Bacteria 3523
200 nmdc:mga0rr50_149183_c1 3300050513 Unclassified 1888
201 nmdc:mga08x19_163895_c1 3300050514 Archaea 1511
202 Ga0495595_0020249 3300053084 Bacteria 2895
203 Ga0495619_0001630 3300053085 Archaea 14787
204 Ga0495619_0017333 3300053085 Bacteria 4561
205 Ga0500650_0054379 3300053098 Bacteria 1864
206 Ga0501082_0159376 3300060353 Bacteria 1961
207 2501940400 2501939600 Bacteria 6907073
208 2623591609 2622736626 Bacteria 7181580
209 2772645809 2772190715 Bacteria 6959372
210 2855670518 2855670206 Bacteria 7120389
211 2855682085 2855676851 Bacteria 7063653
212 2855688054 2855683550 Bacteria 7134265
213 2856858662 2856858025 Bacteria 7255264
214 2857288864 2857288857 Bacteria 7189066
215 2858854308 2858848962 Bacteria 6963058
216 2858869469 2858868258 Bacteria 7683772
217 2858887289 2858882152 Bacteria 7230291
218 2858893847 2858888857 Bacteria 7060307
219 2858898473 2858895516 Bacteria 7378898
220 2858903134 2858902515 Bacteria 7086037
221 2861526326 2861520306 Bacteria 8348283
222 2869049192 2869048445 Bacteria 6875584
223 2869061944 2869061728 Bacteria 7112407
224 2869070502 2869068681 Bacteria 7205615
225 2880495477 2880489317 Bacteria 7096270
226 2880496879 2880495981 Bacteria 7340502
227 2902583803 2902582711 Bacteria 6187705
228 2912721119 2912715099 Bacteria 9460473
229 2929225498 2929219909 Bacteria 6984360
230 2929231524 2929226422 Bacteria 7248583
231 2996223925 2996221748 Bacteria 6799777
232 3003005102 3002998708 Bacteria 11715108
233 649813156 649633069 Bacteria 6962533
234 8003831175 8003830390 Bacteria 6541657
235 8003863601 8003856774 Bacteria 7675274
236 8003874352 8003870546 Bacteria 7396674
237 8053946208 8053945823 Bacteria 8962862
238 8054704435 8054704163 Bacteria 7247792
239 8054734460 8054727385 Bacteria 7558670
240 8054740224 8054734606 Bacteria 6947278
241 8055413868 8055412473 Bacteria 6257500
242 8057569311 8057568493 Bacteria 7221719
243 Ga0395899_0001675
244 Ga0070683_100145498
245 Ga0070682_100142897
246 Ga0068868_100027587
247 Ga0070687_100198668
248 Ga0070703_10047507
249 Ga0070709_10001916
250 Ga0070710_10103344
251 Ga0070711_100002098
252 Ga0070711_100087824
253 Ga0070705_100077647
254 Ga0070708_100053502
255 Ga0070708_100087994
256 Ga0070681_10025898
257 Ga0070681_10071748
258 Ga0070681_10085868
259 Ga0070706_100244145
260 Ga0070707_100006274
261 Ga0070707_100246817
262 Ga0070698_100271879
263 Ga0070698_100476591
264 Ga0070699_100046115
265 Ga0070679_100370146
266 Ga0070684_100026702
267 Ga0070695_100026327
268 Ga0070695_100033177
269 Ga0070695_100146266
270 Ga0070693_100104788
271 Ga0070704_100016797
272 Ga0070664_100164463
273 Ga0081455_10215127
274 Ga0081540_1015326
275 Ga0081539_10006184
276 Ga0081539_10007384
277 Ga0081539_10027602
278 Ga0081539_10091600
279 Ga0070717_10054644
280 Ga0070715_10019062
281 Ga0070716_100000574
282 Ga0070716_100006841
283 Ga0070712_100000573
284 Ga0075428_100000728
285 Ga0075430_100002599
286 Ga0075430_100068942
287 Ga0075430_100083482
288 Ga0075430_100213905
289 Ga0075431_100019700
290 Ga0075431_100050256
291 Ga0075431_100129626
292 Ga0075429_100001092
293 Ga0075429_100009214
294 Ga0075436_100058601
295 Ga0075435_100100344
296 Ga0111539_10092137
297 Ga0105245_10012207
298 Ga0105247_10030312
299 Ga0114129_10000988
300 Ga0114129_10007525
301 Ga0114129_10363475
302 Ga0105241_10192466
303 Ga0105242_10049237
304 Ga0105237_10305870
305 Ga0105246_10003251
306 Ga0157374_10111521
307 Ga0157378_10054941
308 Ga0157378_10062948
309 Ga0157375_10092034
310 Ga0157377_10096858
311 Ga0157376_10256766
312 Ga0207692_10059923
313 Ga0207699_10018016
314 Ga0207684_10012602
315 Ga0207654_10159620
316 Ga0207707_10191185
317 Ga0207693_10000665
318 Ga0207663_10002200
319 Ga0207646_10009330
320 Ga0207646_10011106
321 Ga0207646_10043149
322 Ga0207687_10004169
323 Ga0207687_10410880
324 Ga0207664_10131817
325 Ga0207644_10403563
326 Ga0207690_10138275
327 Ga0207686_10100949
328 Ga0207665_10000379
329 Ga0207665_10008245
330 Ga0207665_10127900
331 Ga0207661_10193166
332 Ga0207677_10005510
333 Ga0207639_10310984
334 Ga0207702_10082491
335 Ga0207683_10124239
336 Ga0307515_10032923
337 Ga0307513_10012995
338 Ga0307408_100056624
339 Ga0307516_10110717
340 Ga0307413_10074336
341 Ga0307413_10135787
342 Ga0307410_10015461
343 Ga0307410_10143130
344 Ga0307406_10016257
345 Ga0307407_10002817
346 Ga0307409_100004129
347 Ga0307409_100004732
348 Ga0307416_100007634
349 Ga0307416_100049656
350 Ga0307411_10006249
351 Ga0307415_100093206
352 Ga0307507_10061806
353 Ga0373923_0007258
354 Ga0373953_0000229
355 Ga0373954_0005437
356 Ga0373957_0001442
357 Ga0373955_0000273
358 Ga0373935_0012106
359 Ga0373935_0130322
360 Ga0373933_0000667
361 Ga0373937_0000481
362 Ga0373937_0044836
363 Ga0373925_0075910
364 Ga0395900_0003124
365 Ga0395898_0003058
366 Ga0395905_0003289
367 Ga0395901_0013737
368 Ga0436360_1040276
369 Ga0436360_1311242
370 Ga0436361_0784781
371 Ga0436362_0227983
372 Ga0436362_1192036
373 Ga0439439_0005832
374 Ga0451577_0012134
375 Ga0466966_0046927
376 Ga0453684_0022104
377 Ga0466970_0007200
378 Ga0466957_0037521
379 Ga0466960_0026133
380 Ga0466959_0231765
381 Ga0466967_0292122
382 Ga0495592_0004373
383 Ga0495629_0094187
384 Ga0495651_0000904
385 Ga0495653_0061525
386 Ga0495653_0101436
387 Ga0495664_0046340
388 Ga0495628_0013826
389 Ga0495652_0000822
390 Ga0495652_0175499
391 Ga0495640_0201553
392 Ga0495587_0006052
393 Ga0495645_0061656
394 Ga0495667_0019272
395 Ga0495635_0095953
396 Ga0495657_0025570
397 Ga0495599_0024866
398 Ga0495623_0016762
399 Ga0495646_0109886
400 Ga0495647_0030747
401 Ga0495600_0158055
402 Ga0495604_0029056
403 Ga0495674_0169487
404 Ga0495684_0156025
405 Ga0495602_0001858
406 Ga0495614_0090951
407 Ga0496101_0139028
408 Ga0496102_0093457
409 Ga0496103_0125629
410 Ga0496104_0107459
411 Ga0496107_0143177
412 Ga0496108_0306496
413 Ga0496108_0327392
414 Ga0496109_0254574
415 Ga0496110_0034620
416 Ga0496111_0031415
417 Ga0496112_0554895
418 Ga0496115_0207135
419 Ga0501034_0028956
420 Ga0501036_0159421
421 Ga0501037_0068470
422 Ga0501039_0023893
423 Ga0501042_0043356
424 Ga0501043_0037837
425 Ga0501046_0120303
426 Ga0501047_0009770
427 Ga0501048_0011610
428 Ga0501073_0035608
429 Ga0501074_0001506
430 Ga0501081_0226151
431 Ga0501044_0024798
432 Ga0501044_0308961
433 nmdc:mga05p37_1362_c1
434 nmdc:mga05p37_259501_c1
435 nmdc:mga09592_72_c1
436 nmdc:mga09592_79273_c1
437 nmdc:mga0qj67_204082_c1
438 nmdc:mga0qj67_48_c1
439 nmdc:mga0qj67_51244_c1
440 nmdc:mga06r32_436_c1
441 nmdc:mga06r32_64849_c1
442 nmdc:mga0rr50_149183_c1
443 nmdc:mga08x19_163895_c1
444 Ga0495595_0020249
445 Ga0495619_0001630
446 Ga0495619_0017333
447 Ga0500650_0054379
448 Ga0501082_0159376
449 2501940400
450 2623591609
451 2772645809
452 2855670518
453 2855682085
454 2855688054
455 2856858662
456 2857288864
457 2858854308
458 2858869469
459 2858887289
460 2858893847
461 2858898473
462 2858903134
463 2861526326
464 2869049192
465 2869061944
466 2869070502
467 2880495477
468 2880496879
469 2902583803
470 2912721119
471 2929225498
472 2929231524
473 2996223925
474 3003005102
475 649813156
476 8003831175
477 8003863601
478 8003874352
479 8053946208
480 8054704435
481 8054734460
482 8054740224
483 8055413868
484 8057569311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

57

301

0.92

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

86

311

0.81

PF09084

NMT1

NMT1/THI5 like

71

292

0.79

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

62

302

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8542 26 319
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8469 29 329
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8394 26 314
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.835 28 311
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.831 29 311
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8838 112 215 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8679 112 215 3.40.190.10
3e4rA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8667 24 108 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.828 115 220 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8249 114 215 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V5VXH0-F1-model_v4 Aliphatic sulfonates ABC transporter substrate-binding protein 0.9886 74 343
AF-A0A535P9F1-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9849 130 343
AF-A0A535EWR0-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9801 163 343
AF-A0A533WT69-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9796 143 343
AF-A0A2V5VXH0-F1-model_v4 Aliphatic sulfonates ABC transporter substrate-binding protein 0.9777 74 343

Map