F354718

General Info

Members Datasets Scaffolds Average Seq Length
242 147 484 190

Family's Representative Sequence

Representative Sequence 3300025299|Ga0209256_1025823|Ga0209256_10258233
Length 206
Sequence MQINLAAANKKSDKAVELSDNVFSNYFNESLVHQVVTAYMAKARSGNHAQKNRAAVSGGGKKPWRQKGTGRARAGTTRSPIWRKGGVTFAAQPQDYSQKVNRKMYQGAMRSILSELLRQERLIVVDNFAVSAPKTKELLDKFKELNINNDVLVVTDSVDENLFLAARNLPKVDVVDVAAADPVSLIGFDKVLITLPAIKQFEEMLA

Samples

Sample ID Description Type Environment
1 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
98 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
99 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
100 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
101 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
102 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
103 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
104 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
105 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
108 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
109 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
110 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
146 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
147 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.71
Metatranscriptomes 14.05
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 0
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209256_1025823 3300025299 Bacteria 1705
2 rootH1_10060094 3300003323 Bacteria 5417
3 JGI26141J51220_1002702 3300003503 Bacteria 1082
4 Ga0007410J51695_1019754 3300003574 Bacteria 6630
5 Ga0070676_10007412 3300005328 Bacteria 5889
6 Ga0070670_100000015 3300005331 Bacteria 228819
7 Ga0068869_100042588 3300005334 Bacteria 3256
8 Ga0070680_100073142 3300005336 Bacteria 2818
9 Ga0070682_100087381 3300005337 Bacteria 2032
10 Ga0070675_100245605 3300005354 Bacteria 1565
11 Ga0070674_100013931 3300005356 Bacteria 4985
12 Ga0070667_100593195 3300005367 Bacteria 1020
13 Ga0070714_100013986 3300005435 Bacteria 6439
14 Ga0070714_100127768 3300005435 Bacteria 2268
15 Ga0070713_100379375 3300005436 Bacteria 1317
16 Ga0070711_100011694 3300005439 Bacteria 5457
17 Ga0070711_100274436 3300005439 Bacteria 1332
18 Ga0070700_100150466 3300005441 Bacteria 1591
19 Ga0070694_100272166 3300005444 Bacteria 1288
20 Ga0070678_100282957 3300005456 Bacteria 1403
21 Ga0070662_100015089 3300005457 Bacteria 5168
22 Ga0068867_100012134 3300005459 Bacteria 6086
23 Ga0068867_100462052 3300005459 Bacteria 1084
24 Ga0070672_100008185 3300005543 Bacteria 7145
25 Ga0070696_100058420 3300005546 Bacteria 2693
26 Ga0070696_100071798 3300005546 Bacteria 2436
27 Ga0070696_100392305 3300005546 Bacteria 1084
28 Ga0070704_100422042 3300005549 Bacteria 1142
29 Ga0068857_100072632 3300005577 Bacteria 3066
30 Ga0068854_100524380 3300005578 Bacteria 1001
31 Ga0068859_100139526 3300005617 Bacteria 2497
32 Ga0068866_10010214 3300005718 Bacteria 4016
33 Ga0068861_100022361 3300005719 Bacteria 4554
34 Ga0068861_100033032 3300005719 Bacteria 3814
35 Ga0068862_100020857 3300005844 Bacteria 5473
36 Ga0070712_100752786 3300006175 Bacteria 834
37 Ga0075366_10043538 3300006195 Bacteria 2659
38 Ga0075428_100014893 3300006844 Bacteria 8641
39 Ga0075428_100026846 3300006844 Bacteria 6376
40 Ga0075428_100123726 3300006844 Bacteria 2815
41 Ga0075430_100070749 3300006846 Bacteria 2926
42 Ga0075433_10093932 3300006852 Bacteria 2654
43 Ga0075429_100096373 3300006880 Bacteria 2581
44 Ga0068865_100004766 3300006881 Bacteria 8203
45 Ga0068865_100203924 3300006881 Bacteria 1537
46 Ga0097620_100139528 3300006931 Bacteria 2497
47 Ga0075435_100191575 3300007076 Bacteria 1731
48 Ga0111539_10068055 3300009094 Bacteria 4204
49 Ga0111539_10622483 3300009094 Bacteria 1257
50 Ga0111539_10844963 3300009094 Bacteria 1065
51 Ga0114129_10181072 3300009147 Bacteria 2867
52 Ga0105243_10120343 3300009148 Bacteria 2212
53 Ga0157380_10164453 3300014326 Bacteria 1932
54 Ga0157380_10415684 3300014326 Bacteria 1281
55 Ga0213876_10025974 3300021384 Bacteria 3089
56 Ga0207682_10031777 3300025893 Bacteria 2120
57 Ga0207642_10104940 3300025899 Bacteria 1427
58 Ga0207699_10252218 3300025906 Bacteria 1216
59 Ga0207645_10010238 3300025907 Bacteria 6445
60 Ga0207693_10183835 3300025915 Bacteria 1645
61 Ga0207663_10127008 3300025916 Bacteria 1756
62 Ga0207660_10158516 3300025917 Bacteria 1744
63 Ga0207700_10224790 3300025928 Bacteria 1593
64 Ga0207664_10021065 3300025929 Bacteria 4840
65 Ga0207664_10051858 3300025929 Bacteria 3242
66 Ga0207664_10818998 3300025929 Bacteria 837
67 Ga0207706_10003877 3300025933 Bacteria 14227
68 Ga0207669_10031454 3300025937 Bacteria 2965
69 Ga0207691_10020921 3300025940 Bacteria 6182
70 Ga0207689_10120932 3300025942 Bacteria 2154
71 Ga0207708_10015186 3300026075 Bacteria 5772
72 Ga0207648_10000313 3300026089 Bacteria 53237
73 Ga0207648_10098266 3300026089 Bacteria 2563
74 Ga0207675_100012427 3300026118 Bacteria 7956
75 Ga0207675_100012828 3300026118 Bacteria 7828
76 Ga0207683_10130802 3300026121 Bacteria 2257
77 Ga0207683_10224402 3300026121 Bacteria 1712
78 Ga0209984_1010755 3300027424 Bacteria 1179
79 Ga0209970_1002321 3300027614 Bacteria 3248
80 Ga0210002_1000845 3300027617 Bacteria 4181
81 Ga0209983_1001121 3300027665 Bacteria 5913
82 Ga0209971_1000853 3300027682 Bacteria 7855
83 Ga0209966_1003250 3300027695 Bacteria 2732
84 Ga0209966_1003514 3300027695 Bacteria 2639
85 Ga0209974_10000548 3300027876 Bacteria 12544
86 Ga0207428_10034422 3300027907 Bacteria 4151
87 Ga0207428_10056726 3300027907 Bacteria 3111
88 Ga0207428_10179517 3300027907 Bacteria 1600
89 Ga0268265_10056930 3300028380 Bacteria 2977
90 Ga0265334_10000005 3300028573 Bacteria 242590
91 Ga0265318_10086108 3300028577 Bacteria 1158
92 Ga0265336_10010889 3300028666 Bacteria 3103
93 Ga0265338_10006324 3300028800 Bacteria 15135
94 Ga0265331_10038283 3300031250 Bacteria 2345
95 Ga0265327_10003993 3300031251 Bacteria 13449
96 Ga0265327_10046965 3300031251 Bacteria 2281
97 Ga0307408_100088152 3300031548 Bacteria 2336
98 Ga0265313_10000014 3300031595 Bacteria 156295
99 Ga0316576_10160654 3300031727 Bacteria 1695
100 Ga0316578_10015240 3300031728 Bacteria 4129
101 Ga0316578_10068019 3300031728 Bacteria 2106
102 Ga0316577_10007369 3300031733 Bacteria 5868
103 Ga0316577_10010745 3300031733 Bacteria 4947
104 Ga0316577_10202018 3300031733 Bacteria 1123
105 Ga0307413_10065924 3300031824 Bacteria 2257
106 Ga0307406_10015233 3300031901 Bacteria 4444
107 Ga0307406_10311494 3300031901 Bacteria 1214
108 Ga0307416_100355107 3300032002 Bacteria 1485
109 Ga0316585_10005145 3300032137 Bacteria 3682
110 Ga0316593_10000027 3300032168 Bacteria 15426
111 Ga0316593_10002148 3300032168 Bacteria 4599
112 Ga0316593_10003055 3300032168 Bacteria 4085
113 Ga0316593_10004139 3300032168 Bacteria 3687
114 Ga0316593_10005483 3300032168 Bacteria 3351
115 Ga0316593_10014042 3300032168 Bacteria 2382
116 Ga0316593_10019240 3300032168 Bacteria 2108
117 Ga0316593_10021714 3300032168 Bacteria 2009
118 Ga0316593_10026472 3300032168 Bacteria 1855
119 Ga0316593_10047315 3300032168 Bacteria 1446
120 Ga0316593_10074691 3300032168 Bacteria 1176
121 Ga0316593_10086368 3300032168 Bacteria 1100
122 Ga0316592_1000006 3300033524 Bacteria 14706
123 Ga0316592_1000008 3300033524 Bacteria 14268
124 Ga0316592_1010499 3300033524 Bacteria 1870
125 Ga0316586_1000040 3300033527 Bacteria 8841
126 Ga0316586_1016579 3300033527 Bacteria 1182
127 Ga0316588_1001236 3300033528 Bacteria 4108
128 Ga0316588_1002254 3300033528 Bacteria 3344
129 Ga0316587_1000021 3300033529 Bacteria 9386
130 Ga0316587_1002879 3300033529 Bacteria 2350
131 Ga0316587_1004289 3300033529 Bacteria 2066
132 Ga0316587_1017228 3300033529 Bacteria 1210
133 Ga0316596_1000016 3300033541 Bacteria 15149
134 Ga0316596_1001024 3300033541 Bacteria 5392
135 Ga0316596_1001141 3300033541 Bacteria 5193
136 Ga0316596_1002852 3300033541 Bacteria 3738
137 Ga0316596_1002958 3300033541 Bacteria 3687
138 Ga0316596_1008222 3300033541 Bacteria 2482
139 Ga0316596_1024647 3300033541 Bacteria 1545
140 Ga0373945_0287380 3300035116 Bacteria 702
141 Ga0373954_0078373 3300035118 Bacteria 1576
142 Ga0316574_0137715 3300035398 Bacteria 1572
143 Ga0316574_0151887 3300035398 Bacteria 1492
144 Ga0373927_0000001 3300035695 Bacteria 1082160
145 Ga0316582_0206705 3300036647 Bacteria 1340
146 Ga0316584_0002043 3300036712 Bacteria 12624
147 Ga0316584_0021671 3300036712 Bacteria 4674
148 Ga0316584_0128575 3300036712 Bacteria 1892
149 Ga0316584_0857121 3300036712 Bacteria 614
150 Ga0316581_0001208 3300037588 Bacteria 5686
151 Ga0400484_24395 3300038725 Bacteria 3066
152 Ga0400484_25426 3300038725 Bacteria 1914
153 Ga0400484_30405 3300038725 Bacteria 18960
154 Ga0400490_00437 3300038726 Bacteria 17578
155 Ga0400490_07361 3300038726 Bacteria 19331
156 Ga0400490_39901 3300038726 Bacteria 15663
157 Ga0400485_02770 3300038735 Bacteria 7937
158 Ga0400485_03111 3300038735 Bacteria 2616
159 Ga0400485_19181 3300038735 Bacteria 55141
160 Ga0400488_03437 3300038741 Bacteria 8596
161 Ga0400488_25285 3300038741 Bacteria 2477
162 Ga0400488_25665 3300038741 Bacteria 1183
163 Ga0400488_39380 3300038741 Bacteria 1223
164 Ga0400488_57964 3300038741 Bacteria 3039
165 Ga0400488_58342 3300038741 Bacteria 2007
166 Ga0400486_24759 3300038742 Bacteria 1650
167 Ga0400486_25543 3300038742 Bacteria 57720
168 Ga0400486_25694 3300038742 Bacteria 15655
169 Ga0400486_26796 3300038742 Bacteria 4631
170 Ga0400483_029392 3300039062 Bacteria 3206
171 Ga0400483_057945 3300039062 Bacteria 4128
172 Ga0400483_069247 3300039062 Bacteria 1821
173 Ga0400483_140144 3300039062 Bacteria 16717
174 Ga0400483_141649 3300039062 Bacteria 8613
175 Ga0400483_173686 3300039062 Bacteria 2576
176 Ga0400483_224990 3300039062 Bacteria 1482
177 Ga0400483_243923 3300039062 Bacteria 2592
178 Ga0400489_34148 3300039093 Bacteria 5617
179 Ga0400487_02246 3300039110 Bacteria 22294
180 Ga0400487_25190 3300039110 Bacteria 4609
181 Ga0400487_28799 3300039110 Bacteria 1410
182 Ga0400487_29008 3300039110 Bacteria 14273
183 Ga0400487_33622 3300039110 Bacteria 1579
184 Ga0400487_66163 3300039110 Bacteria 6500
185 Ga0436365_1680067 3300039437 Bacteria 3128
186 Ga0439451_046025 3300042009 Bacteria 874
187 Ga0450923_021157 3300042125 Bacteria 1266
188 Ga0450891_001604 3300042129 Bacteria 2329
189 Ga0450905_029005 3300042142 Bacteria 846
190 Ga0439435_0050897 3300042436 Bacteria 1185
191 Ga0439464_0045474 3300042439 Bacteria 1260
192 Ga0450893_0037086 3300042532 Unclassified 883
193 Ga0495630_0006403 3300046517 Bacteria 8376
194 Ga0501306_000035 3300049127 Bacteria 7508
195 Ga0501315_000686 3300049531 Bacteria 2491
196 Ga0501032_0430495 3300049569 Bacteria 846
197 Ga0501034_0075626 3300049571 Bacteria 3374
198 Ga0501036_0081358 3300049572 Bacteria 2737
199 Ga0501037_0321782 3300049573 Bacteria 1071
200 Ga0501040_0284222 3300049576 Bacteria 1182
201 Ga0501040_0392027 3300049576 Bacteria 997
202 Ga0501040_0479683 3300049576 Bacteria 896
203 Ga0501041_0117755 3300049577 Bacteria 1650
204 Ga0501042_0108368 3300049578 Bacteria 2000
205 Ga0501042_0125025 3300049578 Bacteria 1852
206 Ga0501042_0165490 3300049578 Bacteria 1596
207 Ga0501042_0166992 3300049578 Bacteria 1588
208 Ga0501046_0090108 3300049580 Bacteria 2360
209 Ga0501071_0021715 3300049587 Bacteria 4474
210 Ga0501071_0122185 3300049587 Bacteria 1931
211 Ga0501071_0331548 3300049587 Bacteria 1157
212 Ga0501072_0028264 3300049588 Bacteria 4378
213 Ga0501074_0099317 3300049590 Bacteria 2084
214 Ga0501075_0058424 3300049591 Bacteria 2905
215 Ga0501075_0361263 3300049591 Bacteria 1107
216 Ga0501076_0096937 3300049592 Bacteria 2376
217 Ga0501076_0175591 3300049592 Bacteria 1746
218 Ga0501079_0080331 3300049741 Bacteria 2522
219 Ga0501079_0318259 3300049741 Bacteria 1218
220 Ga0501081_0395853 3300049743 Bacteria 1022
221 Ga0501045_0536779 3300049824 Bacteria 868
222 Ga0501226_032628 3300049853 Bacteria 594
223 nmdc:mga03n38_745387_c1 3300050490 Bacteria 567
224 nmdc:mga0k408_11178_c2 3300050493 Bacteria 3273
225 nmdc:mga05p37_270114_c1 3300050507 Bacteria 2032
226 nmdc:mga09592_102822_c1 3300050508 Bacteria 2448
227 nmdc:mga09592_296174_c1 3300050508 Bacteria 1403
228 nmdc:mga06r32_24034_c1 3300050510 Bacteria 5650
229 nmdc:mga06r32_381841_c1 3300050510 Bacteria 1392
230 nmdc:mga08y16_15367_c1 3300050511 Bacteria 8050
231 nmdc:mga08y16_215981_c1 3300050511 Bacteria 1986
232 nmdc:mga08y16_54932_c1 3300050511 Bacteria 4162
233 nmdc:mga08y16_69402_c1 3300050511 Bacteria 3674
234 nmdc:mga0rr50_174995_c1 3300050513 Bacteria 1751
235 nmdc:mga0a205_71944_c1 3300050515 Bacteria 3340
236 Ga0500562_045216 3300053108 Bacteria 1173
237 Ga0587111_0009586 3300060346 Bacteria 1638
238 Ga0501082_0666378 3300060353 Bacteria 911
239 Ga0501082_0893036 3300060353 Bacteria 777
240 2738716718 2738541276 Bacteria 4690596
241 8001524062 8001522603 Bacteria 4726425
242 8054359132 8054357960 Bacteria 2867777
243 Ga0209256_1025823
244 rootH1_10060094
245 JGI26141J51220_1002702
246 Ga0007410J51695_1019754
247 Ga0070676_10007412
248 Ga0070670_100000015
249 Ga0068869_100042588
250 Ga0070680_100073142
251 Ga0070682_100087381
252 Ga0070675_100245605
253 Ga0070674_100013931
254 Ga0070667_100593195
255 Ga0070714_100013986
256 Ga0070714_100127768
257 Ga0070713_100379375
258 Ga0070711_100011694
259 Ga0070711_100274436
260 Ga0070700_100150466
261 Ga0070694_100272166
262 Ga0070678_100282957
263 Ga0070662_100015089
264 Ga0068867_100012134
265 Ga0068867_100462052
266 Ga0070672_100008185
267 Ga0070696_100058420
268 Ga0070696_100071798
269 Ga0070696_100392305
270 Ga0070704_100422042
271 Ga0068857_100072632
272 Ga0068854_100524380
273 Ga0068859_100139526
274 Ga0068866_10010214
275 Ga0068861_100022361
276 Ga0068861_100033032
277 Ga0068862_100020857
278 Ga0070712_100752786
279 Ga0075366_10043538
280 Ga0075428_100014893
281 Ga0075428_100026846
282 Ga0075428_100123726
283 Ga0075430_100070749
284 Ga0075433_10093932
285 Ga0075429_100096373
286 Ga0068865_100004766
287 Ga0068865_100203924
288 Ga0097620_100139528
289 Ga0075435_100191575
290 Ga0111539_10068055
291 Ga0111539_10622483
292 Ga0111539_10844963
293 Ga0114129_10181072
294 Ga0105243_10120343
295 Ga0157380_10164453
296 Ga0157380_10415684
297 Ga0213876_10025974
298 Ga0207682_10031777
299 Ga0207642_10104940
300 Ga0207699_10252218
301 Ga0207645_10010238
302 Ga0207693_10183835
303 Ga0207663_10127008
304 Ga0207660_10158516
305 Ga0207700_10224790
306 Ga0207664_10021065
307 Ga0207664_10051858
308 Ga0207664_10818998
309 Ga0207706_10003877
310 Ga0207669_10031454
311 Ga0207691_10020921
312 Ga0207689_10120932
313 Ga0207708_10015186
314 Ga0207648_10000313
315 Ga0207648_10098266
316 Ga0207675_100012427
317 Ga0207675_100012828
318 Ga0207683_10130802
319 Ga0207683_10224402
320 Ga0209984_1010755
321 Ga0209970_1002321
322 Ga0210002_1000845
323 Ga0209983_1001121
324 Ga0209971_1000853
325 Ga0209966_1003250
326 Ga0209966_1003514
327 Ga0209974_10000548
328 Ga0207428_10034422
329 Ga0207428_10056726
330 Ga0207428_10179517
331 Ga0268265_10056930
332 Ga0265334_10000005
333 Ga0265318_10086108
334 Ga0265336_10010889
335 Ga0265338_10006324
336 Ga0265331_10038283
337 Ga0265327_10003993
338 Ga0265327_10046965
339 Ga0307408_100088152
340 Ga0265313_10000014
341 Ga0316576_10160654
342 Ga0316578_10015240
343 Ga0316578_10068019
344 Ga0316577_10007369
345 Ga0316577_10010745
346 Ga0316577_10202018
347 Ga0307413_10065924
348 Ga0307406_10015233
349 Ga0307406_10311494
350 Ga0307416_100355107
351 Ga0316585_10005145
352 Ga0316593_10000027
353 Ga0316593_10002148
354 Ga0316593_10003055
355 Ga0316593_10004139
356 Ga0316593_10005483
357 Ga0316593_10014042
358 Ga0316593_10019240
359 Ga0316593_10021714
360 Ga0316593_10026472
361 Ga0316593_10047315
362 Ga0316593_10074691
363 Ga0316593_10086368
364 Ga0316592_1000006
365 Ga0316592_1000008
366 Ga0316592_1010499
367 Ga0316586_1000040
368 Ga0316586_1016579
369 Ga0316588_1001236
370 Ga0316588_1002254
371 Ga0316587_1000021
372 Ga0316587_1002879
373 Ga0316587_1004289
374 Ga0316587_1017228
375 Ga0316596_1000016
376 Ga0316596_1001024
377 Ga0316596_1001141
378 Ga0316596_1002852
379 Ga0316596_1002958
380 Ga0316596_1008222
381 Ga0316596_1024647
382 Ga0373945_0287380
383 Ga0373954_0078373
384 Ga0316574_0137715
385 Ga0316574_0151887
386 Ga0373927_0000001
387 Ga0316582_0206705
388 Ga0316584_0002043
389 Ga0316584_0021671
390 Ga0316584_0128575
391 Ga0316584_0857121
392 Ga0316581_0001208
393 Ga0400484_24395
394 Ga0400484_25426
395 Ga0400484_30405
396 Ga0400490_00437
397 Ga0400490_07361
398 Ga0400490_39901
399 Ga0400485_02770
400 Ga0400485_03111
401 Ga0400485_19181
402 Ga0400488_03437
403 Ga0400488_25285
404 Ga0400488_25665
405 Ga0400488_39380
406 Ga0400488_57964
407 Ga0400488_58342
408 Ga0400486_24759
409 Ga0400486_25543
410 Ga0400486_25694
411 Ga0400486_26796
412 Ga0400483_029392
413 Ga0400483_057945
414 Ga0400483_069247
415 Ga0400483_140144
416 Ga0400483_141649
417 Ga0400483_173686
418 Ga0400483_224990
419 Ga0400483_243923
420 Ga0400489_34148
421 Ga0400487_02246
422 Ga0400487_25190
423 Ga0400487_28799
424 Ga0400487_29008
425 Ga0400487_33622
426 Ga0400487_66163
427 Ga0436365_1680067
428 Ga0439451_046025
429 Ga0450923_021157
430 Ga0450891_001604
431 Ga0450905_029005
432 Ga0439435_0050897
433 Ga0439464_0045474
434 Ga0450893_0037086
435 Ga0495630_0006403
436 Ga0501306_000035
437 Ga0501315_000686
438 Ga0501032_0430495
439 Ga0501034_0075626
440 Ga0501036_0081358
441 Ga0501037_0321782
442 Ga0501040_0284222
443 Ga0501040_0392027
444 Ga0501040_0479683
445 Ga0501041_0117755
446 Ga0501042_0108368
447 Ga0501042_0125025
448 Ga0501042_0165490
449 Ga0501042_0166992
450 Ga0501046_0090108
451 Ga0501071_0021715
452 Ga0501071_0122185
453 Ga0501071_0331548
454 Ga0501072_0028264
455 Ga0501074_0099317
456 Ga0501075_0058424
457 Ga0501075_0361263
458 Ga0501076_0096937
459 Ga0501076_0175591
460 Ga0501079_0080331
461 Ga0501079_0318259
462 Ga0501081_0395853
463 Ga0501045_0536779
464 Ga0501226_032628
465 nmdc:mga03n38_745387_c1
466 nmdc:mga0k408_11178_c2
467 nmdc:mga05p37_270114_c1
468 nmdc:mga09592_102822_c1
469 nmdc:mga09592_296174_c1
470 nmdc:mga06r32_24034_c1
471 nmdc:mga06r32_381841_c1
472 nmdc:mga08y16_15367_c1
473 nmdc:mga08y16_215981_c1
474 nmdc:mga08y16_54932_c1
475 nmdc:mga08y16_69402_c1
476 nmdc:mga0rr50_174995_c1
477 nmdc:mga0a205_71944_c1
478 Ga0500562_045216
479 Ga0587111_0009586
480 Ga0501082_0666378
481 Ga0501082_0893036
482 2738716718
483 8001524062
484 8054359132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

204

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9506 7 204
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9498 3 204
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9444 7 204
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9442 1 204
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9436 3 204
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7931 1 204 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7887 1 204 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7565 1 204 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7528 1 204 3.40.1370.10
af_Q54RB5_40_257_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7244 1 203 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A1G5SFL3-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9895 104 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A484Y9P8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9847 126 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2G6KQ82-F1-model_v4 50S ribosomal protein L4 0.9826 127 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9815 99 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A534DYB7-F1-model_v4 deleted 0.9776 120 204

Map