F354560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 176 | 242 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_101213142|Ga0075428_1012131422 |
| Length | 148 |
| Sequence | MFVARGTLVKQSIIHIALVVRDYDEAISFYTEKLHFTLVEDIYQPEQDKRWVVVSPPNANGTTLLLARASKPEQQPFIGNQTGGRVFLFLNTDDFWRDYNEMVSKGIKFVRPPKEESYGLVAVFEDLYGNLWDLLQLNANHPLFERTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 108 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 111 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 112 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 118 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 119 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 126 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 127 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 128 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 129 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 159 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 164 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 166 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 169 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 170 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.7 |
| Nodule | 0.83 |
| Rhizoplane | 0.41 |
| Rhizosphere | 82.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1002488 | 3300002774 | Bacteria | 4563 |
| 2 | JGI25159J45721_1002013 | 3300002987 | Bacteria | 8066 |
| 3 | JGI25151J46595_10009911 | 3300003187 | Bacteria | 4472 |
| 4 | JGI25151J46595_10046811 | 3300003187 | Bacteria | 1511 |
| 5 | JGI25406J46586_10004109 | 3300003203 | Bacteria | 6801 |
| 6 | JGI25153J46596_10041579 | 3300003215 | Bacteria | 1412 |
| 7 | JGI25160J50197_1001232 | 3300003354 | Bacteria | 12997 |
| 8 | JGI25161J50226_1001195 | 3300003374 | Bacteria | 8513 |
| 9 | Ga0055526_1007090 | 3300003771 | Bacteria | 5916 |
| 10 | Ga0055537_1003876 | 3300003773 | Bacteria | 4461 |
| 11 | Ga0055524_1001204 | 3300003775 | Bacteria | 15355 |
| 12 | Ga0055534_1000540 | 3300003784 | Bacteria | 20263 |
| 13 | Ga0055528_1007996 | 3300003790 | Bacteria | 4599 |
| 14 | Ga0055530_10003274 | 3300003791 | Bacteria | 9418 |
| 15 | Ga0055531_10002277 | 3300003794 | Bacteria | 12991 |
| 16 | Ga0065165_1063634 | 3300005262 | Bacteria | 1001 |
| 17 | Ga0065707_10488883 | 3300005295 | Bacteria | 767 |
| 18 | Ga0065707_10758156 | 3300005295 | Unclassified | 615 |
| 19 | Ga0070670_100131643 | 3300005331 | Bacteria | 2160 |
| 20 | Ga0070670_101006292 | 3300005331 | Bacteria | 758 |
| 21 | Ga0068869_100133229 | 3300005334 | Unclassified | 1912 |
| 22 | Ga0068869_100249868 | 3300005334 | Bacteria | 1416 |
| 23 | Ga0070680_100039693 | 3300005336 | Unclassified | 3808 |
| 24 | Ga0070682_100314491 | 3300005337 | Unclassified | 1154 |
| 25 | Ga0070682_100904612 | 3300005337 | Unclassified | 725 |
| 26 | Ga0070689_100281566 | 3300005340 | Bacteria | 1380 |
| 27 | Ga0070689_100452102 | 3300005340 | Bacteria | 1093 |
| 28 | Ga0070661_100003005 | 3300005344 | Bacteria | 11619 |
| 29 | Ga0070671_101250493 | 3300005355 | Unclassified | 654 |
| 30 | Ga0070673_100058367 | 3300005364 | Unclassified | 3051 |
| 31 | Ga0070659_100856302 | 3300005366 | Unclassified | 793 |
| 32 | Ga0070663_100075067 | 3300005455 | Unclassified | 2470 |
| 33 | Ga0070663_101054562 | 3300005455 | Bacteria | 709 |
| 34 | Ga0070662_100331984 | 3300005457 | Bacteria | 1242 |
| 35 | Ga0070681_10021179 | 3300005458 | Bacteria | 6514 |
| 36 | Ga0068867_100638995 | 3300005459 | Bacteria | 932 |
| 37 | Ga0070684_100151996 | 3300005535 | Unclassified | 2097 |
| 38 | Ga0070684_100782285 | 3300005535 | Bacteria | 892 |
| 39 | Ga0068853_100007165 | 3300005539 | Bacteria | 8925 |
| 40 | Ga0070696_100329372 | 3300005546 | Unclassified | 1177 |
| 41 | Ga0070693_100185118 | 3300005547 | Unclassified | 1343 |
| 42 | Ga0070704_101151746 | 3300005549 | Unclassified | 706 |
| 43 | Ga0070664_100001723 | 3300005564 | Bacteria | 17528 |
| 44 | Ga0070664_100156852 | 3300005564 | Bacteria | 2012 |
| 45 | Ga0068854_100119002 | 3300005578 | Unclassified | 2002 |
| 46 | Ga0068859_100644723 | 3300005617 | Unclassified | 1151 |
| 47 | Ga0068859_101453595 | 3300005617 | Bacteria | 756 |
| 48 | Ga0068859_101874628 | 3300005617 | Bacteria | 662 |
| 49 | Ga0068864_100120879 | 3300005618 | Unclassified | 2342 |
| 50 | Ga0068870_10653921 | 3300005840 | Bacteria | 720 |
| 51 | Ga0068860_100149307 | 3300005843 | Bacteria | 2250 |
| 52 | Ga0068862_100859590 | 3300005844 | Bacteria | 889 |
| 53 | Ga0068862_100940270 | 3300005844 | Bacteria | 852 |
| 54 | Ga0081539_10003170 | 3300005985 | Bacteria | 20838 |
| 55 | Ga0075363_100158638 | 3300006048 | Bacteria | 1280 |
| 56 | Ga0075367_10071635 | 3300006178 | Bacteria | 2085 |
| 57 | Ga0068871_100817834 | 3300006358 | Unclassified | 860 |
| 58 | Ga0075428_101213142 | 3300006844 | Unclassified | 795 |
| 59 | Ga0075429_100203652 | 3300006880 | Bacteria | 1734 |
| 60 | Ga0097620_100644766 | 3300006931 | Unclassified | 1151 |
| 61 | Ga0097620_101453522 | 3300006931 | Bacteria | 756 |
| 62 | Ga0097620_101873973 | 3300006931 | Bacteria | 662 |
| 63 | Ga0099826_10000052 | 3300006948 | Bacteria | 73156 |
| 64 | Ga0114129_11271423 | 3300009147 | Bacteria | 913 |
| 65 | Ga0114129_11298826 | 3300009147 | Bacteria | 902 |
| 66 | Ga0105241_10966083 | 3300009174 | Bacteria | 795 |
| 67 | Ga0105248_10076850 | 3300009177 | Bacteria | 3753 |
| 68 | Ga0105249_10777048 | 3300009553 | Unclassified | 1021 |
| 69 | Ga0105249_10902376 | 3300009553 | Bacteria | 951 |
| 70 | Ga0105239_10564909 | 3300010375 | Unclassified | 1296 |
| 71 | Ga0105246_10934314 | 3300011119 | Unclassified | 780 |
| 72 | Ga0105246_11952429 | 3300011119 | Bacteria | 565 |
| 73 | Ga0157373_10342249 | 3300013100 | Unclassified | 1066 |
| 74 | Ga0163162_10001477 | 3300013306 | Bacteria | 21873 |
| 75 | Ga0157372_10143393 | 3300013307 | Bacteria | 2754 |
| 76 | Ga0157372_10857590 | 3300013307 | Bacteria | 1054 |
| 77 | Ga0157375_10440100 | 3300013308 | Unclassified | 1469 |
| 78 | Ga0163163_10172925 | 3300014325 | Bacteria | 2207 |
| 79 | Ga0163163_10276529 | 3300014325 | Unclassified | 1730 |
| 80 | Ga0163163_10535122 | 3300014325 | Bacteria | 1234 |
| 81 | Ga0157380_10688096 | 3300014326 | Bacteria | 1026 |
| 82 | Ga0157379_10593791 | 3300014968 | Bacteria | 1033 |
| 83 | Ga0157376_10134419 | 3300014969 | Bacteria | 2211 |
| 84 | Ga0209436_100169 | 3300025208 | Bacteria | 31259 |
| 85 | Ga0207425_1001441 | 3300025245 | Bacteria | 9931 |
| 86 | Ga0207425_1002511 | 3300025245 | Bacteria | 6431 |
| 87 | Ga0209129_1006398 | 3300025258 | Bacteria | 3819 |
| 88 | Ga0209565_1002032 | 3300025263 | Bacteria | 7789 |
| 89 | Ga0209673_1003639 | 3300025273 | Bacteria | 8910 |
| 90 | Ga0209130_1034637 | 3300025284 | Bacteria | 1015 |
| 91 | Ga0209130_1034647 | 3300025284 | Bacteria | 1015 |
| 92 | Ga0209675_1006386 | 3300025291 | Bacteria | 4738 |
| 93 | Ga0209676_1000894 | 3300025292 | Bacteria | 37859 |
| 94 | Ga0209025_1000266 | 3300025294 | Bacteria | 122782 |
| 95 | Ga0209025_1002044 | 3300025294 | Bacteria | 22998 |
| 96 | Ga0209025_1019100 | 3300025294 | Bacteria | 3831 |
| 97 | Ga0209564_1005516 | 3300025295 | Bacteria | 7177 |
| 98 | Ga0209758_1008650 | 3300025297 | Bacteria | 6532 |
| 99 | Ga0209050_1000446 | 3300025298 | Bacteria | 74770 |
| 100 | Ga0207426_1001915 | 3300025302 | Bacteria | 15047 |
| 101 | Ga0209051_1033568 | 3300025303 | Bacteria | 1939 |
| 102 | Ga0209257_1000107 | 3300025304 | Bacteria | 240937 |
| 103 | Ga0207643_10494021 | 3300025908 | Bacteria | 782 |
| 104 | Ga0207707_10057264 | 3300025912 | Unclassified | 3393 |
| 105 | Ga0207695_10381160 | 3300025913 | Bacteria | 1296 |
| 106 | Ga0207660_10195292 | 3300025917 | Unclassified | 1578 |
| 107 | Ga0207690_10002110 | 3300025932 | Bacteria | 12174 |
| 108 | Ga0207706_10359943 | 3300025933 | Bacteria | 1264 |
| 109 | Ga0207670_11716640 | 3300025936 | Bacteria | 534 |
| 110 | Ga0207711_10620034 | 3300025941 | Bacteria | 1009 |
| 111 | Ga0207689_10272510 | 3300025942 | Unclassified | 1401 |
| 112 | Ga0207689_10571889 | 3300025942 | Bacteria | 950 |
| 113 | Ga0207661_10212284 | 3300025944 | Bacteria | 1707 |
| 114 | Ga0207679_10223238 | 3300025945 | Unclassified | 1586 |
| 115 | Ga0207679_10241500 | 3300025945 | Bacteria | 1531 |
| 116 | Ga0207651_10070772 | 3300025960 | Unclassified | 2469 |
| 117 | Ga0207712_10002819 | 3300025961 | Bacteria | 11133 |
| 118 | Ga0207712_11498244 | 3300025961 | Bacteria | 604 |
| 119 | Ga0207668_11496699 | 3300025972 | Bacteria | 609 |
| 120 | Ga0207640_11085477 | 3300025981 | Bacteria | 707 |
| 121 | Ga0207639_10070620 | 3300026041 | Unclassified | 2728 |
| 122 | Ga0207678_10982385 | 3300026067 | Bacteria | 747 |
| 123 | Ga0207641_11058767 | 3300026088 | Bacteria | 809 |
| 124 | Ga0207648_10440237 | 3300026089 | Unclassified | 1185 |
| 125 | Ga0207674_10000141 | 3300026116 | Bacteria | 83671 |
| 126 | Ga0207675_100860516 | 3300026118 | Bacteria | 922 |
| 127 | Ga0207698_10547709 | 3300026142 | Bacteria | 1133 |
| 128 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 129 | Ga0268265_10474132 | 3300028380 | Unclassified | 1174 |
| 130 | Ga0268265_10700999 | 3300028380 | Bacteria | 978 |
| 131 | Ga0265323_10078966 | 3300028653 | Bacteria | 1114 |
| 132 | Ga0265338_10639082 | 3300028800 | Unclassified | 738 |
| 133 | Ga0316182_1014857 | 3300030745 | Bacteria | 3116 |
| 134 | Ga0316182_1451706 | 3300030745 | Bacteria | 1114 |
| 135 | Ga0307408_100000103 | 3300031548 | Bacteria | 93203 |
| 136 | Ga0307408_100006747 | 3300031548 | Bacteria | 7608 |
| 137 | Ga0307408_100349696 | 3300031548 | Bacteria | 1254 |
| 138 | Ga0307408_101486594 | 3300031548 | Bacteria | 640 |
| 139 | Ga0316579_10369998 | 3300031691 | Bacteria | 693 |
| 140 | Ga0316576_10515765 | 3300031727 | Bacteria | 878 |
| 141 | Ga0307405_10968211 | 3300031731 | Bacteria | 724 |
| 142 | Ga0316577_10649308 | 3300031733 | Bacteria | 600 |
| 143 | Ga0307413_10128458 | 3300031824 | Bacteria | 1730 |
| 144 | Ga0307413_10658437 | 3300031824 | Unclassified | 865 |
| 145 | Ga0307410_10368662 | 3300031852 | Unclassified | 1152 |
| 146 | Ga0307410_10611117 | 3300031852 | Bacteria | 910 |
| 147 | Ga0307410_11091463 | 3300031852 | Bacteria | 691 |
| 148 | Ga0307406_10487269 | 3300031901 | Bacteria | 997 |
| 149 | Ga0307407_10278899 | 3300031903 | Bacteria | 1157 |
| 150 | Ga0307409_100235782 | 3300031995 | Bacteria | 1662 |
| 151 | Ga0307409_100487298 | 3300031995 | Bacteria | 1198 |
| 152 | Ga0307409_100680399 | 3300031995 | Unclassified | 1026 |
| 153 | Ga0307416_101228165 | 3300032002 | Bacteria | 855 |
| 154 | Ga0316580_10044559 | 3300032139 | Bacteria | 1369 |
| 155 | Ga0316574_0585207 | 3300035398 | Bacteria | 691 |
| 156 | Ga0316584_0483373 | 3300036712 | Bacteria | 872 |
| 157 | Ga0395899_0069240 | 3300037312 | Bacteria | 2584 |
| 158 | Ga0395899_0189488 | 3300037312 | Bacteria | 1439 |
| 159 | Ga0395899_0455838 | 3300037312 | Bacteria | 836 |
| 160 | Ga0395900_0091931 | 3300037418 | Bacteria | 3117 |
| 161 | Ga0395900_0122995 | 3300037418 | Bacteria | 2661 |
| 162 | Ga0395898_0133015 | 3300037466 | Bacteria | 2381 |
| 163 | Ga0395898_0134378 | 3300037466 | Bacteria | 2368 |
| 164 | Ga0395905_0204556 | 3300037471 | Unclassified | 1851 |
| 165 | Ga0395905_0712893 | 3300037471 | Bacteria | 905 |
| 166 | Ga0395901_0179926 | 3300038443 | Bacteria | 2217 |
| 167 | Ga0400483_195291 | 3300039062 | Bacteria | 1092 |
| 168 | Ga0439448_0212109 | 3300042005 | Bacteria | 680 |
| 169 | Ga0451577_0002698 | 3300042876 | Bacteria | 20674 |
| 170 | Ga0451577_0046427 | 3300042876 | Bacteria | 3886 |
| 171 | Ga0451577_0181640 | 3300042876 | Bacteria | 1897 |
| 172 | Ga0451577_0276464 | 3300042876 | Bacteria | 1521 |
| 173 | Ga0451577_0294138 | 3300042876 | Bacteria | 1472 |
| 174 | Ga0466969_0273409 | 3300044656 | Bacteria | 765 |
| 175 | Ga0453683_0203473 | 3300044673 | Bacteria | 1257 |
| 176 | Ga0466966_0018596 | 3300044684 | Bacteria | 4579 |
| 177 | Ga0466966_0355145 | 3300044684 | Bacteria | 881 |
| 178 | Ga0453684_0003913 | 3300044712 | Bacteria | 32729 |
| 179 | Ga0453684_0004796 | 3300044712 | Bacteria | 27835 |
| 180 | Ga0453684_0005903 | 3300044712 | Bacteria | 23740 |
| 181 | Ga0453684_0020849 | 3300044712 | Bacteria | 9841 |
| 182 | Ga0453684_0154374 | 3300044712 | Bacteria | 2724 |
| 183 | Ga0453684_0257062 | 3300044712 | Bacteria | 2003 |
| 184 | Ga0453684_0606394 | 3300044712 | Bacteria | 1199 |
| 185 | Ga0453684_0778071 | 3300044712 | Bacteria | 1034 |
| 186 | Ga0453684_0812521 | 3300044712 | Bacteria | 1007 |
| 187 | Ga0453684_1001543 | 3300044712 | Bacteria | 889 |
| 188 | Ga0453684_1258360 | 3300044712 | Bacteria | 774 |
| 189 | Ga0453684_1593389 | 3300044712 | Bacteria | 670 |
| 190 | Ga0453684_1683627 | 3300044712 | Bacteria | 648 |
| 191 | Ga0466957_0340764 | 3300044842 | Bacteria | 1015 |
| 192 | Ga0451576_0032124 | 3300045051 | Bacteria | 5593 |
| 193 | Ga0451576_0104508 | 3300045051 | Bacteria | 2946 |
| 194 | Ga0451576_0504941 | 3300045051 | Bacteria | 1270 |
| 195 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 196 | Ga0495590_0413487 | 3300046457 | Bacteria | 518 |
| 197 | Ga0495638_0185749 | 3300046460 | Bacteria | 1183 |
| 198 | Ga0495584_0005753 | 3300046491 | Bacteria | 6543 |
| 199 | Ga0495607_0002205 | 3300046501 | Bacteria | 16134 |
| 200 | Ga0495607_0017778 | 3300046501 | Bacteria | 4553 |
| 201 | Ga0495583_0024042 | 3300046506 | Bacteria | 3069 |
| 202 | Ga0495616_0007733 | 3300046513 | Bacteria | 6422 |
| 203 | Ga0495643_0309655 | 3300046522 | Bacteria | 717 |
| 204 | Ga0495648_0222144 | 3300046524 | Bacteria | 931 |
| 205 | Ga0495642_0001559 | 3300046528 | Bacteria | 10070 |
| 206 | Ga0495609_0000864 | 3300046538 | Bacteria | 22272 |
| 207 | Ga0495668_0000378 | 3300046616 | Bacteria | 59112 |
| 208 | Ga0495668_0038663 | 3300046616 | Bacteria | 2665 |
| 209 | Ga0495625_0006603 | 3300046660 | Bacteria | 10298 |
| 210 | Ga0495659_0002788 | 3300046664 | Bacteria | 5617 |
| 211 | Ga0495661_0049872 | 3300046665 | Bacteria | 2536 |
| 212 | Ga0495649_0003303 | 3300046694 | Bacteria | 10967 |
| 213 | Ga0495589_0287265 | 3300046794 | Bacteria | 764 |
| 214 | Ga0495660_0294069 | 3300046810 | Bacteria | 738 |
| 215 | Ga0495636_0002117 | 3300047318 | Bacteria | 7632 |
| 216 | Ga0495687_004962 | 3300047443 | Bacteria | 8700 |
| 217 | Ga0495687_011003 | 3300047443 | Bacteria | 4903 |
| 218 | Ga0495677_0021372 | 3300047445 | Bacteria | 2345 |
| 219 | Ga0495677_0088250 | 3300047445 | Bacteria | 1167 |
| 220 | Ga0495679_020089 | 3300047446 | Bacteria | 2332 |
| 221 | Ga0495685_030063 | 3300047447 | Bacteria | 1867 |
| 222 | Ga0495681_0024473 | 3300047470 | Bacteria | 3180 |
| 223 | Ga0496105_1143567 | 3300048908 | Bacteria | 576 |
| 224 | Ga0496121_0382669 | 3300048924 | Bacteria | 927 |
| 225 | Ga0501036_0171349 | 3300049572 | Bacteria | 1829 |
| 226 | Ga0501039_0604884 | 3300049575 | Bacteria | 859 |
| 227 | Ga0501042_0602450 | 3300049578 | Bacteria | 799 |
| 228 | Ga0501068_0542100 | 3300049584 | Bacteria | 756 |
| 229 | Ga0501207_034987 | 3300049654 | Bacteria | 857 |
| 230 | Ga0501227_052429 | 3300049665 | Bacteria | 1032 |
| 231 | Ga0501245_152323 | 3300049708 | Bacteria | 512 |
| 232 | Ga0501079_0098833 | 3300049741 | Bacteria | 2262 |
| 233 | Ga0501045_0032266 | 3300049824 | Bacteria | 3795 |
| 234 | nmdc:mga03n38_116155_c1 | 3300050490 | Bacteria | 1309 |
| 235 | nmdc:mga06z11_92002_c1 | 3300050494 | Bacteria | 1648 |
| 236 | nmdc:mga05p37_724590_c1 | 3300050507 | Bacteria | 1101 |
| 237 | nmdc:mga09592_194340_c1 | 3300050508 | Bacteria | 1756 |
| 238 | nmdc:mga06r32_549165_c1 | 3300050510 | Unclassified | 1129 |
| 239 | Ga0501084_0169896 | 3300054114 | Bacteria | 1841 |
| 240 | Ga0587068_016375 | 3300059641 | Bacteria | 1175 |
| 241 | Ga0501082_0065516 | 3300060353 | Bacteria | 3129 |
| 242 | Ga0530510_0178291 | 3300061734 | Bacteria | 1575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0257062 | Ga0453684_0257062_11_397 | 113 |
| 2 | 3300037312 | Ga0395899_0069240 | Ga0395899_0069240_2138_2563 | 121 |
| 3 | 3300037312 | Ga0395899_0455838 | Ga0395899_0455838_121_561 | 121 |
| 4 | 3300037418 | Ga0395900_0091931 | Ga0395900_0091931_127_552 | 121 |
| 5 | 3300037418 | Ga0395900_0122995 | Ga0395900_0122995_1344_1784 | 121 |
| 6 | 3300037466 | Ga0395898_0133015 | Ga0395898_0133015_90_515 | 121 |
| 7 | 3300037466 | Ga0395898_0134378 | Ga0395898_0134378_479_919 | 121 |
| 8 | 3300037471 | Ga0395905_0712893 | Ga0395905_0712893_127_552 | 121 |
| 9 | 3300038443 | Ga0395901_0179926 | Ga0395901_0179926_118_543 | 121 |
| 10 | 3300048908 | Ga0496105_1143567 | Ga0496105_1143567_72_497 | 121 |
| 11 | 3300005337 | Ga0070682_100314491 | Ga0070682_1003144911 | 123 |
| 12 | 3300002987 | JGI25159J45721_1002013 | JGI25159J45721_10020132 | 124 |
| 13 | 3300003354 | JGI25160J50197_1001232 | JGI25160J50197_10012329 | 124 |
| 14 | 3300003374 | JGI25161J50226_1001195 | JGI25161J50226_10011959 | 124 |
| 15 | 3300003771 | Ga0055526_1007090 | Ga0055526_10070906 | 124 |
| 16 | 3300003773 | Ga0055537_1003876 | Ga0055537_10038762 | 124 |
| 17 | 3300003775 | Ga0055524_1001204 | Ga0055524_100120418 | 124 |
| 18 | 3300003784 | Ga0055534_1000540 | Ga0055534_100054017 | 124 |
| 19 | 3300003790 | Ga0055528_1007996 | Ga0055528_10079966 | 124 |
| 20 | 3300003791 | Ga0055530_10003274 | Ga0055530_100032742 | 124 |
| 21 | 3300003794 | Ga0055531_10002277 | Ga0055531_100022772 | 124 |
| 22 | 3300005262 | Ga0065165_1063634 | Ga0065165_10636341 | 124 |
| 23 | 3300005457 | Ga0070662_100331984 | Ga0070662_1003319842 | 124 |
| 24 | 3300025208 | Ga0209436_100169 | Ga0209436_10016911 | 124 |
| 25 | 3300025245 | Ga0207425_1001441 | Ga0207425_100144110 | 124 |
| 26 | 3300025258 | Ga0209129_1006398 | Ga0209129_10063982 | 124 |
| 27 | 3300025263 | Ga0209565_1002032 | Ga0209565_10020329 | 124 |
| 28 | 3300025273 | Ga0209673_1003639 | Ga0209673_10036398 | 124 |
| 29 | 3300025284 | Ga0209130_1034637 | Ga0209130_10346372 | 124 |
| 30 | 3300025284 | Ga0209130_1034647 | Ga0209130_10346471 | 124 |
| 31 | 3300025291 | Ga0209675_1006386 | Ga0209675_10063864 | 124 |
| 32 | 3300025295 | Ga0209564_1005516 | Ga0209564_10055169 | 124 |
| 33 | 3300025298 | Ga0209050_1000446 | Ga0209050_100044621 | 124 |
| 34 | 3300025302 | Ga0207426_1001915 | Ga0207426_100191511 | 124 |
| 35 | 3300025303 | Ga0209051_1033568 | Ga0209051_10335683 | 124 |
| 36 | 3300025304 | Ga0209257_1000107 | Ga0209257_100010765 | 124 |
| 37 | 3300025933 | Ga0207706_10359943 | Ga0207706_103599432 | 124 |
| 38 | 3300044656 | Ga0466969_0273409 | Ga0466969_0273409_321_740 | 124 |
| 39 | 3300044684 | Ga0466966_0018596 | Ga0466966_0018596_1209_1628 | 124 |
| 40 | 3300044712 | Ga0453684_0778071 | Ga0453684_0778071_537_956 | 124 |
| 41 | 3300046528 | Ga0495642_0001559 | Ga0495642_0001559_1642_2073 | 124 |
| 42 | 3300047445 | Ga0495677_0088250 | Ga0495677_0088250_188_619 | 124 |
| 43 | 3300005617 | Ga0068859_101453595 | Ga0068859_1014535952 | 125 |
| 44 | 3300005844 | Ga0068862_100940270 | Ga0068862_1009402702 | 125 |
| 45 | 3300006931 | Ga0097620_101453522 | Ga0097620_1014535222 | 125 |
| 46 | 3300006948 | Ga0099826_10000052 | Ga0099826_1000005259 | 125 |
| 47 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000012246 | 125 |
| 48 | 3300028380 | Ga0268265_10700999 | Ga0268265_107009992 | 125 |
| 49 | 3300031548 | Ga0307408_100000103 | Ga0307408_10000010317 | 125 |
| 50 | 3300031548 | Ga0307408_100006747 | Ga0307408_1000067479 | 125 |
| 51 | 3300031548 | Ga0307408_100349696 | Ga0307408_1003496961 | 125 |
| 52 | 3300046457 | Ga0495590_0413487 | Ga0495590_0413487_50_475 | 125 |
| 53 | 3300046460 | Ga0495638_0185749 | Ga0495638_0185749_366_791 | 125 |
| 54 | 3300046491 | Ga0495584_0005753 | Ga0495584_0005753_1833_2258 | 125 |
| 55 | 3300046501 | Ga0495607_0002205 | Ga0495607_0002205_4680_5105 | 125 |
| 56 | 3300046506 | Ga0495583_0024042 | Ga0495583_0024042_21_446 | 125 |
| 57 | 3300046513 | Ga0495616_0007733 | Ga0495616_0007733_3289_3714 | 125 |
| 58 | 3300046522 | Ga0495643_0309655 | Ga0495643_0309655_277_702 | 125 |
| 59 | 3300046524 | Ga0495648_0222144 | Ga0495648_0222144_240_665 | 125 |
| 60 | 3300046538 | Ga0495609_0000864 | Ga0495609_0000864_21341_21760 | 125 |
| 61 | 3300046616 | Ga0495668_0038663 | Ga0495668_0038663_1833_2258 | 125 |
| 62 | 3300046660 | Ga0495625_0006603 | Ga0495625_0006603_2814_3239 | 125 |
| 63 | 3300046664 | Ga0495659_0002788 | Ga0495659_0002788_328_753 | 125 |
| 64 | 3300046665 | Ga0495661_0049872 | Ga0495661_0049872_205_630 | 125 |
| 65 | 3300046694 | Ga0495649_0003303 | Ga0495649_0003303_9080_9505 | 125 |
| 66 | 3300046794 | Ga0495589_0287265 | Ga0495589_0287265_223_648 | 125 |
| 67 | 3300046810 | Ga0495660_0294069 | Ga0495660_0294069_58_483 | 125 |
| 68 | 3300047318 | Ga0495636_0002117 | Ga0495636_0002117_6762_7187 | 125 |
| 69 | 3300047443 | Ga0495687_004962 | Ga0495687_004962_420_845 | 125 |
| 70 | 3300047443 | Ga0495687_011003 | Ga0495687_011003_3436_3861 | 125 |
| 71 | 3300047445 | Ga0495677_0021372 | Ga0495677_0021372_1043_1468 | 125 |
| 72 | 3300047446 | Ga0495679_020089 | Ga0495679_020089_246_671 | 125 |
| 73 | 3300047447 | Ga0495685_030063 | Ga0495685_030063_183_608 | 125 |
| 74 | 3300047470 | Ga0495681_0024473 | Ga0495681_0024473_2446_2871 | 125 |
| 75 | 3300049572 | Ga0501036_0171349 | Ga0501036_0171349_144_569 | 125 |
| 76 | 3300059641 | Ga0587068_016375 | Ga0587068_016375_500_946 | 125 |
| 77 | 3300005340 | Ga0070689_100452102 | Ga0070689_1004521022 | 129 |
| 78 | 3300005843 | Ga0068860_100149307 | Ga0068860_1001493072 | 129 |
| 79 | 3300009177 | Ga0105248_10076850 | Ga0105248_100768501 | 129 |
| 80 | 3300009553 | Ga0105249_10902376 | Ga0105249_109023761 | 129 |
| 81 | 3300013306 | Ga0163162_10001477 | Ga0163162_100014778 | 129 |
| 82 | 3300013307 | Ga0157372_10857590 | Ga0157372_108575902 | 129 |
| 83 | 3300014968 | Ga0157379_10593791 | Ga0157379_105937911 | 129 |
| 84 | 3300025936 | Ga0207670_11716640 | Ga0207670_117166401 | 129 |
| 85 | 3300025961 | Ga0207712_11498244 | Ga0207712_114982441 | 129 |
| 86 | 3300026142 | Ga0207698_10547709 | Ga0207698_105477091 | 129 |
| 87 | 3300005334 | Ga0068869_100133229 | Ga0068869_1001332292 | 130 |
| 88 | 3300005336 | Ga0070680_100039693 | Ga0070680_1000396932 | 130 |
| 89 | 3300005337 | Ga0070682_100904612 | Ga0070682_1009046122 | 130 |
| 90 | 3300005340 | Ga0070689_100281566 | Ga0070689_1002815662 | 130 |
| 91 | 3300005344 | Ga0070661_100003005 | Ga0070661_1000030053 | 130 |
| 92 | 3300005366 | Ga0070659_100856302 | Ga0070659_1008563021 | 130 |
| 93 | 3300005455 | Ga0070663_100075067 | Ga0070663_1000750672 | 130 |
| 94 | 3300005455 | Ga0070663_101054562 | Ga0070663_1010545621 | 130 |
| 95 | 3300005458 | Ga0070681_10021179 | Ga0070681_100211793 | 130 |
| 96 | 3300005459 | Ga0068867_100638995 | Ga0068867_1006389952 | 130 |
| 97 | 3300005535 | Ga0070684_100151996 | Ga0070684_1001519962 | 130 |
| 98 | 3300005539 | Ga0068853_100007165 | Ga0068853_1000071655 | 130 |
| 99 | 3300005547 | Ga0070693_100185118 | Ga0070693_1001851182 | 130 |
| 100 | 3300005564 | Ga0070664_100001723 | Ga0070664_10000172314 | 130 |
| 101 | 3300005578 | Ga0068854_100119002 | Ga0068854_1001190022 | 130 |
| 102 | 3300005617 | Ga0068859_100644723 | Ga0068859_1006447232 | 130 |
| 103 | 3300005617 | Ga0068859_101874628 | Ga0068859_1018746281 | 130 |
| 104 | 3300005618 | Ga0068864_100120879 | Ga0068864_1001208793 | 130 |
| 105 | 3300005840 | Ga0068870_10653921 | Ga0068870_106539212 | 130 |
| 106 | 3300005844 | Ga0068862_100859590 | Ga0068862_1008595902 | 130 |
| 107 | 3300006880 | Ga0075429_100203652 | Ga0075429_1002036521 | 130 |
| 108 | 3300006931 | Ga0097620_100644766 | Ga0097620_1006447662 | 130 |
| 109 | 3300006931 | Ga0097620_101873973 | Ga0097620_1018739731 | 130 |
| 110 | 3300009147 | Ga0114129_11271423 | Ga0114129_112714232 | 130 |
| 111 | 3300009174 | Ga0105241_10966083 | Ga0105241_109660832 | 130 |
| 112 | 3300009553 | Ga0105249_10777048 | Ga0105249_107770481 | 130 |
| 113 | 3300010375 | Ga0105239_10564909 | Ga0105239_105649092 | 130 |
| 114 | 3300011119 | Ga0105246_10934314 | Ga0105246_109343142 | 130 |
| 115 | 3300013100 | Ga0157373_10342249 | Ga0157373_103422492 | 130 |
| 116 | 3300013307 | Ga0157372_10143393 | Ga0157372_101433932 | 130 |
| 117 | 3300013308 | Ga0157375_10440100 | Ga0157375_104401002 | 130 |
| 118 | 3300014325 | Ga0163163_10276529 | Ga0163163_102765293 | 130 |
| 119 | 3300025908 | Ga0207643_10494021 | Ga0207643_104940212 | 130 |
| 120 | 3300025912 | Ga0207707_10057264 | Ga0207707_100572643 | 130 |
| 121 | 3300025913 | Ga0207695_10381160 | Ga0207695_103811602 | 130 |
| 122 | 3300025917 | Ga0207660_10195292 | Ga0207660_101952922 | 130 |
| 123 | 3300025932 | Ga0207690_10002110 | Ga0207690_1000211010 | 130 |
| 124 | 3300025941 | Ga0207711_10620034 | Ga0207711_106200341 | 130 |
| 125 | 3300025942 | Ga0207689_10272510 | Ga0207689_102725102 | 130 |
| 126 | 3300025945 | Ga0207679_10223238 | Ga0207679_102232382 | 130 |
| 127 | 3300025961 | Ga0207712_10002819 | Ga0207712_1000281910 | 130 |
| 128 | 3300025981 | Ga0207640_11085477 | Ga0207640_110854772 | 130 |
| 129 | 3300026041 | Ga0207639_10070620 | Ga0207639_100706202 | 130 |
| 130 | 3300026067 | Ga0207678_10982385 | Ga0207678_109823852 | 130 |
| 131 | 3300026089 | Ga0207648_10440237 | Ga0207648_104402372 | 130 |
| 132 | 3300026116 | Ga0207674_10000141 | Ga0207674_1000014112 | 130 |
| 133 | 3300028380 | Ga0268265_10474132 | Ga0268265_104741322 | 130 |
| 134 | 3300031824 | Ga0307413_10128458 | Ga0307413_101284582 | 130 |
| 135 | 3300031824 | Ga0307413_10658437 | Ga0307413_106584372 | 130 |
| 136 | 3300031852 | Ga0307410_10368662 | Ga0307410_103686621 | 130 |
| 137 | 3300031852 | Ga0307410_11091463 | Ga0307410_110914631 | 130 |
| 138 | 3300031901 | Ga0307406_10487269 | Ga0307406_104872692 | 130 |
| 139 | 3300031903 | Ga0307407_10278899 | Ga0307407_102788992 | 130 |
| 140 | 3300031995 | Ga0307409_100680399 | Ga0307409_1006803992 | 130 |
| 141 | 3300037471 | Ga0395905_0204556 | Ga0395905_0204556_211_603 | 130 |
| 142 | 3300042876 | Ga0451577_0002698 | Ga0451577_0002698_887_1309 | 130 |
| 143 | 3300042876 | Ga0451577_0276464 | Ga0451577_0276464_1057_1449 | 130 |
| 144 | 3300044712 | Ga0453684_0005903 | Ga0453684_0005903_19291_19713 | 130 |
| 145 | 3300044712 | Ga0453684_0606394 | Ga0453684_0606394_165_557 | 130 |
| 146 | 3300049708 | Ga0501245_152323 | Ga0501245_152323_78_476 | 130 |
| 147 | 3300050508 | nmdc:mga09592_194340_c1 | nmdc:mga09592_194340_c1_216_611 | 130 |
| 148 | 3300049665 | Ga0501227_052429 | Ga0501227_052429_86_481 | 131 |
| 149 | 3300005295 | Ga0065707_10488883 | Ga0065707_104888832 | 132 |
| 150 | 3300005331 | Ga0070670_100131643 | Ga0070670_1001316432 | 132 |
| 151 | 3300006048 | Ga0075363_100158638 | Ga0075363_1001586382 | 132 |
| 152 | 3300006178 | Ga0075367_10071635 | Ga0075367_100716354 | 132 |
| 153 | 3300014325 | Ga0163163_10172925 | Ga0163163_101729252 | 132 |
| 154 | 3300014325 | Ga0163163_10535122 | Ga0163163_105351222 | 132 |
| 155 | 3300014326 | Ga0157380_10688096 | Ga0157380_106880962 | 132 |
| 156 | 3300014969 | Ga0157376_10134419 | Ga0157376_101344192 | 132 |
| 157 | 3300031548 | Ga0307408_101486594 | Ga0307408_1014865942 | 132 |
| 158 | 3300031731 | Ga0307405_10968211 | Ga0307405_109682112 | 132 |
| 159 | 3300031733 | Ga0316577_10649308 | Ga0316577_106493081 | 132 |
| 160 | 3300031852 | Ga0307410_10611117 | Ga0307410_106111172 | 132 |
| 161 | 3300031995 | Ga0307409_100487298 | Ga0307409_1004872982 | 132 |
| 162 | 3300032002 | Ga0307416_101228165 | Ga0307416_1012281652 | 132 |
| 163 | 3300050490 | nmdc:mga03n38_116155_c1 | nmdc:mga03n38_116155_c1_322_723 | 132 |
| 164 | 3300050494 | nmdc:mga06z11_92002_c1 | nmdc:mga06z11_92002_c1_96_497 | 132 |
| 165 | 3300039062 | Ga0400483_195291 | Ga0400483_195291_236_637 | 133 |
| 166 | 3300044712 | Ga0453684_0004796 | Ga0453684_0004796_12795_13196 | 133 |
| 167 | 3300050510 | nmdc:mga06r32_549165_c1 | nmdc:mga06r32_549165_c1_378_779 | 133 |
| 168 | 3300005331 | Ga0070670_101006292 | Ga0070670_1010062921 | 134 |
| 169 | 3300005535 | Ga0070684_100782285 | Ga0070684_1007822852 | 134 |
| 170 | 3300005564 | Ga0070664_100156852 | Ga0070664_1001568522 | 134 |
| 171 | 3300025944 | Ga0207661_10212284 | Ga0207661_102122842 | 134 |
| 172 | 3300025945 | Ga0207679_10241500 | Ga0207679_102415001 | 134 |
| 173 | 3300028653 | Ga0265323_10078966 | Ga0265323_100789662 | 134 |
| 174 | 3300031995 | Ga0307409_100235782 | Ga0307409_1002357821 | 134 |
| 175 | 3300035398 | Ga0316574_0585207 | Ga0316574_0585207_122_526 | 134 |
| 176 | 3300042005 | Ga0439448_0212109 | Ga0439448_0212109_43_459 | 134 |
| 177 | 3300044712 | Ga0453684_1001543 | Ga0453684_1001543_454_858 | 134 |
| 178 | 3300050507 | nmdc:mga05p37_724590_c1 | nmdc:mga05p37_724590_c1_626_1030 | 134 |
| 179 | 3300031691 | Ga0316579_10369998 | Ga0316579_103699981 | 135 |
| 180 | 3300031727 | Ga0316576_10515765 | Ga0316576_105157652 | 135 |
| 181 | 3300032139 | Ga0316580_10044559 | Ga0316580_100445592 | 135 |
| 182 | 3300036712 | Ga0316584_0483373 | Ga0316584_0483373_174_584 | 135 |
| 183 | 3300005355 | Ga0070671_101250493 | Ga0070671_1012504932 | 137 |
| 184 | 3300006358 | Ga0068871_100817834 | Ga0068871_1008178341 | 137 |
| 185 | 3300011119 | Ga0105246_11952429 | Ga0105246_119524291 | 137 |
| 186 | 3300025972 | Ga0207668_11496699 | Ga0207668_114966992 | 138 |
| 187 | 3300002774 | JGI25150J39212_1002488 | JGI25150J39212_10024882 | 139 |
| 188 | 3300003187 | JGI25151J46595_10009911 | JGI25151J46595_100099114 | 139 |
| 189 | 3300003187 | JGI25151J46595_10046811 | JGI25151J46595_100468111 | 139 |
| 190 | 3300003203 | JGI25406J46586_10004109 | JGI25406J46586_100041093 | 139 |
| 191 | 3300003215 | JGI25153J46596_10041579 | JGI25153J46596_100415792 | 139 |
| 192 | 3300005295 | Ga0065707_10758156 | Ga0065707_107581561 | 139 |
| 193 | 3300005334 | Ga0068869_100249868 | Ga0068869_1002498682 | 139 |
| 194 | 3300005364 | Ga0070673_100058367 | Ga0070673_1000583673 | 139 |
| 195 | 3300005546 | Ga0070696_100329372 | Ga0070696_1003293722 | 139 |
| 196 | 3300005549 | Ga0070704_101151746 | Ga0070704_1011517461 | 139 |
| 197 | 3300005985 | Ga0081539_10003170 | Ga0081539_1000317014 | 139 |
| 198 | 3300006844 | Ga0075428_101213142 | Ga0075428_1012131422 | 139 |
| 199 | 3300009147 | Ga0114129_11298826 | Ga0114129_112988262 | 139 |
| 200 | 3300025245 | Ga0207425_1002511 | Ga0207425_10025113 | 139 |
| 201 | 3300025292 | Ga0209676_1000894 | Ga0209676_100089424 | 139 |
| 202 | 3300025294 | Ga0209025_1000266 | Ga0209025_1000266102 | 139 |
| 203 | 3300025294 | Ga0209025_1002044 | Ga0209025_10020446 | 139 |
| 204 | 3300025294 | Ga0209025_1019100 | Ga0209025_10191002 | 139 |
| 205 | 3300025297 | Ga0209758_1008650 | Ga0209758_10086505 | 139 |
| 206 | 3300025942 | Ga0207689_10571889 | Ga0207689_105718892 | 139 |
| 207 | 3300025960 | Ga0207651_10070772 | Ga0207651_100707723 | 139 |
| 208 | 3300026088 | Ga0207641_11058767 | Ga0207641_110587671 | 139 |
| 209 | 3300026118 | Ga0207675_100860516 | Ga0207675_1008605162 | 139 |
| 210 | 3300028800 | Ga0265338_10639082 | Ga0265338_106390821 | 139 |
| 211 | 3300030745 | Ga0316182_1014857 | Ga0316182_10148574 | 139 |
| 212 | 3300030745 | Ga0316182_1451706 | Ga0316182_14517061 | 139 |
| 213 | 3300037312 | Ga0395899_0189488 | Ga0395899_0189488_737_1177 | 139 |
| 214 | 3300042876 | Ga0451577_0046427 | Ga0451577_0046427_1586_2008 | 139 |
| 215 | 3300042876 | Ga0451577_0181640 | Ga0451577_0181640_92_550 | 139 |
| 216 | 3300042876 | Ga0451577_0294138 | Ga0451577_0294138_575_997 | 139 |
| 217 | 3300044673 | Ga0453683_0203473 | Ga0453683_0203473_610_1032 | 139 |
| 218 | 3300044684 | Ga0466966_0355145 | Ga0466966_0355145_368_817 | 139 |
| 219 | 3300044712 | Ga0453684_0003913 | Ga0453684_0003913_2026_2460 | 139 |
| 220 | 3300044712 | Ga0453684_0020849 | Ga0453684_0020849_3895_4317 | 139 |
| 221 | 3300044712 | Ga0453684_0154374 | Ga0453684_0154374_1321_1743 | 139 |
| 222 | 3300044712 | Ga0453684_0812521 | Ga0453684_0812521_299_721 | 139 |
| 223 | 3300044712 | Ga0453684_1258360 | Ga0453684_1258360_313_735 | 139 |
| 224 | 3300044712 | Ga0453684_1593389 | Ga0453684_1593389_233_655 | 139 |
| 225 | 3300044712 | Ga0453684_1683627 | Ga0453684_1683627_87_509 | 139 |
| 226 | 3300044842 | Ga0466957_0340764 | Ga0466957_0340764_96_542 | 139 |
| 227 | 3300045051 | Ga0451576_0032124 | Ga0451576_0032124_3220_3642 | 139 |
| 228 | 3300045051 | Ga0451576_0104508 | Ga0451576_0104508_1969_2391 | 139 |
| 229 | 3300045051 | Ga0451576_0504941 | Ga0451576_0504941_631_1053 | 139 |
| 230 | 3300046457 | Ga0495590_0000001 | Ga0495590_0000001_619498_619926 | 139 |
| 231 | 3300046501 | Ga0495607_0017778 | Ga0495607_0017778_511_957 | 139 |
| 232 | 3300046616 | Ga0495668_0000378 | Ga0495668_0000378_33576_34004 | 139 |
| 233 | 3300048924 | Ga0496121_0382669 | Ga0496121_0382669_455_901 | 139 |
| 234 | 3300049575 | Ga0501039_0604884 | Ga0501039_0604884_111_542 | 139 |
| 235 | 3300049578 | Ga0501042_0602450 | Ga0501042_0602450_329_760 | 139 |
| 236 | 3300049584 | Ga0501068_0542100 | Ga0501068_0542100_221_652 | 139 |
| 237 | 3300049654 | Ga0501207_034987 | Ga0501207_034987_56_517 | 139 |
| 238 | 3300049741 | Ga0501079_0098833 | Ga0501079_0098833_1423_1854 | 139 |
| 239 | 3300049824 | Ga0501045_0032266 | Ga0501045_0032266_946_1377 | 139 |
| 240 | 3300054114 | Ga0501084_0169896 | Ga0501084_0169896_450_881 | 139 |
| 241 | 3300060353 | Ga0501082_0065516 | Ga0501082_0065516_2478_2909 | 139 |
| 242 | 3300061734 | Ga0530510_0178291 | Ga0530510_0178291_835_1266 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ump-assembly1.cif.gz_B | crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8831 | 2 | 130 |
| 5ujp-assembly1.cif.gz_B | the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 | 0.874 | 4 | 128 |
| 5uhj-assembly1.cif.gz_A-2 | the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 | 0.8694 | 2 | 130 |
| 5uhj-assembly2.cif.gz_B-3 | the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 | 0.8673 | 2 | 130 |
| 5ujp-assembly1.cif.gz_B | the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 | 0.8669 | 4 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9024 | 80 | 130 | 3.30.720.110 |
| 2pjsB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.894 | 80 | 127 | 3.10.180.10 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.893 | 77 | 127 | 3.30.720.110 |
| 5uhjB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8849 | 5 | 130 | 3.10.180.10 |
| 5ujpB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8775 | 4 | 128 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W2EY14-F1-model_v4 | VOC domain-containing protein | 0.9908 | 76 | 130 |
|
| AF-B7VP20-F1-model_v4 | Glyoxalase family protein | 0.9907 | 1 | 138 |
|
| AF-A0A2T5HKF6-F1-model_v4 | Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme | 0.9901 | 1 | 138 |
GO:0016829
GO:0051213 |
| AF-A0A3B0RRV1-F1-model_v4 | Glyoxalase family protein | 0.9882 | 1 | 133 |
|
| AF-A0A1L8TP16-F1-model_v4 | VOC domain-containing protein | 0.9875 | 1 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar