F354513

General Info

Members Datasets Scaffolds Average Seq Length
242 174 242 123

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_102378028|Ga0068863_1023780281
Length 129
Sequence MLAARDPMAENQFLSVIRIWAAMAWADGKVVAAEALAMERLIQAAELDEAERNIARGFLKEKVELDTSNVGSLTDEARRGIYKAACRMAAVDRKLDDPERALLDRLREGLNIGAAAGEIETAVFGPPKP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
91 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
113 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
114 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
130 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
131 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
135 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
136 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
137 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
138 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
151 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
155 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
156 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
157 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
160 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
163 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
169 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
170 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
173 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.05
Nodule 0
Rhizoplane 1.24
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100866279 3300005329 Bacteria 866
2 Ga0070670_100740580 3300005331 Bacteria 885
3 Ga0070670_101507322 3300005331 Bacteria 617
4 Ga0068869_100042573 3300005334 Bacteria 3256
5 Ga0070680_100059017 3300005336 Bacteria 3138
6 Ga0070682_100679755 3300005337 Bacteria 823
7 Ga0068868_101346480 3300005338 Bacteria 664
8 Ga0070689_100032006 3300005340 Bacteria 3999
9 Ga0070689_100047788 3300005340 Bacteria 3300
10 Ga0070687_100814515 3300005343 Unclassified 663
11 Ga0070692_10136061 3300005345 Bacteria 1386
12 Ga0070667_100064951 3300005367 Bacteria 3098
13 Ga0070701_10024386 3300005438 Bacteria 2926
14 Ga0070711_100482803 3300005439 Bacteria 1019
15 Ga0070705_101568112 3300005440 Unclassified 553
16 Ga0070708_100498923 3300005445 Bacteria 1148
17 Ga0070678_100002853 3300005456 Bacteria 9565
18 Ga0070681_10141329 3300005458 Unclassified 2337
19 Ga0070685_10547130 3300005466 Bacteria 826
20 Ga0070706_100035278 3300005467 Bacteria 4620
21 Ga0070707_100652186 3300005468 Bacteria 1015
22 Ga0070698_100001138 3300005471 Bacteria 29427
23 Ga0070679_100033128 3300005530 Bacteria 5115
24 Ga0070679_100826426 3300005530 Bacteria 870
25 Ga0070679_101287415 3300005530 Bacteria 677
26 Ga0070684_100027448 3300005535 Bacteria 4806
27 Ga0070684_100173256 3300005535 Bacteria 1960
28 Ga0070684_100438751 3300005535 Unclassified 1206
29 Ga0070684_100927930 3300005535 Unclassified 816
30 Ga0068853_101685547 3300005539 Bacteria 614
31 Ga0068856_100014588 3300005614 Bacteria 7591
32 Ga0068856_101287556 3300005614 Bacteria 746
33 Ga0068852_100650843 3300005616 Bacteria 1061
34 Ga0068859_100918798 3300005617 Bacteria 959
35 Ga0068864_100976442 3300005618 Bacteria 839
36 Ga0068866_10087153 3300005718 Bacteria 1691
37 Ga0068866_10748382 3300005718 Bacteria 675
38 Ga0068870_10238830 3300005840 Bacteria 1121
39 Ga0068870_10352539 3300005840 Bacteria 945
40 Ga0068863_100092274 3300005841 Bacteria 2873
41 Ga0068863_100219153 3300005841 Bacteria 1833
42 Ga0068863_102378028 3300005841 Bacteria 539
43 Ga0068860_100090682 3300005843 Bacteria 2912
44 Ga0081455_10384421 3300005937 Bacteria 979
45 Ga0070717_10154621 3300006028 Bacteria 1986
46 Ga0070717_10286619 3300006028 Bacteria 1461
47 Ga0097621_100621850 3300006237 Bacteria 989
48 Ga0097621_101059014 3300006237 Unclassified 760
49 Ga0068871_100356971 3300006358 Bacteria 1294
50 Ga0075430_100180664 3300006846 Bacteria 1755
51 Ga0075430_100516745 3300006846 Unclassified 985
52 Ga0075431_100324063 3300006847 Bacteria 1553
53 Ga0075429_100006189 3300006880 Bacteria 10349
54 Ga0075429_100549899 3300006880 Unclassified 1012
55 Ga0068865_101461930 3300006881 Bacteria 611
56 Ga0097620_100918850 3300006931 Bacteria 959
57 Ga0097620_101505109 3300006931 Bacteria 743
58 Ga0075435_100159751 3300007076 Bacteria 1898
59 Ga0075435_101267996 3300007076 Bacteria 645
60 Ga0111539_10282690 3300009094 Bacteria 1931
61 Ga0105245_10000223 3300009098 Bacteria 53966
62 Ga0105245_10815276 3300009098 Bacteria 972
63 Ga0105245_11246341 3300009098 Unclassified 792
64 Ga0105243_10412053 3300009148 Bacteria 1258
65 Ga0105241_10309586 3300009174 Unclassified 1358
66 Ga0105242_10503008 3300009176 Bacteria 1153
67 Ga0105237_10417004 3300009545 Bacteria 1348
68 Ga0105239_10280223 3300010375 Unclassified 1877
69 Ga0105246_12401696 3300011119 Unclassified 517
70 Ga0163163_11871731 3300014325 Unclassified 660
71 Ga0157376_10005449 3300014969 Bacteria 8896
72 Ga0157376_11629181 3300014969 Unclassified 680
73 Ga0213876_10031332 3300021384 Bacteria 2806
74 Ga0207642_10067142 3300025899 Bacteria 1692
75 Ga0207684_10115316 3300025910 Unclassified 2301
76 Ga0207654_10816586 3300025911 Unclassified 674
77 Ga0207707_11071675 3300025912 Bacteria 658
78 Ga0207671_10343886 3300025914 Bacteria 1182
79 Ga0207660_10055238 3300025917 Unclassified 2837
80 Ga0207660_10366554 3300025917 Bacteria 1156
81 Ga0207662_10182607 3300025918 Bacteria 1350
82 Ga0207652_10035724 3300025921 Bacteria 4197
83 Ga0207652_10613013 3300025921 Bacteria 975
84 Ga0207652_10839520 3300025921 Bacteria 814
85 Ga0207646_10573280 3300025922 Bacteria 1014
86 Ga0207687_10000120 3300025927 Bacteria 54782
87 Ga0207686_10245750 3300025934 Bacteria 1305
88 Ga0207670_10030775 3300025936 Bacteria 3431
89 Ga0207670_10031316 3300025936 Bacteria 3407
90 Ga0207670_10046719 3300025936 Bacteria 2878
91 Ga0207704_10571171 3300025938 Unclassified 922
92 Ga0207689_10027406 3300025942 Bacteria 4770
93 Ga0207689_10118102 3300025942 Bacteria 2181
94 Ga0207689_10955267 3300025942 Bacteria 723
95 Ga0207661_10982174 3300025944 Bacteria 778
96 Ga0207658_10047608 3300025986 Bacteria 3139
97 Ga0207677_11511930 3300026023 Bacteria 620
98 Ga0207703_11377892 3300026035 Bacteria 678
99 Ga0207708_10314338 3300026075 Unclassified 1277
100 Ga0207702_10069770 3300026078 Bacteria 3022
101 Ga0207702_10849886 3300026078 Bacteria 903
102 Ga0207641_10304454 3300026088 Bacteria 1506
103 Ga0207641_10366729 3300026088 Unclassified 1376
104 Ga0207641_12173512 3300026088 Bacteria 555
105 Ga0207675_100229286 3300026118 Bacteria 1791
106 Ga0207683_10002224 3300026121 Bacteria 17070
107 Ga0207698_12022357 3300026142 Bacteria 590
108 Ga0207428_10740209 3300027907 Bacteria 701
109 Ga0268266_10004111 3300028379 Bacteria 14054
110 Ga0268264_11123040 3300028381 Bacteria 795
111 Ga0268264_11947230 3300028381 Bacteria 597
112 Ga0307515_10025712 3300028794 Bacteria 10172
113 Ga0265338_10047162 3300028800 Bacteria 3939
114 Ga0265338_10097142 3300028800 Unclassified 2414
115 Ga0307511_10208159 3300030521 Unclassified 1003
116 Ga0265332_10005666 3300031238 Bacteria 5741
117 Ga0307513_10091917 3300031456 Bacteria 3091
118 Ga0307513_10429310 3300031456 Bacteria 1050
119 Ga0307509_10000111 3300031507 Bacteria 117078
120 Ga0307509_10004236 3300031507 Bacteria 20915
121 Ga0307509_10031864 3300031507 Bacteria 5814
122 Ga0307509_10075203 3300031507 Bacteria 3509
123 Ga0307509_10207687 3300031507 Bacteria 1787
124 Ga0307508_10090060 3300031616 Bacteria 2654
125 Ga0307508_10510091 3300031616 Bacteria 798
126 Ga0265314_10255848 3300031711 Unclassified 1003
127 Ga0265314_10538321 3300031711 Unclassified 609
128 Ga0307516_10030604 3300031730 Bacteria 5430
129 Ga0307516_10097810 3300031730 Bacteria 2754
130 Ga0373958_0167301 3300034819 Bacteria 559
131 Ga0373949_0000045 3300035090 Bacteria 45428
132 Ga0373951_0192048 3300035091 Unclassified 591
133 Ga0373936_0000005 3300035113 Bacteria 325848
134 Ga0373939_0081662 3300035114 Bacteria 1074
135 Ga0373956_0077692 3300035119 Unclassified 1520
136 Ga0373960_0321715 3300035121 Unclassified 580
137 Ga0373946_0540501 3300035171 Unclassified 600
138 Ga0373961_0000039 3300035241 Bacteria 78101
139 Ga0373931_0394879 3300035691 Bacteria 875
140 Ga0395899_0003091 3300037312 Bacteria 13253
141 Ga0395900_0021997 3300037418 Bacteria 6520
142 Ga0395905_0313897 3300037471 Bacteria 1456
143 Ga0395905_1201627 3300037471 Unclassified 662
144 Ga0395901_0015341 3300038443 Bacteria 7797
145 Ga0395901_0352710 3300038443 Bacteria 1518
146 Ga0395901_1940987 3300038443 Bacteria 536
147 Ga0436365_0379180 3300039437 Bacteria 1218
148 Ga0436365_1368064 3300039437 Bacteria 3997
149 Ga0436363_1717800 3300039450 Bacteria 1388
150 Ga0495603_0206920 3300046455 Bacteria 1134
151 Ga0495590_0195715 3300046457 Bacteria 742
152 Ga0495625_0120704 3300046660 Bacteria 1784
153 Ga0495649_0306553 3300046694 Bacteria 808
154 Ga0495649_0457268 3300046694 Bacteria 637
155 Ga0496101_0994772 3300048904 Bacteria 660
156 Ga0496104_0306337 3300048907 Bacteria 1501
157 Ga0496114_0560733 3300048917 Bacteria 1009
158 Ga0501291_154409 3300049514 Unclassified 521
159 Ga0501292_001914 3300049515 Bacteria 2621
160 Ga0501299_038048 3300049522 Unclassified 955
161 Ga0501033_0956791 3300049570 Bacteria 574
162 Ga0501034_0141218 3300049571 Bacteria 2388
163 Ga0501034_0515302 3300049571 Bacteria 1108
164 Ga0501036_0240076 3300049572 Bacteria 1520
165 Ga0501037_0745317 3300049573 Bacteria 649
166 Ga0501043_0131266 3300049579 Bacteria 1963
167 Ga0501043_0682674 3300049579 Bacteria 752
168 Ga0501046_0134335 3300049580 Bacteria 1875
169 Ga0501047_0104636 3300049581 Bacteria 2710
170 Ga0501047_0107043 3300049581 Bacteria 2677
171 Ga0501067_0060310 3300049583 Bacteria 2100
172 Ga0501068_0123646 3300049584 Bacteria 1615
173 Ga0501068_0254481 3300049584 Bacteria 1120
174 Ga0501068_0585360 3300049584 Bacteria 727
175 Ga0501069_0045281 3300049585 Bacteria 2437
176 Ga0501069_0729652 3300049585 Bacteria 598
177 Ga0501070_0024354 3300049586 Bacteria 5077
178 Ga0501070_0157887 3300049586 Bacteria 1870
179 Ga0501070_0267215 3300049586 Bacteria 1397
180 Ga0501070_0776761 3300049586 Bacteria 753
181 Ga0501072_0405612 3300049588 Unclassified 1081
182 Ga0501073_0558245 3300049589 Bacteria 791
183 Ga0501074_0116431 3300049590 Bacteria 1912
184 Ga0501074_0145671 3300049590 Bacteria 1694
185 Ga0501202_007249 3300049652 Unclassified 2001
186 Ga0501209_030908 3300049656 Unclassified 1357
187 Ga0501209_257655 3300049656 Unclassified 546
188 Ga0501216_011499 3300049660 Unclassified 1439
189 Ga0501217_064810 3300049661 Bacteria 983
190 Ga0501224_045968 3300049664 Unclassified 664
191 Ga0501227_007712 3300049665 Bacteria 2308
192 Ga0501230_001197 3300049667 Bacteria 3029
193 Ga0501233_002924 3300049668 Bacteria 3047
194 Ga0501235_128105 3300049669 Unclassified 640
195 Ga0501249_040914 3300049679 Bacteria 1051
196 Ga0501221_245961 3300049704 Unclassified 512
197 Ga0501225_0030170 3300049705 Unclassified 1491
198 Ga0501080_0351130 3300049742 Bacteria 1332
199 Ga0501083_0117365 3300049744 Bacteria 1746
200 Ga0501035_0348374 3300049822 Bacteria 1240
201 Ga0501044_0063269 3300049823 Bacteria 3780
202 nmdc:mga09592_5486_c1 3300050508 Bacteria 10314
203 nmdc:mga09592_5923_c1 3300050508 Bacteria 9964
204 nmdc:mga0qj67_888808_c1 3300050509 Bacteria 702
205 nmdc:mga06r32_318411_c1 3300050510 Bacteria 1541
206 nmdc:mga08y16_286895_c1 3300050511 Unclassified 1697
207 nmdc:mga0rr50_1380574_c1 3300050513 Bacteria 597
208 Ga0500635_0003573 3300053080 Bacteria 3927
209 Ga0500578_0158709 3300053086 Bacteria 1405
210 Ga0500583_0423810 3300053092 Unclassified 635
211 Ga0500566_0001160 3300053094 Bacteria 15322
212 Ga0500566_0004252 3300053094 Bacteria 8546
213 Ga0500566_0108826 3300053094 Bacteria 1509
214 Ga0500640_006527 3300053095 Bacteria 4462
215 Ga0500553_183049 3300053101 Unclassified 748
216 Ga0500554_000424 3300053102 Bacteria 8870
217 Ga0500554_238739 3300053102 Bacteria 601
218 Ga0500572_001055 3300053111 Bacteria 8184
219 Ga0500595_000145 3300053119 Bacteria 46383
220 Ga0500597_011555 3300053120 Bacteria 3200
221 Ga0500597_018566 3300053120 Bacteria 2699
222 Ga0500607_143694 3300053121 Bacteria 1118
223 Ga0500614_001272 3300053123 Bacteria 6100
224 Ga0500614_007408 3300053123 Bacteria 2313
225 Ga0500614_103025 3300053123 Bacteria 825
226 Ga0500617_289128 3300053124 Bacteria 523
227 Ga0500642_0010480 3300053130 Bacteria 3270
228 Ga0500658_0211987 3300053134 Bacteria 887
229 Ga0500559_0004306 3300053136 Bacteria 6801
230 Ga0500564_164245 3300053138 Bacteria 938
231 Ga0500568_0058188 3300053139 Bacteria 1502
232 Ga0500585_029399 3300053144 Bacteria 1879
233 Ga0500603_007739 3300053150 Bacteria 2365
234 Ga0500619_097927 3300053154 Bacteria 994
235 Ga0500636_0020191 3300053177 Bacteria 3942
236 Ga0500636_0237279 3300053177 Bacteria 939
237 Ga0500637_0053104 3300053178 Bacteria 2313
238 Ga0500637_0111181 3300053178 Bacteria 1589
239 Ga0500637_0234165 3300053178 Unclassified 1033
240 Ga0500601_027978 3300053737 Unclassified 664
241 Ga0500601_044095 3300053737 Bacteria 547
242 Ga0501084_0233455 3300054114 Bacteria 1553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100621850 Ga0097621_1006218502 118
2 3300006846 Ga0075430_100180664 Ga0075430_1001806641 118
3 3300006847 Ga0075431_100324063 Ga0075431_1003240633 118
4 3300006880 Ga0075429_100006189 Ga0075429_1000061894 118
5 3300009094 Ga0111539_10282690 Ga0111539_102826903 118
6 3300027907 Ga0207428_10740209 Ga0207428_107402092 118
7 3300050508 nmdc:mga09592_5923_c1 nmdc:mga09592_5923_c1_7876_8235 118
8 3300050509 nmdc:mga0qj67_888808_c1 nmdc:mga0qj67_888808_c1_262_621 118
9 3300050510 nmdc:mga06r32_318411_c1 nmdc:mga06r32_318411_c1_202_561 118
10 3300050511 nmdc:mga08y16_286895_c1 nmdc:mga08y16_286895_c1_448_810 118
11 3300005367 Ga0070667_100064951 Ga0070667_1000649514 120
12 3300006880 Ga0075429_100549899 Ga0075429_1005498992 120
13 3300006881 Ga0068865_101461930 Ga0068865_1014619302 120
14 3300007076 Ga0075435_100159751 Ga0075435_1001597512 120
15 3300025938 Ga0207704_10571171 Ga0207704_105711712 120
16 3300025986 Ga0207658_10047608 Ga0207658_100476083 120
17 3300026023 Ga0207677_11511930 Ga0207677_115119302 120
18 3300031507 Ga0307509_10000111 Ga0307509_1000011122 120
19 3300031730 Ga0307516_10030604 Ga0307516_100306042 120
20 3300031730 Ga0307516_10097810 Ga0307516_100978102 120
21 3300035113 Ga0373936_0000005 Ga0373936_0000005_74357_74722 120
22 3300039437 Ga0436365_0379180 Ga0436365_0379180_487_852 120
23 3300039450 Ga0436363_1717800 Ga0436363_1717800_426_791 120
24 3300046694 Ga0495649_0306553 Ga0495649_0306553_372_737 120
25 3300049571 Ga0501034_0141218 Ga0501034_0141218_1209_1574 120
26 3300049583 Ga0501067_0060310 Ga0501067_0060310_1317_1682 120
27 3300049584 Ga0501068_0123646 Ga0501068_0123646_986_1351 120
28 3300049585 Ga0501069_0045281 Ga0501069_0045281_295_660 120
29 3300049586 Ga0501070_0024354 Ga0501070_0024354_3544_3909 120
30 3300049588 Ga0501072_0405612 Ga0501072_0405612_448_813 120
31 3300049590 Ga0501074_0145671 Ga0501074_0145671_96_461 120
32 3300049744 Ga0501083_0117365 Ga0501083_0117365_320_685 120
33 3300050508 nmdc:mga09592_5486_c1 nmdc:mga09592_5486_c1_428_793 120
34 3300053080 Ga0500635_0003573 Ga0500635_0003573_3000_3365 120
35 3300053086 Ga0500578_0158709 Ga0500578_0158709_798_1163 120
36 3300053094 Ga0500566_0001160 Ga0500566_0001160_9094_9459 120
37 3300053094 Ga0500566_0004252 Ga0500566_0004252_6323_6688 120
38 3300053095 Ga0500640_006527 Ga0500640_006527_3630_3995 120
39 3300053102 Ga0500554_000424 Ga0500554_000424_5488_5853 120
40 3300053102 Ga0500554_238739 Ga0500554_238739_27_392 120
41 3300053111 Ga0500572_001055 Ga0500572_001055_463_828 120
42 3300053119 Ga0500595_000145 Ga0500595_000145_25879_26244 120
43 3300053120 Ga0500597_018566 Ga0500597_018566_515_880 120
44 3300053121 Ga0500607_143694 Ga0500607_143694_406_771 120
45 3300053123 Ga0500614_001272 Ga0500614_001272_5037_5402 120
46 3300053123 Ga0500614_103025 Ga0500614_103025_351_716 120
47 3300053130 Ga0500642_0010480 Ga0500642_0010480_415_780 120
48 3300053134 Ga0500658_0211987 Ga0500658_0211987_372_737 120
49 3300053136 Ga0500559_0004306 Ga0500559_0004306_5114_5479 120
50 3300053138 Ga0500564_164245 Ga0500564_164245_242_607 120
51 3300053144 Ga0500585_029399 Ga0500585_029399_651_1016 120
52 3300053150 Ga0500603_007739 Ga0500603_007739_608_973 120
53 3300053154 Ga0500619_097927 Ga0500619_097927_99_464 120
54 3300053178 Ga0500637_0111181 Ga0500637_0111181_1154_1519 120
55 3300053737 Ga0500601_027978 Ga0500601_027978_112_477 120
56 3300053737 Ga0500601_044095 Ga0500601_044095_21_386 120
57 3300005331 Ga0070670_100740580 Ga0070670_1007405802 121
58 3300005331 Ga0070670_101507322 Ga0070670_1015073222 121
59 3300005336 Ga0070680_100059017 Ga0070680_1000590173 121
60 3300005337 Ga0070682_100679755 Ga0070682_1006797552 121
61 3300005338 Ga0068868_101346480 Ga0068868_1013464802 121
62 3300005340 Ga0070689_100032006 Ga0070689_1000320064 121
63 3300005439 Ga0070711_100482803 Ga0070711_1004828032 121
64 3300005456 Ga0070678_100002853 Ga0070678_1000028537 121
65 3300005458 Ga0070681_10141329 Ga0070681_101413293 121
66 3300005467 Ga0070706_100035278 Ga0070706_1000352783 121
67 3300005471 Ga0070698_100001138 Ga0070698_1000011383 121
68 3300005530 Ga0070679_100033128 Ga0070679_1000331284 121
69 3300005530 Ga0070679_100826426 Ga0070679_1008264262 121
70 3300005530 Ga0070679_101287415 Ga0070679_1012874151 121
71 3300005535 Ga0070684_100027448 Ga0070684_1000274487 121
72 3300005535 Ga0070684_100438751 Ga0070684_1004387512 121
73 3300005535 Ga0070684_100927930 Ga0070684_1009279302 121
74 3300005539 Ga0068853_101685547 Ga0068853_1016855472 121
75 3300005614 Ga0068856_100014588 Ga0068856_1000145885 121
76 3300005614 Ga0068856_101287556 Ga0068856_1012875561 121
77 3300005616 Ga0068852_100650843 Ga0068852_1006508432 121
78 3300005617 Ga0068859_100918798 Ga0068859_1009187982 121
79 3300006358 Ga0068871_100356971 Ga0068871_1003569711 121
80 3300006846 Ga0075430_100516745 Ga0075430_1005167452 121
81 3300006931 Ga0097620_100918850 Ga0097620_1009188502 121
82 3300009098 Ga0105245_10000223 Ga0105245_100002232 121
83 3300009098 Ga0105245_11246341 Ga0105245_112463411 121
84 3300009545 Ga0105237_10417004 Ga0105237_104170042 121
85 3300010375 Ga0105239_10280223 Ga0105239_102802233 121
86 3300011119 Ga0105246_12401696 Ga0105246_124016961 121
87 3300014969 Ga0157376_10005449 Ga0157376_1000544910 121
88 3300014969 Ga0157376_11629181 Ga0157376_116291812 121
89 3300021384 Ga0213876_10031332 Ga0213876_100313323 121
90 3300025910 Ga0207684_10115316 Ga0207684_101153161 121
91 3300025912 Ga0207707_11071675 Ga0207707_110716751 121
92 3300025914 Ga0207671_10343886 Ga0207671_103438862 121
93 3300025917 Ga0207660_10055238 Ga0207660_100552383 121
94 3300025917 Ga0207660_10366554 Ga0207660_103665543 121
95 3300025921 Ga0207652_10035724 Ga0207652_100357245 121
96 3300025921 Ga0207652_10613013 Ga0207652_106130132 121
97 3300025921 Ga0207652_10839520 Ga0207652_108395202 121
98 3300025927 Ga0207687_10000120 Ga0207687_1000012024 121
99 3300025936 Ga0207670_10031316 Ga0207670_100313163 121
100 3300026078 Ga0207702_10069770 Ga0207702_100697704 121
101 3300026078 Ga0207702_10849886 Ga0207702_108498862 121
102 3300026121 Ga0207683_10002224 Ga0207683_100022246 121
103 3300026142 Ga0207698_12022357 Ga0207698_120223572 121
104 3300028379 Ga0268266_10004111 Ga0268266_1000411112 121
105 3300028800 Ga0265338_10047162 Ga0265338_100471623 121
106 3300028800 Ga0265338_10097142 Ga0265338_100971423 121
107 3300031507 Ga0307509_10004236 Ga0307509_1000423622 121
108 3300031711 Ga0265314_10255848 Ga0265314_102558482 121
109 3300031711 Ga0265314_10538321 Ga0265314_105383212 121
110 3300035171 Ga0373946_0540501 Ga0373946_0540501_119_499 121
111 3300037312 Ga0395899_0003091 Ga0395899_0003091_7845_8213 121
112 3300037418 Ga0395900_0021997 Ga0395900_0021997_1088_1456 121
113 3300037471 Ga0395905_0313897 Ga0395905_0313897_923_1291 121
114 3300037471 Ga0395905_1201627 Ga0395905_1201627_92_460 121
115 3300038443 Ga0395901_0015341 Ga0395901_0015341_5855_6223 121
116 3300038443 Ga0395901_0352710 Ga0395901_0352710_138_506 121
117 3300038443 Ga0395901_1940987 Ga0395901_1940987_39_407 121
118 3300039437 Ga0436365_1368064 Ga0436365_1368064_2054_2422 121
119 3300048907 Ga0496104_0306337 Ga0496104_0306337_347_715 121
120 3300048917 Ga0496114_0560733 Ga0496114_0560733_511_879 121
121 3300049514 Ga0501291_154409 Ga0501291_154409_92_460 121
122 3300049515 Ga0501292_001914 Ga0501292_001914_1449_1817 121
123 3300049522 Ga0501299_038048 Ga0501299_038048_390_758 121
124 3300049570 Ga0501033_0956791 Ga0501033_0956791_18_386 121
125 3300049571 Ga0501034_0515302 Ga0501034_0515302_130_498 121
126 3300049572 Ga0501036_0240076 Ga0501036_0240076_447_815 121
127 3300049573 Ga0501037_0745317 Ga0501037_0745317_195_563 121
128 3300049579 Ga0501043_0131266 Ga0501043_0131266_392_760 121
129 3300049579 Ga0501043_0682674 Ga0501043_0682674_291_659 121
130 3300049580 Ga0501046_0134335 Ga0501046_0134335_41_409 121
131 3300049581 Ga0501047_0104636 Ga0501047_0104636_2112_2480 121
132 3300049581 Ga0501047_0107043 Ga0501047_0107043_122_490 121
133 3300049584 Ga0501068_0254481 Ga0501068_0254481_468_836 121
134 3300049584 Ga0501068_0585360 Ga0501068_0585360_278_646 121
135 3300049585 Ga0501069_0729652 Ga0501069_0729652_198_578 121
136 3300049586 Ga0501070_0157887 Ga0501070_0157887_347_715 121
137 3300049586 Ga0501070_0267215 Ga0501070_0267215_1000_1368 121
138 3300049586 Ga0501070_0776761 Ga0501070_0776761_188_556 121
139 3300049589 Ga0501073_0558245 Ga0501073_0558245_50_418 121
140 3300049590 Ga0501074_0116431 Ga0501074_0116431_919_1287 121
141 3300049652 Ga0501202_007249 Ga0501202_007249_964_1332 121
142 3300049656 Ga0501209_030908 Ga0501209_030908_314_682 121
143 3300049656 Ga0501209_257655 Ga0501209_257655_83_451 121
144 3300049660 Ga0501216_011499 Ga0501216_011499_519_887 121
145 3300049661 Ga0501217_064810 Ga0501217_064810_41_409 121
146 3300049664 Ga0501224_045968 Ga0501224_045968_237_605 121
147 3300049665 Ga0501227_007712 Ga0501227_007712_551_919 121
148 3300049667 Ga0501230_001197 Ga0501230_001197_1392_1760 121
149 3300049668 Ga0501233_002924 Ga0501233_002924_1301_1669 121
150 3300049669 Ga0501235_128105 Ga0501235_128105_81_449 121
151 3300049679 Ga0501249_040914 Ga0501249_040914_126_494 121
152 3300049704 Ga0501221_245961 Ga0501221_245961_91_459 121
153 3300049705 Ga0501225_0030170 Ga0501225_0030170_556_924 121
154 3300049742 Ga0501080_0351130 Ga0501080_0351130_392_760 121
155 3300049822 Ga0501035_0348374 Ga0501035_0348374_186_554 121
156 3300049823 Ga0501044_0063269 Ga0501044_0063269_1118_1486 121
157 3300054114 Ga0501084_0233455 Ga0501084_0233455_158_526 121
158 3300005329 Ga0070683_100866279 Ga0070683_1008662792 122
159 3300005334 Ga0068869_100042573 Ga0068869_1000425733 122
160 3300005340 Ga0070689_100047788 Ga0070689_1000477883 122
161 3300005343 Ga0070687_100814515 Ga0070687_1008145151 122
162 3300005345 Ga0070692_10136061 Ga0070692_101360612 122
163 3300005438 Ga0070701_10024386 Ga0070701_100243862 122
164 3300005440 Ga0070705_101568112 Ga0070705_1015681121 122
165 3300005445 Ga0070708_100498923 Ga0070708_1004989232 122
166 3300005466 Ga0070685_10547130 Ga0070685_105471301 122
167 3300005468 Ga0070707_100652186 Ga0070707_1006521862 122
168 3300005535 Ga0070684_100173256 Ga0070684_1001732562 122
169 3300005618 Ga0068864_100976442 Ga0068864_1009764422 122
170 3300005718 Ga0068866_10087153 Ga0068866_100871532 122
171 3300005718 Ga0068866_10748382 Ga0068866_107483822 122
172 3300005840 Ga0068870_10238830 Ga0068870_102388302 122
173 3300005840 Ga0068870_10352539 Ga0068870_103525393 122
174 3300005841 Ga0068863_100092274 Ga0068863_1000922743 122
175 3300005841 Ga0068863_100219153 Ga0068863_1002191532 122
176 3300005841 Ga0068863_102378028 Ga0068863_1023780281 122
177 3300005843 Ga0068860_100090682 Ga0068860_1000906822 122
178 3300005937 Ga0081455_10384421 Ga0081455_103844212 122
179 3300006028 Ga0070717_10154621 Ga0070717_101546213 122
180 3300006028 Ga0070717_10286619 Ga0070717_102866192 122
181 3300006237 Ga0097621_101059014 Ga0097621_1010590142 122
182 3300006931 Ga0097620_101505109 Ga0097620_1015051092 122
183 3300007076 Ga0075435_101267996 Ga0075435_1012679962 122
184 3300009098 Ga0105245_10815276 Ga0105245_108152762 122
185 3300009148 Ga0105243_10412053 Ga0105243_104120532 122
186 3300009174 Ga0105241_10309586 Ga0105241_103095863 122
187 3300009176 Ga0105242_10503008 Ga0105242_105030082 122
188 3300014325 Ga0163163_11871731 Ga0163163_118717311 122
189 3300025899 Ga0207642_10067142 Ga0207642_100671423 122
190 3300025911 Ga0207654_10816586 Ga0207654_108165862 122
191 3300025918 Ga0207662_10182607 Ga0207662_101826074 122
192 3300025922 Ga0207646_10573280 Ga0207646_105732802 122
193 3300025934 Ga0207686_10245750 Ga0207686_102457502 122
194 3300025936 Ga0207670_10030775 Ga0207670_100307753 122
195 3300025936 Ga0207670_10046719 Ga0207670_100467191 122
196 3300025942 Ga0207689_10027406 Ga0207689_100274063 122
197 3300025942 Ga0207689_10118102 Ga0207689_101181022 122
198 3300025942 Ga0207689_10955267 Ga0207689_109552672 122
199 3300025944 Ga0207661_10982174 Ga0207661_109821742 122
200 3300026035 Ga0207703_11377892 Ga0207703_113778921 122
201 3300026075 Ga0207708_10314338 Ga0207708_103143383 122
202 3300026088 Ga0207641_10304454 Ga0207641_103044542 122
203 3300026088 Ga0207641_10366729 Ga0207641_103667292 122
204 3300026088 Ga0207641_12173512 Ga0207641_121735122 122
205 3300026118 Ga0207675_100229286 Ga0207675_1002292862 122
206 3300028381 Ga0268264_11123040 Ga0268264_111230402 122
207 3300028381 Ga0268264_11947230 Ga0268264_119472302 122
208 3300028794 Ga0307515_10025712 Ga0307515_100257126 122
209 3300030521 Ga0307511_10208159 Ga0307511_102081591 122
210 3300031238 Ga0265332_10005666 Ga0265332_100056662 122
211 3300031456 Ga0307513_10091917 Ga0307513_100919172 122
212 3300031456 Ga0307513_10429310 Ga0307513_104293102 122
213 3300031507 Ga0307509_10031864 Ga0307509_100318644 122
214 3300031507 Ga0307509_10075203 Ga0307509_100752035 122
215 3300031507 Ga0307509_10207687 Ga0307509_102076873 122
216 3300031616 Ga0307508_10090060 Ga0307508_100900602 122
217 3300031616 Ga0307508_10510091 Ga0307508_105100912 122
218 3300034819 Ga0373958_0167301 Ga0373958_0167301_160_549 122
219 3300035090 Ga0373949_0000045 Ga0373949_0000045_17092_17463 122
220 3300035091 Ga0373951_0192048 Ga0373951_0192048_177_566 122
221 3300035114 Ga0373939_0081662 Ga0373939_0081662_668_1057 122
222 3300035119 Ga0373956_0077692 Ga0373956_0077692_750_1121 122
223 3300035121 Ga0373960_0321715 Ga0373960_0321715_122_520 122
224 3300035241 Ga0373961_0000039 Ga0373961_0000039_4486_4857 122
225 3300035691 Ga0373931_0394879 Ga0373931_0394879_126_497 122
226 3300046455 Ga0495603_0206920 Ga0495603_0206920_257_628 122
227 3300046457 Ga0495590_0195715 Ga0495590_0195715_202_600 122
228 3300046660 Ga0495625_0120704 Ga0495625_0120704_733_1104 122
229 3300046694 Ga0495649_0457268 Ga0495649_0457268_197_577 122
230 3300048904 Ga0496101_0994772 Ga0496101_0994772_215_592 122
231 3300050513 nmdc:mga0rr50_1380574_c1 nmdc:mga0rr50_1380574_c1_136_507 122
232 3300053092 Ga0500583_0423810 Ga0500583_0423810_110_481 122
233 3300053094 Ga0500566_0108826 Ga0500566_0108826_1010_1381 122
234 3300053101 Ga0500553_183049 Ga0500553_183049_304_675 122
235 3300053120 Ga0500597_011555 Ga0500597_011555_1778_2149 122
236 3300053123 Ga0500614_007408 Ga0500614_007408_489_860 122
237 3300053124 Ga0500617_289128 Ga0500617_289128_94_465 122
238 3300053139 Ga0500568_0058188 Ga0500568_0058188_275_652 122
239 3300053177 Ga0500636_0020191 Ga0500636_0020191_218_589 122
240 3300053177 Ga0500636_0237279 Ga0500636_0237279_287_658 122
241 3300053178 Ga0500637_0053104 Ga0500637_0053104_323_694 122
242 3300053178 Ga0500637_0234165 Ga0500637_0234165_118_489 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h5n-assembly1.cif.gz_B crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.5199 5 104
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.4849 3 117
2h5n-assembly1.cif.gz_C crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.4775 5 114
4j7z-assembly3.cif.gz_C thermus thermophilus dnaj j- and g/f-domains 0.4767 57 122
2h5n-assembly1.cif.gz_A crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.4697 5 113
ID Description Score Start End Superfamily
af_Q9M2M2_56_121_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.8545 68 116 1.10.1240.40
af_A4I0E6_190_298_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7921 58 117 1.10.3680.10
af_A0A0B4LEZ3_582_737_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6651 60 116 1.25.10.10
af_Q91WU4_1_181_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.6618 5 117 1.10.3680.10
af_Q9M2M2_56_121_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.643 68 116 1.10.1240.40
ID Description Score Start End GO Terms
AF-A0A2S9YGL5-F1-model_v4 Tellurite resistance protein TerB 0.9085 1 113
AF-A0A2S9Y610-F1-model_v4 Tellurite resistance protein TerB 0.8904 1 109
AF-A0A7J5ERU9-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.8873 1 122
AF-A0A7J5ERU9-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.8806 1 122
AF-A0A3M2DHS5-F1-model_v4 TerB family tellurite resistance protein 0.8716 1 121

Feature Viewer

pLDDT pTM Quality
85.4 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map