F354560

General Info

Members Datasets Scaffolds Average Seq Length
242 176 242 133

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101213142|Ga0075428_1012131422
Length 148
Sequence MFVARGTLVKQSIIHIALVVRDYDEAISFYTEKLHFTLVEDIYQPEQDKRWVVVSPPNANGTTLLLARASKPEQQPFIGNQTGGRVFLFLNTDDFWRDYNEMVSKGIKFVRPPKEESYGLVAVFEDLYGNLWDLLQLNANHPLFERTQ

Samples

Sample ID Description Type Environment
1 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
164 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
165 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.7
Nodule 0.83
Rhizoplane 0.41
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1002488 3300002774 Bacteria 4563
2 JGI25159J45721_1002013 3300002987 Bacteria 8066
3 JGI25151J46595_10009911 3300003187 Bacteria 4472
4 JGI25151J46595_10046811 3300003187 Bacteria 1511
5 JGI25406J46586_10004109 3300003203 Bacteria 6801
6 JGI25153J46596_10041579 3300003215 Bacteria 1412
7 JGI25160J50197_1001232 3300003354 Bacteria 12997
8 JGI25161J50226_1001195 3300003374 Bacteria 8513
9 Ga0055526_1007090 3300003771 Bacteria 5916
10 Ga0055537_1003876 3300003773 Bacteria 4461
11 Ga0055524_1001204 3300003775 Bacteria 15355
12 Ga0055534_1000540 3300003784 Bacteria 20263
13 Ga0055528_1007996 3300003790 Bacteria 4599
14 Ga0055530_10003274 3300003791 Bacteria 9418
15 Ga0055531_10002277 3300003794 Bacteria 12991
16 Ga0065165_1063634 3300005262 Bacteria 1001
17 Ga0065707_10488883 3300005295 Bacteria 767
18 Ga0065707_10758156 3300005295 Unclassified 615
19 Ga0070670_100131643 3300005331 Bacteria 2160
20 Ga0070670_101006292 3300005331 Bacteria 758
21 Ga0068869_100133229 3300005334 Unclassified 1912
22 Ga0068869_100249868 3300005334 Bacteria 1416
23 Ga0070680_100039693 3300005336 Unclassified 3808
24 Ga0070682_100314491 3300005337 Unclassified 1154
25 Ga0070682_100904612 3300005337 Unclassified 725
26 Ga0070689_100281566 3300005340 Bacteria 1380
27 Ga0070689_100452102 3300005340 Bacteria 1093
28 Ga0070661_100003005 3300005344 Bacteria 11619
29 Ga0070671_101250493 3300005355 Unclassified 654
30 Ga0070673_100058367 3300005364 Unclassified 3051
31 Ga0070659_100856302 3300005366 Unclassified 793
32 Ga0070663_100075067 3300005455 Unclassified 2470
33 Ga0070663_101054562 3300005455 Bacteria 709
34 Ga0070662_100331984 3300005457 Bacteria 1242
35 Ga0070681_10021179 3300005458 Bacteria 6514
36 Ga0068867_100638995 3300005459 Bacteria 932
37 Ga0070684_100151996 3300005535 Unclassified 2097
38 Ga0070684_100782285 3300005535 Bacteria 892
39 Ga0068853_100007165 3300005539 Bacteria 8925
40 Ga0070696_100329372 3300005546 Unclassified 1177
41 Ga0070693_100185118 3300005547 Unclassified 1343
42 Ga0070704_101151746 3300005549 Unclassified 706
43 Ga0070664_100001723 3300005564 Bacteria 17528
44 Ga0070664_100156852 3300005564 Bacteria 2012
45 Ga0068854_100119002 3300005578 Unclassified 2002
46 Ga0068859_100644723 3300005617 Unclassified 1151
47 Ga0068859_101453595 3300005617 Bacteria 756
48 Ga0068859_101874628 3300005617 Bacteria 662
49 Ga0068864_100120879 3300005618 Unclassified 2342
50 Ga0068870_10653921 3300005840 Bacteria 720
51 Ga0068860_100149307 3300005843 Bacteria 2250
52 Ga0068862_100859590 3300005844 Bacteria 889
53 Ga0068862_100940270 3300005844 Bacteria 852
54 Ga0081539_10003170 3300005985 Bacteria 20838
55 Ga0075363_100158638 3300006048 Bacteria 1280
56 Ga0075367_10071635 3300006178 Bacteria 2085
57 Ga0068871_100817834 3300006358 Unclassified 860
58 Ga0075428_101213142 3300006844 Unclassified 795
59 Ga0075429_100203652 3300006880 Bacteria 1734
60 Ga0097620_100644766 3300006931 Unclassified 1151
61 Ga0097620_101453522 3300006931 Bacteria 756
62 Ga0097620_101873973 3300006931 Bacteria 662
63 Ga0099826_10000052 3300006948 Bacteria 73156
64 Ga0114129_11271423 3300009147 Bacteria 913
65 Ga0114129_11298826 3300009147 Bacteria 902
66 Ga0105241_10966083 3300009174 Bacteria 795
67 Ga0105248_10076850 3300009177 Bacteria 3753
68 Ga0105249_10777048 3300009553 Unclassified 1021
69 Ga0105249_10902376 3300009553 Bacteria 951
70 Ga0105239_10564909 3300010375 Unclassified 1296
71 Ga0105246_10934314 3300011119 Unclassified 780
72 Ga0105246_11952429 3300011119 Bacteria 565
73 Ga0157373_10342249 3300013100 Unclassified 1066
74 Ga0163162_10001477 3300013306 Bacteria 21873
75 Ga0157372_10143393 3300013307 Bacteria 2754
76 Ga0157372_10857590 3300013307 Bacteria 1054
77 Ga0157375_10440100 3300013308 Unclassified 1469
78 Ga0163163_10172925 3300014325 Bacteria 2207
79 Ga0163163_10276529 3300014325 Unclassified 1730
80 Ga0163163_10535122 3300014325 Bacteria 1234
81 Ga0157380_10688096 3300014326 Bacteria 1026
82 Ga0157379_10593791 3300014968 Bacteria 1033
83 Ga0157376_10134419 3300014969 Bacteria 2211
84 Ga0209436_100169 3300025208 Bacteria 31259
85 Ga0207425_1001441 3300025245 Bacteria 9931
86 Ga0207425_1002511 3300025245 Bacteria 6431
87 Ga0209129_1006398 3300025258 Bacteria 3819
88 Ga0209565_1002032 3300025263 Bacteria 7789
89 Ga0209673_1003639 3300025273 Bacteria 8910
90 Ga0209130_1034637 3300025284 Bacteria 1015
91 Ga0209130_1034647 3300025284 Bacteria 1015
92 Ga0209675_1006386 3300025291 Bacteria 4738
93 Ga0209676_1000894 3300025292 Bacteria 37859
94 Ga0209025_1000266 3300025294 Bacteria 122782
95 Ga0209025_1002044 3300025294 Bacteria 22998
96 Ga0209025_1019100 3300025294 Bacteria 3831
97 Ga0209564_1005516 3300025295 Bacteria 7177
98 Ga0209758_1008650 3300025297 Bacteria 6532
99 Ga0209050_1000446 3300025298 Bacteria 74770
100 Ga0207426_1001915 3300025302 Bacteria 15047
101 Ga0209051_1033568 3300025303 Bacteria 1939
102 Ga0209257_1000107 3300025304 Bacteria 240937
103 Ga0207643_10494021 3300025908 Bacteria 782
104 Ga0207707_10057264 3300025912 Unclassified 3393
105 Ga0207695_10381160 3300025913 Bacteria 1296
106 Ga0207660_10195292 3300025917 Unclassified 1578
107 Ga0207690_10002110 3300025932 Bacteria 12174
108 Ga0207706_10359943 3300025933 Bacteria 1264
109 Ga0207670_11716640 3300025936 Bacteria 534
110 Ga0207711_10620034 3300025941 Bacteria 1009
111 Ga0207689_10272510 3300025942 Unclassified 1401
112 Ga0207689_10571889 3300025942 Bacteria 950
113 Ga0207661_10212284 3300025944 Bacteria 1707
114 Ga0207679_10223238 3300025945 Unclassified 1586
115 Ga0207679_10241500 3300025945 Bacteria 1531
116 Ga0207651_10070772 3300025960 Unclassified 2469
117 Ga0207712_10002819 3300025961 Bacteria 11133
118 Ga0207712_11498244 3300025961 Bacteria 604
119 Ga0207668_11496699 3300025972 Bacteria 609
120 Ga0207640_11085477 3300025981 Bacteria 707
121 Ga0207639_10070620 3300026041 Unclassified 2728
122 Ga0207678_10982385 3300026067 Bacteria 747
123 Ga0207641_11058767 3300026088 Bacteria 809
124 Ga0207648_10440237 3300026089 Unclassified 1185
125 Ga0207674_10000141 3300026116 Bacteria 83671
126 Ga0207675_100860516 3300026118 Bacteria 922
127 Ga0207698_10547709 3300026142 Bacteria 1133
128 Ga0209282_1000001 3300027666 Bacteria 2450367
129 Ga0268265_10474132 3300028380 Unclassified 1174
130 Ga0268265_10700999 3300028380 Bacteria 978
131 Ga0265323_10078966 3300028653 Bacteria 1114
132 Ga0265338_10639082 3300028800 Unclassified 738
133 Ga0316182_1014857 3300030745 Bacteria 3116
134 Ga0316182_1451706 3300030745 Bacteria 1114
135 Ga0307408_100000103 3300031548 Bacteria 93203
136 Ga0307408_100006747 3300031548 Bacteria 7608
137 Ga0307408_100349696 3300031548 Bacteria 1254
138 Ga0307408_101486594 3300031548 Bacteria 640
139 Ga0316579_10369998 3300031691 Bacteria 693
140 Ga0316576_10515765 3300031727 Bacteria 878
141 Ga0307405_10968211 3300031731 Bacteria 724
142 Ga0316577_10649308 3300031733 Bacteria 600
143 Ga0307413_10128458 3300031824 Bacteria 1730
144 Ga0307413_10658437 3300031824 Unclassified 865
145 Ga0307410_10368662 3300031852 Unclassified 1152
146 Ga0307410_10611117 3300031852 Bacteria 910
147 Ga0307410_11091463 3300031852 Bacteria 691
148 Ga0307406_10487269 3300031901 Bacteria 997
149 Ga0307407_10278899 3300031903 Bacteria 1157
150 Ga0307409_100235782 3300031995 Bacteria 1662
151 Ga0307409_100487298 3300031995 Bacteria 1198
152 Ga0307409_100680399 3300031995 Unclassified 1026
153 Ga0307416_101228165 3300032002 Bacteria 855
154 Ga0316580_10044559 3300032139 Bacteria 1369
155 Ga0316574_0585207 3300035398 Bacteria 691
156 Ga0316584_0483373 3300036712 Bacteria 872
157 Ga0395899_0069240 3300037312 Bacteria 2584
158 Ga0395899_0189488 3300037312 Bacteria 1439
159 Ga0395899_0455838 3300037312 Bacteria 836
160 Ga0395900_0091931 3300037418 Bacteria 3117
161 Ga0395900_0122995 3300037418 Bacteria 2661
162 Ga0395898_0133015 3300037466 Bacteria 2381
163 Ga0395898_0134378 3300037466 Bacteria 2368
164 Ga0395905_0204556 3300037471 Unclassified 1851
165 Ga0395905_0712893 3300037471 Bacteria 905
166 Ga0395901_0179926 3300038443 Bacteria 2217
167 Ga0400483_195291 3300039062 Bacteria 1092
168 Ga0439448_0212109 3300042005 Bacteria 680
169 Ga0451577_0002698 3300042876 Bacteria 20674
170 Ga0451577_0046427 3300042876 Bacteria 3886
171 Ga0451577_0181640 3300042876 Bacteria 1897
172 Ga0451577_0276464 3300042876 Bacteria 1521
173 Ga0451577_0294138 3300042876 Bacteria 1472
174 Ga0466969_0273409 3300044656 Bacteria 765
175 Ga0453683_0203473 3300044673 Bacteria 1257
176 Ga0466966_0018596 3300044684 Bacteria 4579
177 Ga0466966_0355145 3300044684 Bacteria 881
178 Ga0453684_0003913 3300044712 Bacteria 32729
179 Ga0453684_0004796 3300044712 Bacteria 27835
180 Ga0453684_0005903 3300044712 Bacteria 23740
181 Ga0453684_0020849 3300044712 Bacteria 9841
182 Ga0453684_0154374 3300044712 Bacteria 2724
183 Ga0453684_0257062 3300044712 Bacteria 2003
184 Ga0453684_0606394 3300044712 Bacteria 1199
185 Ga0453684_0778071 3300044712 Bacteria 1034
186 Ga0453684_0812521 3300044712 Bacteria 1007
187 Ga0453684_1001543 3300044712 Bacteria 889
188 Ga0453684_1258360 3300044712 Bacteria 774
189 Ga0453684_1593389 3300044712 Bacteria 670
190 Ga0453684_1683627 3300044712 Bacteria 648
191 Ga0466957_0340764 3300044842 Bacteria 1015
192 Ga0451576_0032124 3300045051 Bacteria 5593
193 Ga0451576_0104508 3300045051 Bacteria 2946
194 Ga0451576_0504941 3300045051 Bacteria 1270
195 Ga0495590_0000001 3300046457 Bacteria 762984
196 Ga0495590_0413487 3300046457 Bacteria 518
197 Ga0495638_0185749 3300046460 Bacteria 1183
198 Ga0495584_0005753 3300046491 Bacteria 6543
199 Ga0495607_0002205 3300046501 Bacteria 16134
200 Ga0495607_0017778 3300046501 Bacteria 4553
201 Ga0495583_0024042 3300046506 Bacteria 3069
202 Ga0495616_0007733 3300046513 Bacteria 6422
203 Ga0495643_0309655 3300046522 Bacteria 717
204 Ga0495648_0222144 3300046524 Bacteria 931
205 Ga0495642_0001559 3300046528 Bacteria 10070
206 Ga0495609_0000864 3300046538 Bacteria 22272
207 Ga0495668_0000378 3300046616 Bacteria 59112
208 Ga0495668_0038663 3300046616 Bacteria 2665
209 Ga0495625_0006603 3300046660 Bacteria 10298
210 Ga0495659_0002788 3300046664 Bacteria 5617
211 Ga0495661_0049872 3300046665 Bacteria 2536
212 Ga0495649_0003303 3300046694 Bacteria 10967
213 Ga0495589_0287265 3300046794 Bacteria 764
214 Ga0495660_0294069 3300046810 Bacteria 738
215 Ga0495636_0002117 3300047318 Bacteria 7632
216 Ga0495687_004962 3300047443 Bacteria 8700
217 Ga0495687_011003 3300047443 Bacteria 4903
218 Ga0495677_0021372 3300047445 Bacteria 2345
219 Ga0495677_0088250 3300047445 Bacteria 1167
220 Ga0495679_020089 3300047446 Bacteria 2332
221 Ga0495685_030063 3300047447 Bacteria 1867
222 Ga0495681_0024473 3300047470 Bacteria 3180
223 Ga0496105_1143567 3300048908 Bacteria 576
224 Ga0496121_0382669 3300048924 Bacteria 927
225 Ga0501036_0171349 3300049572 Bacteria 1829
226 Ga0501039_0604884 3300049575 Bacteria 859
227 Ga0501042_0602450 3300049578 Bacteria 799
228 Ga0501068_0542100 3300049584 Bacteria 756
229 Ga0501207_034987 3300049654 Bacteria 857
230 Ga0501227_052429 3300049665 Bacteria 1032
231 Ga0501245_152323 3300049708 Bacteria 512
232 Ga0501079_0098833 3300049741 Bacteria 2262
233 Ga0501045_0032266 3300049824 Bacteria 3795
234 nmdc:mga03n38_116155_c1 3300050490 Bacteria 1309
235 nmdc:mga06z11_92002_c1 3300050494 Bacteria 1648
236 nmdc:mga05p37_724590_c1 3300050507 Bacteria 1101
237 nmdc:mga09592_194340_c1 3300050508 Bacteria 1756
238 nmdc:mga06r32_549165_c1 3300050510 Unclassified 1129
239 Ga0501084_0169896 3300054114 Bacteria 1841
240 Ga0587068_016375 3300059641 Bacteria 1175
241 Ga0501082_0065516 3300060353 Bacteria 3129
242 Ga0530510_0178291 3300061734 Bacteria 1575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0257062 Ga0453684_0257062_11_397 113
2 3300037312 Ga0395899_0069240 Ga0395899_0069240_2138_2563 121
3 3300037312 Ga0395899_0455838 Ga0395899_0455838_121_561 121
4 3300037418 Ga0395900_0091931 Ga0395900_0091931_127_552 121
5 3300037418 Ga0395900_0122995 Ga0395900_0122995_1344_1784 121
6 3300037466 Ga0395898_0133015 Ga0395898_0133015_90_515 121
7 3300037466 Ga0395898_0134378 Ga0395898_0134378_479_919 121
8 3300037471 Ga0395905_0712893 Ga0395905_0712893_127_552 121
9 3300038443 Ga0395901_0179926 Ga0395901_0179926_118_543 121
10 3300048908 Ga0496105_1143567 Ga0496105_1143567_72_497 121
11 3300005337 Ga0070682_100314491 Ga0070682_1003144911 123
12 3300002987 JGI25159J45721_1002013 JGI25159J45721_10020132 124
13 3300003354 JGI25160J50197_1001232 JGI25160J50197_10012329 124
14 3300003374 JGI25161J50226_1001195 JGI25161J50226_10011959 124
15 3300003771 Ga0055526_1007090 Ga0055526_10070906 124
16 3300003773 Ga0055537_1003876 Ga0055537_10038762 124
17 3300003775 Ga0055524_1001204 Ga0055524_100120418 124
18 3300003784 Ga0055534_1000540 Ga0055534_100054017 124
19 3300003790 Ga0055528_1007996 Ga0055528_10079966 124
20 3300003791 Ga0055530_10003274 Ga0055530_100032742 124
21 3300003794 Ga0055531_10002277 Ga0055531_100022772 124
22 3300005262 Ga0065165_1063634 Ga0065165_10636341 124
23 3300005457 Ga0070662_100331984 Ga0070662_1003319842 124
24 3300025208 Ga0209436_100169 Ga0209436_10016911 124
25 3300025245 Ga0207425_1001441 Ga0207425_100144110 124
26 3300025258 Ga0209129_1006398 Ga0209129_10063982 124
27 3300025263 Ga0209565_1002032 Ga0209565_10020329 124
28 3300025273 Ga0209673_1003639 Ga0209673_10036398 124
29 3300025284 Ga0209130_1034637 Ga0209130_10346372 124
30 3300025284 Ga0209130_1034647 Ga0209130_10346471 124
31 3300025291 Ga0209675_1006386 Ga0209675_10063864 124
32 3300025295 Ga0209564_1005516 Ga0209564_10055169 124
33 3300025298 Ga0209050_1000446 Ga0209050_100044621 124
34 3300025302 Ga0207426_1001915 Ga0207426_100191511 124
35 3300025303 Ga0209051_1033568 Ga0209051_10335683 124
36 3300025304 Ga0209257_1000107 Ga0209257_100010765 124
37 3300025933 Ga0207706_10359943 Ga0207706_103599432 124
38 3300044656 Ga0466969_0273409 Ga0466969_0273409_321_740 124
39 3300044684 Ga0466966_0018596 Ga0466966_0018596_1209_1628 124
40 3300044712 Ga0453684_0778071 Ga0453684_0778071_537_956 124
41 3300046528 Ga0495642_0001559 Ga0495642_0001559_1642_2073 124
42 3300047445 Ga0495677_0088250 Ga0495677_0088250_188_619 124
43 3300005617 Ga0068859_101453595 Ga0068859_1014535952 125
44 3300005844 Ga0068862_100940270 Ga0068862_1009402702 125
45 3300006931 Ga0097620_101453522 Ga0097620_1014535222 125
46 3300006948 Ga0099826_10000052 Ga0099826_1000005259 125
47 3300027666 Ga0209282_1000001 Ga0209282_10000012246 125
48 3300028380 Ga0268265_10700999 Ga0268265_107009992 125
49 3300031548 Ga0307408_100000103 Ga0307408_10000010317 125
50 3300031548 Ga0307408_100006747 Ga0307408_1000067479 125
51 3300031548 Ga0307408_100349696 Ga0307408_1003496961 125
52 3300046457 Ga0495590_0413487 Ga0495590_0413487_50_475 125
53 3300046460 Ga0495638_0185749 Ga0495638_0185749_366_791 125
54 3300046491 Ga0495584_0005753 Ga0495584_0005753_1833_2258 125
55 3300046501 Ga0495607_0002205 Ga0495607_0002205_4680_5105 125
56 3300046506 Ga0495583_0024042 Ga0495583_0024042_21_446 125
57 3300046513 Ga0495616_0007733 Ga0495616_0007733_3289_3714 125
58 3300046522 Ga0495643_0309655 Ga0495643_0309655_277_702 125
59 3300046524 Ga0495648_0222144 Ga0495648_0222144_240_665 125
60 3300046538 Ga0495609_0000864 Ga0495609_0000864_21341_21760 125
61 3300046616 Ga0495668_0038663 Ga0495668_0038663_1833_2258 125
62 3300046660 Ga0495625_0006603 Ga0495625_0006603_2814_3239 125
63 3300046664 Ga0495659_0002788 Ga0495659_0002788_328_753 125
64 3300046665 Ga0495661_0049872 Ga0495661_0049872_205_630 125
65 3300046694 Ga0495649_0003303 Ga0495649_0003303_9080_9505 125
66 3300046794 Ga0495589_0287265 Ga0495589_0287265_223_648 125
67 3300046810 Ga0495660_0294069 Ga0495660_0294069_58_483 125
68 3300047318 Ga0495636_0002117 Ga0495636_0002117_6762_7187 125
69 3300047443 Ga0495687_004962 Ga0495687_004962_420_845 125
70 3300047443 Ga0495687_011003 Ga0495687_011003_3436_3861 125
71 3300047445 Ga0495677_0021372 Ga0495677_0021372_1043_1468 125
72 3300047446 Ga0495679_020089 Ga0495679_020089_246_671 125
73 3300047447 Ga0495685_030063 Ga0495685_030063_183_608 125
74 3300047470 Ga0495681_0024473 Ga0495681_0024473_2446_2871 125
75 3300049572 Ga0501036_0171349 Ga0501036_0171349_144_569 125
76 3300059641 Ga0587068_016375 Ga0587068_016375_500_946 125
77 3300005340 Ga0070689_100452102 Ga0070689_1004521022 129
78 3300005843 Ga0068860_100149307 Ga0068860_1001493072 129
79 3300009177 Ga0105248_10076850 Ga0105248_100768501 129
80 3300009553 Ga0105249_10902376 Ga0105249_109023761 129
81 3300013306 Ga0163162_10001477 Ga0163162_100014778 129
82 3300013307 Ga0157372_10857590 Ga0157372_108575902 129
83 3300014968 Ga0157379_10593791 Ga0157379_105937911 129
84 3300025936 Ga0207670_11716640 Ga0207670_117166401 129
85 3300025961 Ga0207712_11498244 Ga0207712_114982441 129
86 3300026142 Ga0207698_10547709 Ga0207698_105477091 129
87 3300005334 Ga0068869_100133229 Ga0068869_1001332292 130
88 3300005336 Ga0070680_100039693 Ga0070680_1000396932 130
89 3300005337 Ga0070682_100904612 Ga0070682_1009046122 130
90 3300005340 Ga0070689_100281566 Ga0070689_1002815662 130
91 3300005344 Ga0070661_100003005 Ga0070661_1000030053 130
92 3300005366 Ga0070659_100856302 Ga0070659_1008563021 130
93 3300005455 Ga0070663_100075067 Ga0070663_1000750672 130
94 3300005455 Ga0070663_101054562 Ga0070663_1010545621 130
95 3300005458 Ga0070681_10021179 Ga0070681_100211793 130
96 3300005459 Ga0068867_100638995 Ga0068867_1006389952 130
97 3300005535 Ga0070684_100151996 Ga0070684_1001519962 130
98 3300005539 Ga0068853_100007165 Ga0068853_1000071655 130
99 3300005547 Ga0070693_100185118 Ga0070693_1001851182 130
100 3300005564 Ga0070664_100001723 Ga0070664_10000172314 130
101 3300005578 Ga0068854_100119002 Ga0068854_1001190022 130
102 3300005617 Ga0068859_100644723 Ga0068859_1006447232 130
103 3300005617 Ga0068859_101874628 Ga0068859_1018746281 130
104 3300005618 Ga0068864_100120879 Ga0068864_1001208793 130
105 3300005840 Ga0068870_10653921 Ga0068870_106539212 130
106 3300005844 Ga0068862_100859590 Ga0068862_1008595902 130
107 3300006880 Ga0075429_100203652 Ga0075429_1002036521 130
108 3300006931 Ga0097620_100644766 Ga0097620_1006447662 130
109 3300006931 Ga0097620_101873973 Ga0097620_1018739731 130
110 3300009147 Ga0114129_11271423 Ga0114129_112714232 130
111 3300009174 Ga0105241_10966083 Ga0105241_109660832 130
112 3300009553 Ga0105249_10777048 Ga0105249_107770481 130
113 3300010375 Ga0105239_10564909 Ga0105239_105649092 130
114 3300011119 Ga0105246_10934314 Ga0105246_109343142 130
115 3300013100 Ga0157373_10342249 Ga0157373_103422492 130
116 3300013307 Ga0157372_10143393 Ga0157372_101433932 130
117 3300013308 Ga0157375_10440100 Ga0157375_104401002 130
118 3300014325 Ga0163163_10276529 Ga0163163_102765293 130
119 3300025908 Ga0207643_10494021 Ga0207643_104940212 130
120 3300025912 Ga0207707_10057264 Ga0207707_100572643 130
121 3300025913 Ga0207695_10381160 Ga0207695_103811602 130
122 3300025917 Ga0207660_10195292 Ga0207660_101952922 130
123 3300025932 Ga0207690_10002110 Ga0207690_1000211010 130
124 3300025941 Ga0207711_10620034 Ga0207711_106200341 130
125 3300025942 Ga0207689_10272510 Ga0207689_102725102 130
126 3300025945 Ga0207679_10223238 Ga0207679_102232382 130
127 3300025961 Ga0207712_10002819 Ga0207712_1000281910 130
128 3300025981 Ga0207640_11085477 Ga0207640_110854772 130
129 3300026041 Ga0207639_10070620 Ga0207639_100706202 130
130 3300026067 Ga0207678_10982385 Ga0207678_109823852 130
131 3300026089 Ga0207648_10440237 Ga0207648_104402372 130
132 3300026116 Ga0207674_10000141 Ga0207674_1000014112 130
133 3300028380 Ga0268265_10474132 Ga0268265_104741322 130
134 3300031824 Ga0307413_10128458 Ga0307413_101284582 130
135 3300031824 Ga0307413_10658437 Ga0307413_106584372 130
136 3300031852 Ga0307410_10368662 Ga0307410_103686621 130
137 3300031852 Ga0307410_11091463 Ga0307410_110914631 130
138 3300031901 Ga0307406_10487269 Ga0307406_104872692 130
139 3300031903 Ga0307407_10278899 Ga0307407_102788992 130
140 3300031995 Ga0307409_100680399 Ga0307409_1006803992 130
141 3300037471 Ga0395905_0204556 Ga0395905_0204556_211_603 130
142 3300042876 Ga0451577_0002698 Ga0451577_0002698_887_1309 130
143 3300042876 Ga0451577_0276464 Ga0451577_0276464_1057_1449 130
144 3300044712 Ga0453684_0005903 Ga0453684_0005903_19291_19713 130
145 3300044712 Ga0453684_0606394 Ga0453684_0606394_165_557 130
146 3300049708 Ga0501245_152323 Ga0501245_152323_78_476 130
147 3300050508 nmdc:mga09592_194340_c1 nmdc:mga09592_194340_c1_216_611 130
148 3300049665 Ga0501227_052429 Ga0501227_052429_86_481 131
149 3300005295 Ga0065707_10488883 Ga0065707_104888832 132
150 3300005331 Ga0070670_100131643 Ga0070670_1001316432 132
151 3300006048 Ga0075363_100158638 Ga0075363_1001586382 132
152 3300006178 Ga0075367_10071635 Ga0075367_100716354 132
153 3300014325 Ga0163163_10172925 Ga0163163_101729252 132
154 3300014325 Ga0163163_10535122 Ga0163163_105351222 132
155 3300014326 Ga0157380_10688096 Ga0157380_106880962 132
156 3300014969 Ga0157376_10134419 Ga0157376_101344192 132
157 3300031548 Ga0307408_101486594 Ga0307408_1014865942 132
158 3300031731 Ga0307405_10968211 Ga0307405_109682112 132
159 3300031733 Ga0316577_10649308 Ga0316577_106493081 132
160 3300031852 Ga0307410_10611117 Ga0307410_106111172 132
161 3300031995 Ga0307409_100487298 Ga0307409_1004872982 132
162 3300032002 Ga0307416_101228165 Ga0307416_1012281652 132
163 3300050490 nmdc:mga03n38_116155_c1 nmdc:mga03n38_116155_c1_322_723 132
164 3300050494 nmdc:mga06z11_92002_c1 nmdc:mga06z11_92002_c1_96_497 132
165 3300039062 Ga0400483_195291 Ga0400483_195291_236_637 133
166 3300044712 Ga0453684_0004796 Ga0453684_0004796_12795_13196 133
167 3300050510 nmdc:mga06r32_549165_c1 nmdc:mga06r32_549165_c1_378_779 133
168 3300005331 Ga0070670_101006292 Ga0070670_1010062921 134
169 3300005535 Ga0070684_100782285 Ga0070684_1007822852 134
170 3300005564 Ga0070664_100156852 Ga0070664_1001568522 134
171 3300025944 Ga0207661_10212284 Ga0207661_102122842 134
172 3300025945 Ga0207679_10241500 Ga0207679_102415001 134
173 3300028653 Ga0265323_10078966 Ga0265323_100789662 134
174 3300031995 Ga0307409_100235782 Ga0307409_1002357821 134
175 3300035398 Ga0316574_0585207 Ga0316574_0585207_122_526 134
176 3300042005 Ga0439448_0212109 Ga0439448_0212109_43_459 134
177 3300044712 Ga0453684_1001543 Ga0453684_1001543_454_858 134
178 3300050507 nmdc:mga05p37_724590_c1 nmdc:mga05p37_724590_c1_626_1030 134
179 3300031691 Ga0316579_10369998 Ga0316579_103699981 135
180 3300031727 Ga0316576_10515765 Ga0316576_105157652 135
181 3300032139 Ga0316580_10044559 Ga0316580_100445592 135
182 3300036712 Ga0316584_0483373 Ga0316584_0483373_174_584 135
183 3300005355 Ga0070671_101250493 Ga0070671_1012504932 137
184 3300006358 Ga0068871_100817834 Ga0068871_1008178341 137
185 3300011119 Ga0105246_11952429 Ga0105246_119524291 137
186 3300025972 Ga0207668_11496699 Ga0207668_114966992 138
187 3300002774 JGI25150J39212_1002488 JGI25150J39212_10024882 139
188 3300003187 JGI25151J46595_10009911 JGI25151J46595_100099114 139
189 3300003187 JGI25151J46595_10046811 JGI25151J46595_100468111 139
190 3300003203 JGI25406J46586_10004109 JGI25406J46586_100041093 139
191 3300003215 JGI25153J46596_10041579 JGI25153J46596_100415792 139
192 3300005295 Ga0065707_10758156 Ga0065707_107581561 139
193 3300005334 Ga0068869_100249868 Ga0068869_1002498682 139
194 3300005364 Ga0070673_100058367 Ga0070673_1000583673 139
195 3300005546 Ga0070696_100329372 Ga0070696_1003293722 139
196 3300005549 Ga0070704_101151746 Ga0070704_1011517461 139
197 3300005985 Ga0081539_10003170 Ga0081539_1000317014 139
198 3300006844 Ga0075428_101213142 Ga0075428_1012131422 139
199 3300009147 Ga0114129_11298826 Ga0114129_112988262 139
200 3300025245 Ga0207425_1002511 Ga0207425_10025113 139
201 3300025292 Ga0209676_1000894 Ga0209676_100089424 139
202 3300025294 Ga0209025_1000266 Ga0209025_1000266102 139
203 3300025294 Ga0209025_1002044 Ga0209025_10020446 139
204 3300025294 Ga0209025_1019100 Ga0209025_10191002 139
205 3300025297 Ga0209758_1008650 Ga0209758_10086505 139
206 3300025942 Ga0207689_10571889 Ga0207689_105718892 139
207 3300025960 Ga0207651_10070772 Ga0207651_100707723 139
208 3300026088 Ga0207641_11058767 Ga0207641_110587671 139
209 3300026118 Ga0207675_100860516 Ga0207675_1008605162 139
210 3300028800 Ga0265338_10639082 Ga0265338_106390821 139
211 3300030745 Ga0316182_1014857 Ga0316182_10148574 139
212 3300030745 Ga0316182_1451706 Ga0316182_14517061 139
213 3300037312 Ga0395899_0189488 Ga0395899_0189488_737_1177 139
214 3300042876 Ga0451577_0046427 Ga0451577_0046427_1586_2008 139
215 3300042876 Ga0451577_0181640 Ga0451577_0181640_92_550 139
216 3300042876 Ga0451577_0294138 Ga0451577_0294138_575_997 139
217 3300044673 Ga0453683_0203473 Ga0453683_0203473_610_1032 139
218 3300044684 Ga0466966_0355145 Ga0466966_0355145_368_817 139
219 3300044712 Ga0453684_0003913 Ga0453684_0003913_2026_2460 139
220 3300044712 Ga0453684_0020849 Ga0453684_0020849_3895_4317 139
221 3300044712 Ga0453684_0154374 Ga0453684_0154374_1321_1743 139
222 3300044712 Ga0453684_0812521 Ga0453684_0812521_299_721 139
223 3300044712 Ga0453684_1258360 Ga0453684_1258360_313_735 139
224 3300044712 Ga0453684_1593389 Ga0453684_1593389_233_655 139
225 3300044712 Ga0453684_1683627 Ga0453684_1683627_87_509 139
226 3300044842 Ga0466957_0340764 Ga0466957_0340764_96_542 139
227 3300045051 Ga0451576_0032124 Ga0451576_0032124_3220_3642 139
228 3300045051 Ga0451576_0104508 Ga0451576_0104508_1969_2391 139
229 3300045051 Ga0451576_0504941 Ga0451576_0504941_631_1053 139
230 3300046457 Ga0495590_0000001 Ga0495590_0000001_619498_619926 139
231 3300046501 Ga0495607_0017778 Ga0495607_0017778_511_957 139
232 3300046616 Ga0495668_0000378 Ga0495668_0000378_33576_34004 139
233 3300048924 Ga0496121_0382669 Ga0496121_0382669_455_901 139
234 3300049575 Ga0501039_0604884 Ga0501039_0604884_111_542 139
235 3300049578 Ga0501042_0602450 Ga0501042_0602450_329_760 139
236 3300049584 Ga0501068_0542100 Ga0501068_0542100_221_652 139
237 3300049654 Ga0501207_034987 Ga0501207_034987_56_517 139
238 3300049741 Ga0501079_0098833 Ga0501079_0098833_1423_1854 139
239 3300049824 Ga0501045_0032266 Ga0501045_0032266_946_1377 139
240 3300054114 Ga0501084_0169896 Ga0501084_0169896_450_881 139
241 3300060353 Ga0501082_0065516 Ga0501082_0065516_2478_2909 139
242 3300061734 Ga0530510_0178291 Ga0530510_0178291_835_1266 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

134

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8831 2 130
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.874 4 128
5uhj-assembly1.cif.gz_A-2 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8694 2 130
5uhj-assembly2.cif.gz_B-3 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8673 2 130
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8669 4 128
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9024 80 130 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.894 80 127 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.893 77 127 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8849 5 130 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8775 4 128 3.10.180.10
ID Description Score Start End GO Terms
AF-W2EY14-F1-model_v4 VOC domain-containing protein 0.9908 76 130
AF-B7VP20-F1-model_v4 Glyoxalase family protein 0.9907 1 138
AF-A0A2T5HKF6-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9901 1 138 GO:0016829
GO:0051213
AF-A0A3B0RRV1-F1-model_v4 Glyoxalase family protein 0.9882 1 133
AF-A0A1L8TP16-F1-model_v4 VOC domain-containing protein 0.9875 1 138

Feature Viewer

pLDDT pTM Quality
91.87 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map