F354488
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 163 | 242 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100006461|Ga0070665_1000064617 |
| Length | 238 |
| Sequence | MSRAPRPRWAPLSHMAFGLTASGGGCEKGAMSRPLVVGIAGGTGSGKSTVANKLASAIPHGRCVTLDHDAYYRAQSHLSFDERARLNYDHPSSLETELLVAHLRALREGRAVEVPIYDFAHHDRRPETRRVEPAPVIVVEGILVFVDPQLREQMDVKIFVDTDADIRLMRRIRRDLEQRGRSFQSVRDQYYATVRPMHIEHVEPSKRWADLIVPEGGDNHVALDVLLGRLGRIAFGNE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 79 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 82 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 86 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 87 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 88 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 89 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 91 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 92 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 93 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 94 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 95 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 97 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 99 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 100 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 113 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 114 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 115 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 142 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 143 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 144 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 152 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 153 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 154 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 155 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 156 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 157 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 158 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 161 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 162 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 163 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 0 |
| Rhizoplane | 1.24 |
| Rhizosphere | 86.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10175143 | 3300003320 | Bacteria | 1151 |
| 2 | Ga0070658_10803503 | 3300005327 | Bacteria | 817 |
| 3 | Ga0070683_100181482 | 3300005329 | Bacteria | 1998 |
| 4 | Ga0068869_100018572 | 3300005334 | Bacteria | 4735 |
| 5 | Ga0070680_100074748 | 3300005336 | Bacteria | 2789 |
| 6 | Ga0070682_100159119 | 3300005337 | Bacteria | 1558 |
| 7 | Ga0068868_100249072 | 3300005338 | Bacteria | 1495 |
| 8 | Ga0068868_100403619 | 3300005338 | Bacteria | 1180 |
| 9 | Ga0070689_100020157 | 3300005340 | Bacteria | 4944 |
| 10 | Ga0070689_100195058 | 3300005340 | Bacteria | 1650 |
| 11 | Ga0070691_10050796 | 3300005341 | Bacteria | 1979 |
| 12 | Ga0070675_100019908 | 3300005354 | Bacteria | 5353 |
| 13 | Ga0070675_100215426 | 3300005354 | Bacteria | 1671 |
| 14 | Ga0070688_100089831 | 3300005365 | Bacteria | 2005 |
| 15 | Ga0070688_100518480 | 3300005365 | Bacteria | 902 |
| 16 | Ga0070667_100281945 | 3300005367 | Bacteria | 1492 |
| 17 | Ga0070703_10053417 | 3300005406 | Bacteria | 1299 |
| 18 | Ga0070700_100481581 | 3300005441 | Bacteria | 951 |
| 19 | Ga0070694_100215791 | 3300005444 | Bacteria | 1437 |
| 20 | Ga0070694_100569286 | 3300005444 | Bacteria | 909 |
| 21 | Ga0070708_100030230 | 3300005445 | Bacteria | 4682 |
| 22 | Ga0070678_100017701 | 3300005456 | Bacteria | 4597 |
| 23 | Ga0070678_100276313 | 3300005456 | Bacteria | 1419 |
| 24 | Ga0070681_10266167 | 3300005458 | Bacteria | 1626 |
| 25 | Ga0068867_100504960 | 3300005459 | Bacteria | 1040 |
| 26 | Ga0068867_100930023 | 3300005459 | Bacteria | 784 |
| 27 | Ga0070706_100944682 | 3300005467 | Bacteria | 796 |
| 28 | Ga0070707_100236520 | 3300005468 | Bacteria | 1778 |
| 29 | Ga0070698_100002720 | 3300005471 | Bacteria | 19442 |
| 30 | Ga0070698_100240931 | 3300005471 | Bacteria | 1742 |
| 31 | Ga0070698_100514640 | 3300005471 | Bacteria | 1135 |
| 32 | Ga0070699_100824852 | 3300005518 | Bacteria | 849 |
| 33 | Ga0070679_100000979 | 3300005530 | Bacteria | 24893 |
| 34 | Ga0070679_100002363 | 3300005530 | Bacteria | 17106 |
| 35 | Ga0070679_100019010 | 3300005530 | Bacteria | 6673 |
| 36 | Ga0070679_100089542 | 3300005530 | Bacteria | 3064 |
| 37 | Ga0070684_100158267 | 3300005535 | Bacteria | 2054 |
| 38 | Ga0070684_100371290 | 3300005535 | Bacteria | 1317 |
| 39 | Ga0070697_100341530 | 3300005536 | Bacteria | 1292 |
| 40 | Ga0070665_100006461 | 3300005548 | Bacteria | 11931 |
| 41 | Ga0068855_100191744 | 3300005563 | Bacteria | 2305 |
| 42 | Ga0068855_100791079 | 3300005563 | Bacteria | 1009 |
| 43 | Ga0068857_100458425 | 3300005577 | Bacteria | 1193 |
| 44 | Ga0068856_100062667 | 3300005614 | Bacteria | 3673 |
| 45 | Ga0068864_100750834 | 3300005618 | Bacteria | 956 |
| 46 | Ga0068864_101230009 | 3300005618 | Bacteria | 748 |
| 47 | Ga0068861_100198053 | 3300005719 | Bacteria | 1684 |
| 48 | Ga0068861_100295260 | 3300005719 | Bacteria | 1401 |
| 49 | Ga0068861_100398961 | 3300005719 | Bacteria | 1220 |
| 50 | Ga0068863_100152845 | 3300005841 | Bacteria | 2209 |
| 51 | Ga0068858_100989547 | 3300005842 | Bacteria | 824 |
| 52 | Ga0081455_10316718 | 3300005937 | Bacteria | 1113 |
| 53 | Ga0070717_10482459 | 3300006028 | Bacteria | 1119 |
| 54 | Ga0068871_100294038 | 3300006358 | Bacteria | 1424 |
| 55 | Ga0075430_100254410 | 3300006846 | Bacteria | 1455 |
| 56 | Ga0075431_100107176 | 3300006847 | Bacteria | 2883 |
| 57 | Ga0075431_100488004 | 3300006847 | Bacteria | 1224 |
| 58 | Ga0075434_100688725 | 3300006871 | Bacteria | 1040 |
| 59 | Ga0075429_100121451 | 3300006880 | Bacteria | 2283 |
| 60 | Ga0075429_100170293 | 3300006880 | Bacteria | 1907 |
| 61 | Ga0075435_100266230 | 3300007076 | Bacteria | 1461 |
| 62 | Ga0111539_10002977 | 3300009094 | Bacteria | 22469 |
| 63 | Ga0111539_10417147 | 3300009094 | Bacteria | 1563 |
| 64 | Ga0105245_10003579 | 3300009098 | Bacteria | 13866 |
| 65 | Ga0105245_10047054 | 3300009098 | Bacteria | 3856 |
| 66 | Ga0105243_10962099 | 3300009148 | Bacteria | 854 |
| 67 | Ga0105248_10934121 | 3300009177 | Bacteria | 980 |
| 68 | Ga0105237_10593710 | 3300009545 | Bacteria | 1114 |
| 69 | Ga0105238_10949694 | 3300009551 | Bacteria | 879 |
| 70 | Ga0105238_11290927 | 3300009551 | Bacteria | 756 |
| 71 | Ga0105249_10232943 | 3300009553 | Bacteria | 1817 |
| 72 | Ga0105249_10259450 | 3300009553 | Bacteria | 1726 |
| 73 | Ga0105239_10793258 | 3300010375 | Bacteria | 1085 |
| 74 | Ga0157371_10813913 | 3300013102 | Bacteria | 704 |
| 75 | Ga0157378_10254610 | 3300013297 | Bacteria | 1682 |
| 76 | Ga0157378_10409912 | 3300013297 | Bacteria | 1337 |
| 77 | Ga0157372_10527139 | 3300013307 | Bacteria | 1377 |
| 78 | Ga0163163_10596092 | 3300014325 | Bacteria | 1168 |
| 79 | Ga0157376_10223165 | 3300014969 | Bacteria | 1746 |
| 80 | Ga0157376_10460815 | 3300014969 | Bacteria | 1242 |
| 81 | Ga0213876_10025058 | 3300021384 | Bacteria | 3149 |
| 82 | Ga0213876_10259816 | 3300021384 | Bacteria | 923 |
| 83 | Ga0207705_10185472 | 3300025909 | Bacteria | 1571 |
| 84 | Ga0207705_10647230 | 3300025909 | Bacteria | 822 |
| 85 | Ga0207707_10162296 | 3300025912 | Bacteria | 1954 |
| 86 | Ga0207663_10720874 | 3300025916 | Bacteria | 791 |
| 87 | Ga0207660_10110123 | 3300025917 | Bacteria | 2071 |
| 88 | Ga0207660_10339101 | 3300025917 | Bacteria | 1203 |
| 89 | Ga0207662_10083883 | 3300025918 | Bacteria | 1949 |
| 90 | Ga0207662_10103139 | 3300025918 | Bacteria | 1770 |
| 91 | Ga0207652_10003089 | 3300025921 | Bacteria | 13894 |
| 92 | Ga0207652_10049328 | 3300025921 | Bacteria | 3603 |
| 93 | Ga0207652_10194747 | 3300025921 | Bacteria | 1823 |
| 94 | Ga0207659_10014891 | 3300025926 | Bacteria | 5027 |
| 95 | Ga0207687_10001578 | 3300025927 | Bacteria | 15686 |
| 96 | Ga0207687_10134828 | 3300025927 | Bacteria | 1866 |
| 97 | Ga0207670_10198049 | 3300025936 | Bacteria | 1524 |
| 98 | Ga0207704_10181569 | 3300025938 | Bacteria | 1521 |
| 99 | Ga0207711_10580502 | 3300025941 | Bacteria | 1046 |
| 100 | Ga0207661_10315097 | 3300025944 | Bacteria | 1405 |
| 101 | Ga0207712_10146664 | 3300025961 | Bacteria | 1817 |
| 102 | Ga0207677_10791805 | 3300026023 | Bacteria | 848 |
| 103 | Ga0207708_10381117 | 3300026075 | Bacteria | 1163 |
| 104 | Ga0207702_10124320 | 3300026078 | Bacteria | 2313 |
| 105 | Ga0207641_10153835 | 3300026088 | Bacteria | 2085 |
| 106 | Ga0207676_10569503 | 3300026095 | Bacteria | 1084 |
| 107 | Ga0207676_10594442 | 3300026095 | Bacteria | 1062 |
| 108 | Ga0207676_10885627 | 3300026095 | Bacteria | 875 |
| 109 | Ga0207674_10144874 | 3300026116 | Bacteria | 2334 |
| 110 | Ga0207674_10757103 | 3300026116 | Bacteria | 937 |
| 111 | Ga0207674_10858888 | 3300026116 | Bacteria | 875 |
| 112 | Ga0207675_100319884 | 3300026118 | Bacteria | 1514 |
| 113 | Ga0207675_100476662 | 3300026118 | Bacteria | 1240 |
| 114 | Ga0207683_10008054 | 3300026121 | Bacteria | 9011 |
| 115 | Ga0207683_10140694 | 3300026121 | Bacteria | 2174 |
| 116 | Ga0207428_10016398 | 3300027907 | Bacteria | 6373 |
| 117 | Ga0268266_10013403 | 3300028379 | Bacteria | 7060 |
| 118 | Ga0268264_10207822 | 3300028381 | Bacteria | 1795 |
| 119 | Ga0307515_10018598 | 3300028794 | Bacteria | 12556 |
| 120 | Ga0265338_10022434 | 3300028800 | Bacteria | 6535 |
| 121 | Ga0265338_10134969 | 3300028800 | Bacteria | 1942 |
| 122 | Ga0265332_10004035 | 3300031238 | Bacteria | 6979 |
| 123 | Ga0265327_10009262 | 3300031251 | Bacteria | 7141 |
| 124 | Ga0307513_10001098 | 3300031456 | Bacteria | 39150 |
| 125 | Ga0307509_10000042 | 3300031507 | Bacteria | 178442 |
| 126 | Ga0307509_10016950 | 3300031507 | Bacteria | 8402 |
| 127 | Ga0307509_10085929 | 3300031507 | Bacteria | 3236 |
| 128 | Ga0307509_10104680 | 3300031507 | Bacteria | 2854 |
| 129 | Ga0307509_10485139 | 3300031507 | Unclassified | 923 |
| 130 | Ga0307508_10281886 | 3300031616 | Bacteria | 1255 |
| 131 | Ga0307508_10461041 | 3300031616 | Bacteria | 864 |
| 132 | Ga0316579_10010687 | 3300031691 | Bacteria | 3886 |
| 133 | Ga0265314_10176227 | 3300031711 | Bacteria | 1286 |
| 134 | Ga0316576_10006857 | 3300031727 | Bacteria | 7119 |
| 135 | Ga0316577_10000093 | 3300031733 | Bacteria | 24144 |
| 136 | Ga0316577_10018007 | 3300031733 | Bacteria | 3905 |
| 137 | Ga0307415_100080442 | 3300032126 | Bacteria | 2325 |
| 138 | Ga0307415_100282588 | 3300032126 | Bacteria | 1365 |
| 139 | Ga0316585_10045618 | 3300032137 | Bacteria | 1402 |
| 140 | Ga0316580_10004154 | 3300032139 | Bacteria | 4174 |
| 141 | Ga0373950_0000012 | 3300034818 | Bacteria | 352408 |
| 142 | Ga0373949_0000058 | 3300035090 | Bacteria | 42184 |
| 143 | Ga0373923_0327819 | 3300035111 | Bacteria | 728 |
| 144 | Ga0373936_0000008 | 3300035113 | Bacteria | 268505 |
| 145 | Ga0373941_0004218 | 3300035115 | Bacteria | 3305 |
| 146 | Ga0373961_0000021 | 3300035241 | Bacteria | 100265 |
| 147 | Ga0316574_0279050 | 3300035398 | Bacteria | 1064 |
| 148 | Ga0373935_0188479 | 3300035692 | Bacteria | 1420 |
| 149 | Ga0373933_0000297 | 3300035724 | Bacteria | 32047 |
| 150 | Ga0373937_0032416 | 3300036401 | Bacteria | 4739 |
| 151 | Ga0373937_0605731 | 3300036401 | Bacteria | 1040 |
| 152 | Ga0316582_0016407 | 3300036647 | Bacteria | 4257 |
| 153 | Ga0316584_0000010 | 3300036712 | Bacteria | 65029 |
| 154 | Ga0316584_0008506 | 3300036712 | Bacteria | 7071 |
| 155 | Ga0395899_0056677 | 3300037312 | Bacteria | 2895 |
| 156 | Ga0395899_0342407 | 3300037312 | Bacteria | 1002 |
| 157 | Ga0395900_0134125 | 3300037418 | Bacteria | 2536 |
| 158 | Ga0395905_0068464 | 3300037471 | Bacteria | 3325 |
| 159 | Ga0395901_0017257 | 3300038443 | Bacteria | 7367 |
| 160 | Ga0436365_1283925 | 3300039437 | Bacteria | 3796 |
| 161 | Ga0436365_1343922 | 3300039437 | Bacteria | 1437 |
| 162 | Ga0436360_1180516 | 3300039438 | Bacteria | 854 |
| 163 | Ga0451853_0105965 | 3300041512 | Bacteria | 673 |
| 164 | Ga0451577_0000990 | 3300042876 | Bacteria | 41360 |
| 165 | Ga0451577_0004468 | 3300042876 | Bacteria | 14763 |
| 166 | Ga0451577_0053267 | 3300042876 | Bacteria | 3612 |
| 167 | Ga0451577_0096800 | 3300042876 | Bacteria | 2635 |
| 168 | Ga0453683_0020048 | 3300044673 | Bacteria | 4275 |
| 169 | Ga0453683_0099926 | 3300044673 | Bacteria | 1821 |
| 170 | Ga0466966_0009813 | 3300044684 | Bacteria | 6346 |
| 171 | Ga0453684_0003604 | 3300044712 | Bacteria | 34545 |
| 172 | Ga0453684_0073900 | 3300044712 | Bacteria | 4295 |
| 173 | Ga0453684_0107996 | 3300044712 | Bacteria | 3387 |
| 174 | Ga0453684_0115152 | 3300044712 | Bacteria | 3258 |
| 175 | Ga0453684_0221735 | 3300044712 | Bacteria | 2190 |
| 176 | Ga0466959_0024486 | 3300045049 | Bacteria | 4472 |
| 177 | Ga0451576_0122884 | 3300045051 | Bacteria | 2703 |
| 178 | Ga0451576_0181844 | 3300045051 | Bacteria | 2195 |
| 179 | Ga0451576_0319199 | 3300045051 | Bacteria | 1625 |
| 180 | Ga0451576_0662607 | 3300045051 | Bacteria | 1097 |
| 181 | Ga0466967_0441074 | 3300045976 | Bacteria | 1271 |
| 182 | Ga0495629_0126616 | 3300046459 | Bacteria | 1780 |
| 183 | Ga0495651_0110956 | 3300046462 | Bacteria | 2028 |
| 184 | Ga0495650_0036043 | 3300046471 | Bacteria | 2170 |
| 185 | Ga0495664_0019173 | 3300046477 | Bacteria | 3930 |
| 186 | Ga0495608_0240364 | 3300046511 | Bacteria | 1132 |
| 187 | Ga0495628_0049519 | 3300046516 | Bacteria | 3327 |
| 188 | Ga0495628_0234383 | 3300046516 | Bacteria | 1375 |
| 189 | Ga0495665_0328131 | 3300046531 | Bacteria | 781 |
| 190 | Ga0495635_0390950 | 3300046663 | Bacteria | 925 |
| 191 | Ga0495604_0493237 | 3300047317 | Bacteria | 795 |
| 192 | Ga0495684_0227874 | 3300047471 | Bacteria | 1364 |
| 193 | Ga0495684_0249459 | 3300047471 | Bacteria | 1292 |
| 194 | Ga0495686_0121609 | 3300047472 | Bacteria | 1555 |
| 195 | Ga0495602_0085155 | 3300048088 | Bacteria | 2643 |
| 196 | Ga0495602_0205809 | 3300048088 | Bacteria | 1498 |
| 197 | Ga0496112_0263036 | 3300048915 | Bacteria | 1674 |
| 198 | Ga0496114_0143989 | 3300048917 | Bacteria | 2065 |
| 199 | Ga0496114_0310649 | 3300048917 | Bacteria | 1392 |
| 200 | Ga0501034_0036322 | 3300049571 | Bacteria | 4992 |
| 201 | Ga0501034_0378355 | 3300049571 | Bacteria | 1341 |
| 202 | Ga0501046_0229011 | 3300049580 | Bacteria | 1374 |
| 203 | Ga0501047_0006811 | 3300049581 | Bacteria | 10739 |
| 204 | Ga0501047_0069160 | 3300049581 | Bacteria | 3400 |
| 205 | Ga0501069_0284356 | 3300049585 | Bacteria | 968 |
| 206 | Ga0501070_0081758 | 3300049586 | Bacteria | 2673 |
| 207 | Ga0501070_0091943 | 3300049586 | Bacteria | 2511 |
| 208 | Ga0501070_0109623 | 3300049586 | Bacteria | 2281 |
| 209 | Ga0501070_0287504 | 3300049586 | Bacteria | 1340 |
| 210 | Ga0501070_0743060 | 3300049586 | Bacteria | 773 |
| 211 | Ga0501070_0873335 | 3300049586 | Bacteria | 703 |
| 212 | Ga0501074_0026642 | 3300049590 | Bacteria | 4192 |
| 213 | Ga0501227_025391 | 3300049665 | Bacteria | 1389 |
| 214 | Ga0501221_036993 | 3300049704 | Bacteria | 1048 |
| 215 | Ga0501225_0005581 | 3300049705 | Bacteria | 3690 |
| 216 | Ga0501083_0149103 | 3300049744 | Bacteria | 1531 |
| 217 | Ga0501035_0355468 | 3300049822 | Bacteria | 1225 |
| 218 | Ga0501044_0039385 | 3300049823 | Bacteria | 4931 |
| 219 | Ga0501044_0216311 | 3300049823 | Bacteria | 1868 |
| 220 | Ga0501044_0369421 | 3300049823 | Bacteria | 1351 |
| 221 | nmdc:mga05p37_611264_c1 | 3300050507 | Bacteria | 1228 |
| 222 | nmdc:mga09592_38389_c1 | 3300050508 | Bacteria | 4020 |
| 223 | nmdc:mga06r32_38853_c1 | 3300050510 | Bacteria | 4512 |
| 224 | nmdc:mga06r32_608456_c1 | 3300050510 | Unclassified | 1063 |
| 225 | nmdc:mga06r32_676186_c1 | 3300050510 | Bacteria | 999 |
| 226 | nmdc:mga08y16_2414_c1 | 3300050511 | Bacteria | 19201 |
| 227 | nmdc:mga08y16_33928_c1 | 3300050511 | Bacteria | 5361 |
| 228 | Ga0500578_0021972 | 3300053086 | Bacteria | 4098 |
| 229 | Ga0500583_0231319 | 3300053092 | Bacteria | 915 |
| 230 | Ga0500566_0001530 | 3300053094 | Bacteria | 13585 |
| 231 | Ga0500566_0020547 | 3300053094 | Bacteria | 3881 |
| 232 | Ga0500566_0101116 | 3300053094 | Bacteria | 1580 |
| 233 | Ga0500594_0083504 | 3300053118 | Bacteria | 959 |
| 234 | Ga0500597_106097 | 3300053120 | Bacteria | 1221 |
| 235 | Ga0500614_022681 | 3300053123 | Bacteria | 1468 |
| 236 | Ga0500642_0005544 | 3300053130 | Bacteria | 4080 |
| 237 | Ga0500564_052346 | 3300053138 | Bacteria | 1866 |
| 238 | Ga0500568_0026214 | 3300053139 | Bacteria | 2449 |
| 239 | Ga0500603_001465 | 3300053150 | Bacteria | 5387 |
| 240 | Ga0500630_023595 | 3300053159 | Bacteria | 3038 |
| 241 | Ga0500638_083309 | 3300053162 | Bacteria | 1516 |
| 242 | Ga0500636_0064348 | 3300053177 | Bacteria | 2136 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025909 | Ga0207705_10647230 | Ga0207705_106472301 | 169 |
| 2 | 3300005937 | Ga0081455_10316718 | Ga0081455_103167182 | 181 |
| 3 | 3300044673 | Ga0453683_0099926 | Ga0453683_0099926_22_615 | 182 |
| 4 | 3300009551 | Ga0105238_10949694 | Ga0105238_109496941 | 187 |
| 5 | 3300046477 | Ga0495664_0019173 | Ga0495664_0019173_653_1315 | 187 |
| 6 | 3300046511 | Ga0495608_0240364 | Ga0495608_0240364_63_725 | 187 |
| 7 | 3300046516 | Ga0495628_0049519 | Ga0495628_0049519_263_925 | 187 |
| 8 | 3300047471 | Ga0495684_0249459 | Ga0495684_0249459_464_1126 | 187 |
| 9 | 3300005327 | Ga0070658_10803503 | Ga0070658_108035031 | 188 |
| 10 | 3300006028 | Ga0070717_10482459 | Ga0070717_104824591 | 188 |
| 11 | 3300010375 | Ga0105239_10793258 | Ga0105239_107932582 | 188 |
| 12 | 3300031456 | Ga0307513_10001098 | Ga0307513_1000109812 | 188 |
| 13 | 3300021384 | Ga0213876_10025058 | Ga0213876_100250583 | 189 |
| 14 | 3300039437 | Ga0436365_1283925 | Ga0436365_1283925_2404_3030 | 189 |
| 15 | 3300005336 | Ga0070680_100074748 | Ga0070680_1000747482 | 191 |
| 16 | 3300005530 | Ga0070679_100019010 | Ga0070679_1000190103 | 191 |
| 17 | 3300025909 | Ga0207705_10185472 | Ga0207705_101854723 | 191 |
| 18 | 3300025917 | Ga0207660_10110123 | Ga0207660_101101233 | 191 |
| 19 | 3300025921 | Ga0207652_10049328 | Ga0207652_100493284 | 191 |
| 20 | 3300005458 | Ga0070681_10266167 | Ga0070681_102661673 | 192 |
| 21 | 3300005530 | Ga0070679_100002363 | Ga0070679_10000236312 | 192 |
| 22 | 3300025917 | Ga0207660_10339101 | Ga0207660_103391012 | 192 |
| 23 | 3300025921 | Ga0207652_10003089 | Ga0207652_1000308911 | 192 |
| 24 | 3300053139 | Ga0500568_0026214 | Ga0500568_0026214_1320_1958 | 192 |
| 25 | 3300006880 | Ga0075429_100121451 | Ga0075429_1001214512 | 193 |
| 26 | 3300025926 | Ga0207659_10014891 | Ga0207659_100148912 | 193 |
| 27 | 3300031507 | Ga0307509_10016950 | Ga0307509_100169508 | 193 |
| 28 | 3300050511 | nmdc:mga08y16_33928_c1 | nmdc:mga08y16_33928_c1_1237_1857 | 193 |
| 29 | 3300013297 | Ga0157378_10254610 | Ga0157378_102546102 | 194 |
| 30 | 3300013307 | Ga0157372_10527139 | Ga0157372_105271392 | 194 |
| 31 | 3300014325 | Ga0163163_10596092 | Ga0163163_105960922 | 194 |
| 32 | 3300046516 | Ga0495628_0234383 | Ga0495628_0234383_164_766 | 194 |
| 33 | 3300047317 | Ga0495604_0493237 | Ga0495604_0493237_102_704 | 194 |
| 34 | 3300048915 | Ga0496112_0263036 | Ga0496112_0263036_647_1249 | 194 |
| 35 | 3300005354 | Ga0070675_100019908 | Ga0070675_1000199082 | 195 |
| 36 | 3300009094 | Ga0111539_10417147 | Ga0111539_104171472 | 195 |
| 37 | 3300035115 | Ga0373941_0004218 | Ga0373941_0004218_29_652 | 195 |
| 38 | 3300039438 | Ga0436360_1180516 | Ga0436360_1180516_185_796 | 195 |
| 39 | 3300044712 | Ga0453684_0073900 | Ga0453684_0073900_2242_2880 | 197 |
| 40 | 3300045051 | Ga0451576_0319199 | Ga0451576_0319199_602_1240 | 197 |
| 41 | 3300045051 | Ga0451576_0662607 | Ga0451576_0662607_392_1003 | 197 |
| 42 | 3300049586 | Ga0501070_0873335 | Ga0501070_0873335_29_640 | 197 |
| 43 | 3300005467 | Ga0070706_100944682 | Ga0070706_1009446821 | 198 |
| 44 | 3300031507 | Ga0307509_10104680 | Ga0307509_101046803 | 198 |
| 45 | 3300034818 | Ga0373950_0000012 | Ga0373950_0000012_158693_159313 | 198 |
| 46 | 3300035111 | Ga0373923_0327819 | Ga0373923_0327819_19_648 | 198 |
| 47 | 3300035724 | Ga0373933_0000297 | Ga0373933_0000297_26917_27546 | 198 |
| 48 | 3300036401 | Ga0373937_0032416 | Ga0373937_0032416_1542_2171 | 198 |
| 49 | 3300048917 | Ga0496114_0310649 | Ga0496114_0310649_277_897 | 198 |
| 50 | 3300049571 | Ga0501034_0378355 | Ga0501034_0378355_665_1282 | 198 |
| 51 | 3300049586 | Ga0501070_0081758 | Ga0501070_0081758_736_1353 | 198 |
| 52 | 3300049823 | Ga0501044_0369421 | Ga0501044_0369421_233_850 | 198 |
| 53 | 3300005338 | Ga0068868_100403619 | Ga0068868_1004036192 | 199 |
| 54 | 3300005340 | Ga0070689_100195058 | Ga0070689_1001950582 | 199 |
| 55 | 3300005341 | Ga0070691_10050796 | Ga0070691_100507963 | 199 |
| 56 | 3300005354 | Ga0070675_100215426 | Ga0070675_1002154262 | 199 |
| 57 | 3300005406 | Ga0070703_10053417 | Ga0070703_100534172 | 199 |
| 58 | 3300005530 | Ga0070679_100000979 | Ga0070679_10000097912 | 199 |
| 59 | 3300005535 | Ga0070684_100158267 | Ga0070684_1001582673 | 199 |
| 60 | 3300005563 | Ga0068855_100191744 | Ga0068855_1001917443 | 199 |
| 61 | 3300005577 | Ga0068857_100458425 | Ga0068857_1004584252 | 199 |
| 62 | 3300025912 | Ga0207707_10162296 | Ga0207707_101622962 | 199 |
| 63 | 3300025916 | Ga0207663_10720874 | Ga0207663_107208741 | 199 |
| 64 | 3300025936 | Ga0207670_10198049 | Ga0207670_101980492 | 199 |
| 65 | 3300026095 | Ga0207676_10885627 | Ga0207676_108856271 | 199 |
| 66 | 3300026116 | Ga0207674_10144874 | Ga0207674_101448742 | 199 |
| 67 | 3300026116 | Ga0207674_10757103 | Ga0207674_107571031 | 199 |
| 68 | 3300026116 | Ga0207674_10858888 | Ga0207674_108588881 | 199 |
| 69 | 3300031733 | Ga0316577_10018007 | Ga0316577_100180072 | 199 |
| 70 | 3300035692 | Ga0373935_0188479 | Ga0373935_0188479_94_726 | 199 |
| 71 | 3300036401 | Ga0373937_0605731 | Ga0373937_0605731_219_851 | 199 |
| 72 | 3300036712 | Ga0316584_0000010 | Ga0316584_0000010_21683_22300 | 199 |
| 73 | 3300046459 | Ga0495629_0126616 | Ga0495629_0126616_740_1357 | 199 |
| 74 | 3300046462 | Ga0495651_0110956 | Ga0495651_0110956_1114_1731 | 199 |
| 75 | 3300046531 | Ga0495665_0328131 | Ga0495665_0328131_12_629 | 199 |
| 76 | 3300046663 | Ga0495635_0390950 | Ga0495635_0390950_181_798 | 199 |
| 77 | 3300047471 | Ga0495684_0227874 | Ga0495684_0227874_453_1070 | 199 |
| 78 | 3300048088 | Ga0495602_0085155 | Ga0495602_0085155_1661_2278 | 199 |
| 79 | 3300048088 | Ga0495602_0205809 | Ga0495602_0205809_305_925 | 199 |
| 80 | 3300005329 | Ga0070683_100181482 | Ga0070683_1001814822 | 200 |
| 81 | 3300005334 | Ga0068869_100018572 | Ga0068869_1000185724 | 200 |
| 82 | 3300005340 | Ga0070689_100020157 | Ga0070689_1000201574 | 200 |
| 83 | 3300005365 | Ga0070688_100089831 | Ga0070688_1000898313 | 200 |
| 84 | 3300005441 | Ga0070700_100481581 | Ga0070700_1004815811 | 200 |
| 85 | 3300005444 | Ga0070694_100215791 | Ga0070694_1002157912 | 200 |
| 86 | 3300005444 | Ga0070694_100569286 | Ga0070694_1005692862 | 200 |
| 87 | 3300005471 | Ga0070698_100240931 | Ga0070698_1002409312 | 200 |
| 88 | 3300005535 | Ga0070684_100371290 | Ga0070684_1003712902 | 200 |
| 89 | 3300005842 | Ga0068858_100989547 | Ga0068858_1009895472 | 200 |
| 90 | 3300006871 | Ga0075434_100688725 | Ga0075434_1006887252 | 200 |
| 91 | 3300007076 | Ga0075435_100266230 | Ga0075435_1002662302 | 200 |
| 92 | 3300009094 | Ga0111539_10002977 | Ga0111539_1000297718 | 200 |
| 93 | 3300009553 | Ga0105249_10259450 | Ga0105249_102594502 | 200 |
| 94 | 3300014969 | Ga0157376_10460815 | Ga0157376_104608152 | 200 |
| 95 | 3300021384 | Ga0213876_10259816 | Ga0213876_102598162 | 200 |
| 96 | 3300025918 | Ga0207662_10083883 | Ga0207662_100838832 | 200 |
| 97 | 3300025918 | Ga0207662_10103139 | Ga0207662_101031392 | 200 |
| 98 | 3300025944 | Ga0207661_10315097 | Ga0207661_103150972 | 200 |
| 99 | 3300026075 | Ga0207708_10381117 | Ga0207708_103811172 | 200 |
| 100 | 3300026095 | Ga0207676_10569503 | Ga0207676_105695032 | 200 |
| 101 | 3300027907 | Ga0207428_10016398 | Ga0207428_100163985 | 200 |
| 102 | 3300028794 | Ga0307515_10018598 | Ga0307515_100185986 | 200 |
| 103 | 3300028800 | Ga0265338_10022434 | Ga0265338_100224343 | 200 |
| 104 | 3300028800 | Ga0265338_10134969 | Ga0265338_101349692 | 200 |
| 105 | 3300031507 | Ga0307509_10000042 | Ga0307509_10000042123 | 200 |
| 106 | 3300031507 | Ga0307509_10085929 | Ga0307509_100859292 | 200 |
| 107 | 3300031616 | Ga0307508_10281886 | Ga0307508_102818862 | 200 |
| 108 | 3300031616 | Ga0307508_10461041 | Ga0307508_104610412 | 200 |
| 109 | 3300035113 | Ga0373936_0000008 | Ga0373936_0000008_5449_6072 | 200 |
| 110 | 3300035241 | Ga0373961_0000021 | Ga0373961_0000021_45010_45633 | 200 |
| 111 | 3300037312 | Ga0395899_0342407 | Ga0395899_0342407_53_673 | 200 |
| 112 | 3300039437 | Ga0436365_1343922 | Ga0436365_1343922_462_1082 | 200 |
| 113 | 3300042876 | Ga0451577_0000990 | Ga0451577_0000990_10540_11190 | 200 |
| 114 | 3300044712 | Ga0453684_0003604 | Ga0453684_0003604_25054_25704 | 200 |
| 115 | 3300049585 | Ga0501069_0284356 | Ga0501069_0284356_244_864 | 200 |
| 116 | 3300049586 | Ga0501070_0287504 | Ga0501070_0287504_224_844 | 200 |
| 117 | 3300049586 | Ga0501070_0743060 | Ga0501070_0743060_143_763 | 200 |
| 118 | 3300049744 | Ga0501083_0149103 | Ga0501083_0149103_59_679 | 200 |
| 119 | 3300050510 | nmdc:mga06r32_608456_c1 | nmdc:mga06r32_608456_c1_332_955 | 200 |
| 120 | 3300050511 | nmdc:mga08y16_2414_c1 | nmdc:mga08y16_2414_c1_3855_4490 | 200 |
| 121 | 3300053092 | Ga0500583_0231319 | Ga0500583_0231319_237_860 | 200 |
| 122 | 3300053094 | Ga0500566_0001530 | Ga0500566_0001530_5111_5734 | 200 |
| 123 | 3300053094 | Ga0500566_0020547 | Ga0500566_0020547_919_1542 | 200 |
| 124 | 3300053120 | Ga0500597_106097 | Ga0500597_106097_45_668 | 200 |
| 125 | 3300053123 | Ga0500614_022681 | Ga0500614_022681_743_1366 | 200 |
| 126 | 3300053130 | Ga0500642_0005544 | Ga0500642_0005544_1419_2042 | 200 |
| 127 | 3300053138 | Ga0500564_052346 | Ga0500564_052346_1126_1749 | 200 |
| 128 | 3300053150 | Ga0500603_001465 | Ga0500603_001465_4131_4754 | 200 |
| 129 | 3300005337 | Ga0070682_100159119 | Ga0070682_1001591192 | 201 |
| 130 | 3300005365 | Ga0070688_100518480 | Ga0070688_1005184802 | 201 |
| 131 | 3300005367 | Ga0070667_100281945 | Ga0070667_1002819452 | 201 |
| 132 | 3300005445 | Ga0070708_100030230 | Ga0070708_1000302305 | 201 |
| 133 | 3300005459 | Ga0068867_100504960 | Ga0068867_1005049601 | 201 |
| 134 | 3300005459 | Ga0068867_100930023 | Ga0068867_1009300231 | 201 |
| 135 | 3300005471 | Ga0070698_100002720 | Ga0070698_1000027206 | 201 |
| 136 | 3300005471 | Ga0070698_100514640 | Ga0070698_1005146402 | 201 |
| 137 | 3300005518 | Ga0070699_100824852 | Ga0070699_1008248521 | 201 |
| 138 | 3300005530 | Ga0070679_100089542 | Ga0070679_1000895422 | 201 |
| 139 | 3300005563 | Ga0068855_100791079 | Ga0068855_1007910791 | 201 |
| 140 | 3300005614 | Ga0068856_100062667 | Ga0068856_1000626672 | 201 |
| 141 | 3300005618 | Ga0068864_101230009 | Ga0068864_1012300091 | 201 |
| 142 | 3300005719 | Ga0068861_100295260 | Ga0068861_1002952601 | 201 |
| 143 | 3300005719 | Ga0068861_100398961 | Ga0068861_1003989612 | 201 |
| 144 | 3300005841 | Ga0068863_100152845 | Ga0068863_1001528452 | 201 |
| 145 | 3300006358 | Ga0068871_100294038 | Ga0068871_1002940382 | 201 |
| 146 | 3300006846 | Ga0075430_100254410 | Ga0075430_1002544102 | 201 |
| 147 | 3300006847 | Ga0075431_100107176 | Ga0075431_1001071762 | 201 |
| 148 | 3300006847 | Ga0075431_100488004 | Ga0075431_1004880042 | 201 |
| 149 | 3300006880 | Ga0075429_100170293 | Ga0075429_1001702932 | 201 |
| 150 | 3300009098 | Ga0105245_10003579 | Ga0105245_100035799 | 201 |
| 151 | 3300009098 | Ga0105245_10047054 | Ga0105245_100470544 | 201 |
| 152 | 3300009177 | Ga0105248_10934121 | Ga0105248_109341212 | 201 |
| 153 | 3300009545 | Ga0105237_10593710 | Ga0105237_105937101 | 201 |
| 154 | 3300009551 | Ga0105238_11290927 | Ga0105238_112909271 | 201 |
| 155 | 3300013102 | Ga0157371_10813913 | Ga0157371_108139131 | 201 |
| 156 | 3300013297 | Ga0157378_10409912 | Ga0157378_104099121 | 201 |
| 157 | 3300014969 | Ga0157376_10223165 | Ga0157376_102231651 | 201 |
| 158 | 3300025921 | Ga0207652_10194747 | Ga0207652_101947472 | 201 |
| 159 | 3300025927 | Ga0207687_10001578 | Ga0207687_100015784 | 201 |
| 160 | 3300025927 | Ga0207687_10134828 | Ga0207687_101348281 | 201 |
| 161 | 3300025938 | Ga0207704_10181569 | Ga0207704_101815692 | 201 |
| 162 | 3300025941 | Ga0207711_10580502 | Ga0207711_105805022 | 201 |
| 163 | 3300026078 | Ga0207702_10124320 | Ga0207702_101243202 | 201 |
| 164 | 3300026088 | Ga0207641_10153835 | Ga0207641_101538352 | 201 |
| 165 | 3300026095 | Ga0207676_10594442 | Ga0207676_105944421 | 201 |
| 166 | 3300026118 | Ga0207675_100319884 | Ga0207675_1003198842 | 201 |
| 167 | 3300026121 | Ga0207683_10140694 | Ga0207683_101406942 | 201 |
| 168 | 3300028381 | Ga0268264_10207822 | Ga0268264_102078222 | 201 |
| 169 | 3300031251 | Ga0265327_10009262 | Ga0265327_100092623 | 201 |
| 170 | 3300031711 | Ga0265314_10176227 | Ga0265314_101762272 | 201 |
| 171 | 3300037312 | Ga0395899_0056677 | Ga0395899_0056677_1758_2384 | 201 |
| 172 | 3300037418 | Ga0395900_0134125 | Ga0395900_0134125_25_651 | 201 |
| 173 | 3300037471 | Ga0395905_0068464 | Ga0395905_0068464_298_921 | 201 |
| 174 | 3300038443 | Ga0395901_0017257 | Ga0395901_0017257_2860_3486 | 201 |
| 175 | 3300041512 | Ga0451853_0105965 | Ga0451853_0105965_33_656 | 201 |
| 176 | 3300042876 | Ga0451577_0004468 | Ga0451577_0004468_7385_8038 | 201 |
| 177 | 3300042876 | Ga0451577_0096800 | Ga0451577_0096800_1027_1680 | 201 |
| 178 | 3300044673 | Ga0453683_0020048 | Ga0453683_0020048_2991_3644 | 201 |
| 179 | 3300044712 | Ga0453684_0107996 | Ga0453684_0107996_1374_2027 | 201 |
| 180 | 3300044712 | Ga0453684_0115152 | Ga0453684_0115152_1389_2042 | 201 |
| 181 | 3300044712 | Ga0453684_0221735 | Ga0453684_0221735_997_1650 | 201 |
| 182 | 3300045051 | Ga0451576_0122884 | Ga0451576_0122884_1038_1691 | 201 |
| 183 | 3300045051 | Ga0451576_0181844 | Ga0451576_0181844_645_1298 | 201 |
| 184 | 3300046471 | Ga0495650_0036043 | Ga0495650_0036043_1527_2153 | 201 |
| 185 | 3300049571 | Ga0501034_0036322 | Ga0501034_0036322_3285_3908 | 201 |
| 186 | 3300049580 | Ga0501046_0229011 | Ga0501046_0229011_458_1081 | 201 |
| 187 | 3300049581 | Ga0501047_0006811 | Ga0501047_0006811_7067_7690 | 201 |
| 188 | 3300049581 | Ga0501047_0069160 | Ga0501047_0069160_183_806 | 201 |
| 189 | 3300049586 | Ga0501070_0091943 | Ga0501070_0091943_1374_1997 | 201 |
| 190 | 3300049586 | Ga0501070_0109623 | Ga0501070_0109623_1450_2073 | 201 |
| 191 | 3300049590 | Ga0501074_0026642 | Ga0501074_0026642_2521_3144 | 201 |
| 192 | 3300049665 | Ga0501227_025391 | Ga0501227_025391_155_796 | 201 |
| 193 | 3300049704 | Ga0501221_036993 | Ga0501221_036993_59_700 | 201 |
| 194 | 3300049705 | Ga0501225_0005581 | Ga0501225_0005581_1163_1804 | 201 |
| 195 | 3300049822 | Ga0501035_0355468 | Ga0501035_0355468_97_720 | 201 |
| 196 | 3300049823 | Ga0501044_0039385 | Ga0501044_0039385_1300_1923 | 201 |
| 197 | 3300049823 | Ga0501044_0216311 | Ga0501044_0216311_473_1096 | 201 |
| 198 | 3300050507 | nmdc:mga05p37_611264_c1 | nmdc:mga05p37_611264_c1_14_640 | 201 |
| 199 | 3300050510 | nmdc:mga06r32_676186_c1 | nmdc:mga06r32_676186_c1_135_761 | 201 |
| 200 | 3300053086 | Ga0500578_0021972 | Ga0500578_0021972_3104_3730 | 201 |
| 201 | 3300053094 | Ga0500566_0101116 | Ga0500566_0101116_849_1475 | 201 |
| 202 | 3300053159 | Ga0500630_023595 | Ga0500630_023595_1532_2164 | 201 |
| 203 | 3300053162 | Ga0500638_083309 | Ga0500638_083309_75_701 | 201 |
| 204 | 3300053177 | Ga0500636_0064348 | Ga0500636_0064348_1319_1945 | 201 |
| 205 | 3300003320 | rootH2_10175143 | rootH2_101751432 | 202 |
| 206 | 3300005338 | Ga0068868_100249072 | Ga0068868_1002490722 | 202 |
| 207 | 3300005456 | Ga0070678_100017701 | Ga0070678_1000177011 | 202 |
| 208 | 3300005456 | Ga0070678_100276313 | Ga0070678_1002763131 | 202 |
| 209 | 3300005468 | Ga0070707_100236520 | Ga0070707_1002365202 | 202 |
| 210 | 3300005536 | Ga0070697_100341530 | Ga0070697_1003415302 | 202 |
| 211 | 3300005548 | Ga0070665_100006461 | Ga0070665_1000064617 | 202 |
| 212 | 3300005618 | Ga0068864_100750834 | Ga0068864_1007508342 | 202 |
| 213 | 3300005719 | Ga0068861_100198053 | Ga0068861_1001980532 | 202 |
| 214 | 3300009148 | Ga0105243_10962099 | Ga0105243_109620991 | 202 |
| 215 | 3300009553 | Ga0105249_10232943 | Ga0105249_102329432 | 202 |
| 216 | 3300025961 | Ga0207712_10146664 | Ga0207712_101466642 | 202 |
| 217 | 3300026023 | Ga0207677_10791805 | Ga0207677_107918052 | 202 |
| 218 | 3300026118 | Ga0207675_100476662 | Ga0207675_1004766622 | 202 |
| 219 | 3300026121 | Ga0207683_10008054 | Ga0207683_100080542 | 202 |
| 220 | 3300028379 | Ga0268266_10013403 | Ga0268266_100134033 | 202 |
| 221 | 3300031238 | Ga0265332_10004035 | Ga0265332_100040356 | 202 |
| 222 | 3300031507 | Ga0307509_10485139 | Ga0307509_104851392 | 202 |
| 223 | 3300031691 | Ga0316579_10010687 | Ga0316579_100106873 | 202 |
| 224 | 3300031727 | Ga0316576_10006857 | Ga0316576_100068574 | 202 |
| 225 | 3300031733 | Ga0316577_10000093 | Ga0316577_1000009320 | 202 |
| 226 | 3300032126 | Ga0307415_100080442 | Ga0307415_1000804422 | 202 |
| 227 | 3300032126 | Ga0307415_100282588 | Ga0307415_1002825882 | 202 |
| 228 | 3300032137 | Ga0316585_10045618 | Ga0316585_100456182 | 202 |
| 229 | 3300032139 | Ga0316580_10004154 | Ga0316580_100041542 | 202 |
| 230 | 3300035090 | Ga0373949_0000058 | Ga0373949_0000058_27820_28455 | 202 |
| 231 | 3300035398 | Ga0316574_0279050 | Ga0316574_0279050_277_909 | 202 |
| 232 | 3300036647 | Ga0316582_0016407 | Ga0316582_0016407_3304_3936 | 202 |
| 233 | 3300036712 | Ga0316584_0008506 | Ga0316584_0008506_3657_4289 | 202 |
| 234 | 3300042876 | Ga0451577_0053267 | Ga0451577_0053267_544_1221 | 202 |
| 235 | 3300044684 | Ga0466966_0009813 | Ga0466966_0009813_3447_4127 | 202 |
| 236 | 3300045049 | Ga0466959_0024486 | Ga0466959_0024486_2567_3247 | 202 |
| 237 | 3300045976 | Ga0466967_0441074 | Ga0466967_0441074_629_1258 | 202 |
| 238 | 3300047472 | Ga0495686_0121609 | Ga0495686_0121609_881_1510 | 202 |
| 239 | 3300048917 | Ga0496114_0143989 | Ga0496114_0143989_1006_1644 | 202 |
| 240 | 3300050508 | nmdc:mga09592_38389_c1 | nmdc:mga09592_38389_c1_3007_3738 | 202 |
| 241 | 3300050510 | nmdc:mga06r32_38853_c1 | nmdc:mga06r32_38853_c1_1204_1935 | 202 |
| 242 | 3300053118 | Ga0500594_0083504 | Ga0500594_0083504_106_795 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3w8r-assembly1.cif.gz_B | mutant structure of thermus thermophilus hb8 uridine-cytidine kinase | 0.9424 | 4 | 200 |
| 6pwz-assembly1.cif.gz_D | crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidocytidine | 0.9353 | 4 | 201 |
| 1ufq-assembly1.cif.gz_B | crystal structure of ligand-free human uridine-cytidine kinase 2 | 0.931 | 5 | 198 |
| 6n55-assembly1.cif.gz_H | crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine | 0.9291 | 5 | 201 |
| 6pwz-assembly1.cif.gz_A | crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidocytidine | 0.922 | 4 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXW6_1_207_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9336 | 4 | 198 | 3.40.50.300 |
| af_O74427_22_234_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9224 | 7 | 197 | 3.40.50.300 |
| af_P0A8F4_7_213_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9197 | 6 | 198 | 3.40.50.300 |
| af_I1JJM2_43_250_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9165 | 1 | 202 | 3.40.50.300 |
| af_Q5ANN6_93_307_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9153 | 5 | 200 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0THS1-F1-model_v4 | Uridine kinase (EC 2.7.1.48) | 0.9769 | 5 | 198 |
GO:0004849
GO:0005524 GO:0005737 GO:0043771 GO:0044206 GO:0044211 |
| AF-A0A0K1PZE2-F1-model_v4 | Uridine kinase (EC 2.7.1.48) | 0.9671 | 3 | 200 |
GO:0004849
GO:0005524 GO:0005737 GO:0043771 GO:0044206 GO:0044211 |
| AF-A0A497E8L9-F1-model_v4 | Uridine kinase (EC 2.7.1.48) | 0.965 | 4 | 202 |
GO:0004849
GO:0005524 GO:0005737 GO:0043771 GO:0044206 GO:0044211 |
| AF-A0A6H2H1Q9-F1-model_v4 | Uridine kinase (EC 2.7.1.48) (Cytidine monophosphokinase) (Uridine monophosphokinase) | 0.965 | 6 | 198 |
GO:0004849
GO:0005524 GO:0005737 GO:0016773 GO:0044206 GO:0044211 |
| AF-A0A7S1XWE6-F1-model_v4 | Uridine kinase (EC 2.7.1.48) | 0.9639 | 4 | 198 |
GO:0005524
GO:0016301 GO:0044206 GO:0044211 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar