F354488

General Info

Members Datasets Scaffolds Average Seq Length
242 163 242 208

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100006461|Ga0070665_1000064617
Length 238
Sequence MSRAPRPRWAPLSHMAFGLTASGGGCEKGAMSRPLVVGIAGGTGSGKSTVANKLASAIPHGRCVTLDHDAYYRAQSHLSFDERARLNYDHPSSLETELLVAHLRALREGRAVEVPIYDFAHHDRRPETRRVEPAPVIVVEGILVFVDPQLREQMDVKIFVDTDADIRLMRRIRRDLEQRGRSFQSVRDQYYATVRPMHIEHVEPSKRWADLIVPEGGDNHVALDVLLGRLGRIAFGNE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
94 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
95 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
142 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
156 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
157 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
158 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
161 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
162 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 1.24
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10175143 3300003320 Bacteria 1151
2 Ga0070658_10803503 3300005327 Bacteria 817
3 Ga0070683_100181482 3300005329 Bacteria 1998
4 Ga0068869_100018572 3300005334 Bacteria 4735
5 Ga0070680_100074748 3300005336 Bacteria 2789
6 Ga0070682_100159119 3300005337 Bacteria 1558
7 Ga0068868_100249072 3300005338 Bacteria 1495
8 Ga0068868_100403619 3300005338 Bacteria 1180
9 Ga0070689_100020157 3300005340 Bacteria 4944
10 Ga0070689_100195058 3300005340 Bacteria 1650
11 Ga0070691_10050796 3300005341 Bacteria 1979
12 Ga0070675_100019908 3300005354 Bacteria 5353
13 Ga0070675_100215426 3300005354 Bacteria 1671
14 Ga0070688_100089831 3300005365 Bacteria 2005
15 Ga0070688_100518480 3300005365 Bacteria 902
16 Ga0070667_100281945 3300005367 Bacteria 1492
17 Ga0070703_10053417 3300005406 Bacteria 1299
18 Ga0070700_100481581 3300005441 Bacteria 951
19 Ga0070694_100215791 3300005444 Bacteria 1437
20 Ga0070694_100569286 3300005444 Bacteria 909
21 Ga0070708_100030230 3300005445 Bacteria 4682
22 Ga0070678_100017701 3300005456 Bacteria 4597
23 Ga0070678_100276313 3300005456 Bacteria 1419
24 Ga0070681_10266167 3300005458 Bacteria 1626
25 Ga0068867_100504960 3300005459 Bacteria 1040
26 Ga0068867_100930023 3300005459 Bacteria 784
27 Ga0070706_100944682 3300005467 Bacteria 796
28 Ga0070707_100236520 3300005468 Bacteria 1778
29 Ga0070698_100002720 3300005471 Bacteria 19442
30 Ga0070698_100240931 3300005471 Bacteria 1742
31 Ga0070698_100514640 3300005471 Bacteria 1135
32 Ga0070699_100824852 3300005518 Bacteria 849
33 Ga0070679_100000979 3300005530 Bacteria 24893
34 Ga0070679_100002363 3300005530 Bacteria 17106
35 Ga0070679_100019010 3300005530 Bacteria 6673
36 Ga0070679_100089542 3300005530 Bacteria 3064
37 Ga0070684_100158267 3300005535 Bacteria 2054
38 Ga0070684_100371290 3300005535 Bacteria 1317
39 Ga0070697_100341530 3300005536 Bacteria 1292
40 Ga0070665_100006461 3300005548 Bacteria 11931
41 Ga0068855_100191744 3300005563 Bacteria 2305
42 Ga0068855_100791079 3300005563 Bacteria 1009
43 Ga0068857_100458425 3300005577 Bacteria 1193
44 Ga0068856_100062667 3300005614 Bacteria 3673
45 Ga0068864_100750834 3300005618 Bacteria 956
46 Ga0068864_101230009 3300005618 Bacteria 748
47 Ga0068861_100198053 3300005719 Bacteria 1684
48 Ga0068861_100295260 3300005719 Bacteria 1401
49 Ga0068861_100398961 3300005719 Bacteria 1220
50 Ga0068863_100152845 3300005841 Bacteria 2209
51 Ga0068858_100989547 3300005842 Bacteria 824
52 Ga0081455_10316718 3300005937 Bacteria 1113
53 Ga0070717_10482459 3300006028 Bacteria 1119
54 Ga0068871_100294038 3300006358 Bacteria 1424
55 Ga0075430_100254410 3300006846 Bacteria 1455
56 Ga0075431_100107176 3300006847 Bacteria 2883
57 Ga0075431_100488004 3300006847 Bacteria 1224
58 Ga0075434_100688725 3300006871 Bacteria 1040
59 Ga0075429_100121451 3300006880 Bacteria 2283
60 Ga0075429_100170293 3300006880 Bacteria 1907
61 Ga0075435_100266230 3300007076 Bacteria 1461
62 Ga0111539_10002977 3300009094 Bacteria 22469
63 Ga0111539_10417147 3300009094 Bacteria 1563
64 Ga0105245_10003579 3300009098 Bacteria 13866
65 Ga0105245_10047054 3300009098 Bacteria 3856
66 Ga0105243_10962099 3300009148 Bacteria 854
67 Ga0105248_10934121 3300009177 Bacteria 980
68 Ga0105237_10593710 3300009545 Bacteria 1114
69 Ga0105238_10949694 3300009551 Bacteria 879
70 Ga0105238_11290927 3300009551 Bacteria 756
71 Ga0105249_10232943 3300009553 Bacteria 1817
72 Ga0105249_10259450 3300009553 Bacteria 1726
73 Ga0105239_10793258 3300010375 Bacteria 1085
74 Ga0157371_10813913 3300013102 Bacteria 704
75 Ga0157378_10254610 3300013297 Bacteria 1682
76 Ga0157378_10409912 3300013297 Bacteria 1337
77 Ga0157372_10527139 3300013307 Bacteria 1377
78 Ga0163163_10596092 3300014325 Bacteria 1168
79 Ga0157376_10223165 3300014969 Bacteria 1746
80 Ga0157376_10460815 3300014969 Bacteria 1242
81 Ga0213876_10025058 3300021384 Bacteria 3149
82 Ga0213876_10259816 3300021384 Bacteria 923
83 Ga0207705_10185472 3300025909 Bacteria 1571
84 Ga0207705_10647230 3300025909 Bacteria 822
85 Ga0207707_10162296 3300025912 Bacteria 1954
86 Ga0207663_10720874 3300025916 Bacteria 791
87 Ga0207660_10110123 3300025917 Bacteria 2071
88 Ga0207660_10339101 3300025917 Bacteria 1203
89 Ga0207662_10083883 3300025918 Bacteria 1949
90 Ga0207662_10103139 3300025918 Bacteria 1770
91 Ga0207652_10003089 3300025921 Bacteria 13894
92 Ga0207652_10049328 3300025921 Bacteria 3603
93 Ga0207652_10194747 3300025921 Bacteria 1823
94 Ga0207659_10014891 3300025926 Bacteria 5027
95 Ga0207687_10001578 3300025927 Bacteria 15686
96 Ga0207687_10134828 3300025927 Bacteria 1866
97 Ga0207670_10198049 3300025936 Bacteria 1524
98 Ga0207704_10181569 3300025938 Bacteria 1521
99 Ga0207711_10580502 3300025941 Bacteria 1046
100 Ga0207661_10315097 3300025944 Bacteria 1405
101 Ga0207712_10146664 3300025961 Bacteria 1817
102 Ga0207677_10791805 3300026023 Bacteria 848
103 Ga0207708_10381117 3300026075 Bacteria 1163
104 Ga0207702_10124320 3300026078 Bacteria 2313
105 Ga0207641_10153835 3300026088 Bacteria 2085
106 Ga0207676_10569503 3300026095 Bacteria 1084
107 Ga0207676_10594442 3300026095 Bacteria 1062
108 Ga0207676_10885627 3300026095 Bacteria 875
109 Ga0207674_10144874 3300026116 Bacteria 2334
110 Ga0207674_10757103 3300026116 Bacteria 937
111 Ga0207674_10858888 3300026116 Bacteria 875
112 Ga0207675_100319884 3300026118 Bacteria 1514
113 Ga0207675_100476662 3300026118 Bacteria 1240
114 Ga0207683_10008054 3300026121 Bacteria 9011
115 Ga0207683_10140694 3300026121 Bacteria 2174
116 Ga0207428_10016398 3300027907 Bacteria 6373
117 Ga0268266_10013403 3300028379 Bacteria 7060
118 Ga0268264_10207822 3300028381 Bacteria 1795
119 Ga0307515_10018598 3300028794 Bacteria 12556
120 Ga0265338_10022434 3300028800 Bacteria 6535
121 Ga0265338_10134969 3300028800 Bacteria 1942
122 Ga0265332_10004035 3300031238 Bacteria 6979
123 Ga0265327_10009262 3300031251 Bacteria 7141
124 Ga0307513_10001098 3300031456 Bacteria 39150
125 Ga0307509_10000042 3300031507 Bacteria 178442
126 Ga0307509_10016950 3300031507 Bacteria 8402
127 Ga0307509_10085929 3300031507 Bacteria 3236
128 Ga0307509_10104680 3300031507 Bacteria 2854
129 Ga0307509_10485139 3300031507 Unclassified 923
130 Ga0307508_10281886 3300031616 Bacteria 1255
131 Ga0307508_10461041 3300031616 Bacteria 864
132 Ga0316579_10010687 3300031691 Bacteria 3886
133 Ga0265314_10176227 3300031711 Bacteria 1286
134 Ga0316576_10006857 3300031727 Bacteria 7119
135 Ga0316577_10000093 3300031733 Bacteria 24144
136 Ga0316577_10018007 3300031733 Bacteria 3905
137 Ga0307415_100080442 3300032126 Bacteria 2325
138 Ga0307415_100282588 3300032126 Bacteria 1365
139 Ga0316585_10045618 3300032137 Bacteria 1402
140 Ga0316580_10004154 3300032139 Bacteria 4174
141 Ga0373950_0000012 3300034818 Bacteria 352408
142 Ga0373949_0000058 3300035090 Bacteria 42184
143 Ga0373923_0327819 3300035111 Bacteria 728
144 Ga0373936_0000008 3300035113 Bacteria 268505
145 Ga0373941_0004218 3300035115 Bacteria 3305
146 Ga0373961_0000021 3300035241 Bacteria 100265
147 Ga0316574_0279050 3300035398 Bacteria 1064
148 Ga0373935_0188479 3300035692 Bacteria 1420
149 Ga0373933_0000297 3300035724 Bacteria 32047
150 Ga0373937_0032416 3300036401 Bacteria 4739
151 Ga0373937_0605731 3300036401 Bacteria 1040
152 Ga0316582_0016407 3300036647 Bacteria 4257
153 Ga0316584_0000010 3300036712 Bacteria 65029
154 Ga0316584_0008506 3300036712 Bacteria 7071
155 Ga0395899_0056677 3300037312 Bacteria 2895
156 Ga0395899_0342407 3300037312 Bacteria 1002
157 Ga0395900_0134125 3300037418 Bacteria 2536
158 Ga0395905_0068464 3300037471 Bacteria 3325
159 Ga0395901_0017257 3300038443 Bacteria 7367
160 Ga0436365_1283925 3300039437 Bacteria 3796
161 Ga0436365_1343922 3300039437 Bacteria 1437
162 Ga0436360_1180516 3300039438 Bacteria 854
163 Ga0451853_0105965 3300041512 Bacteria 673
164 Ga0451577_0000990 3300042876 Bacteria 41360
165 Ga0451577_0004468 3300042876 Bacteria 14763
166 Ga0451577_0053267 3300042876 Bacteria 3612
167 Ga0451577_0096800 3300042876 Bacteria 2635
168 Ga0453683_0020048 3300044673 Bacteria 4275
169 Ga0453683_0099926 3300044673 Bacteria 1821
170 Ga0466966_0009813 3300044684 Bacteria 6346
171 Ga0453684_0003604 3300044712 Bacteria 34545
172 Ga0453684_0073900 3300044712 Bacteria 4295
173 Ga0453684_0107996 3300044712 Bacteria 3387
174 Ga0453684_0115152 3300044712 Bacteria 3258
175 Ga0453684_0221735 3300044712 Bacteria 2190
176 Ga0466959_0024486 3300045049 Bacteria 4472
177 Ga0451576_0122884 3300045051 Bacteria 2703
178 Ga0451576_0181844 3300045051 Bacteria 2195
179 Ga0451576_0319199 3300045051 Bacteria 1625
180 Ga0451576_0662607 3300045051 Bacteria 1097
181 Ga0466967_0441074 3300045976 Bacteria 1271
182 Ga0495629_0126616 3300046459 Bacteria 1780
183 Ga0495651_0110956 3300046462 Bacteria 2028
184 Ga0495650_0036043 3300046471 Bacteria 2170
185 Ga0495664_0019173 3300046477 Bacteria 3930
186 Ga0495608_0240364 3300046511 Bacteria 1132
187 Ga0495628_0049519 3300046516 Bacteria 3327
188 Ga0495628_0234383 3300046516 Bacteria 1375
189 Ga0495665_0328131 3300046531 Bacteria 781
190 Ga0495635_0390950 3300046663 Bacteria 925
191 Ga0495604_0493237 3300047317 Bacteria 795
192 Ga0495684_0227874 3300047471 Bacteria 1364
193 Ga0495684_0249459 3300047471 Bacteria 1292
194 Ga0495686_0121609 3300047472 Bacteria 1555
195 Ga0495602_0085155 3300048088 Bacteria 2643
196 Ga0495602_0205809 3300048088 Bacteria 1498
197 Ga0496112_0263036 3300048915 Bacteria 1674
198 Ga0496114_0143989 3300048917 Bacteria 2065
199 Ga0496114_0310649 3300048917 Bacteria 1392
200 Ga0501034_0036322 3300049571 Bacteria 4992
201 Ga0501034_0378355 3300049571 Bacteria 1341
202 Ga0501046_0229011 3300049580 Bacteria 1374
203 Ga0501047_0006811 3300049581 Bacteria 10739
204 Ga0501047_0069160 3300049581 Bacteria 3400
205 Ga0501069_0284356 3300049585 Bacteria 968
206 Ga0501070_0081758 3300049586 Bacteria 2673
207 Ga0501070_0091943 3300049586 Bacteria 2511
208 Ga0501070_0109623 3300049586 Bacteria 2281
209 Ga0501070_0287504 3300049586 Bacteria 1340
210 Ga0501070_0743060 3300049586 Bacteria 773
211 Ga0501070_0873335 3300049586 Bacteria 703
212 Ga0501074_0026642 3300049590 Bacteria 4192
213 Ga0501227_025391 3300049665 Bacteria 1389
214 Ga0501221_036993 3300049704 Bacteria 1048
215 Ga0501225_0005581 3300049705 Bacteria 3690
216 Ga0501083_0149103 3300049744 Bacteria 1531
217 Ga0501035_0355468 3300049822 Bacteria 1225
218 Ga0501044_0039385 3300049823 Bacteria 4931
219 Ga0501044_0216311 3300049823 Bacteria 1868
220 Ga0501044_0369421 3300049823 Bacteria 1351
221 nmdc:mga05p37_611264_c1 3300050507 Bacteria 1228
222 nmdc:mga09592_38389_c1 3300050508 Bacteria 4020
223 nmdc:mga06r32_38853_c1 3300050510 Bacteria 4512
224 nmdc:mga06r32_608456_c1 3300050510 Unclassified 1063
225 nmdc:mga06r32_676186_c1 3300050510 Bacteria 999
226 nmdc:mga08y16_2414_c1 3300050511 Bacteria 19201
227 nmdc:mga08y16_33928_c1 3300050511 Bacteria 5361
228 Ga0500578_0021972 3300053086 Bacteria 4098
229 Ga0500583_0231319 3300053092 Bacteria 915
230 Ga0500566_0001530 3300053094 Bacteria 13585
231 Ga0500566_0020547 3300053094 Bacteria 3881
232 Ga0500566_0101116 3300053094 Bacteria 1580
233 Ga0500594_0083504 3300053118 Bacteria 959
234 Ga0500597_106097 3300053120 Bacteria 1221
235 Ga0500614_022681 3300053123 Bacteria 1468
236 Ga0500642_0005544 3300053130 Bacteria 4080
237 Ga0500564_052346 3300053138 Bacteria 1866
238 Ga0500568_0026214 3300053139 Bacteria 2449
239 Ga0500603_001465 3300053150 Bacteria 5387
240 Ga0500630_023595 3300053159 Bacteria 3038
241 Ga0500638_083309 3300053162 Bacteria 1516
242 Ga0500636_0064348 3300053177 Bacteria 2136

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10647230 Ga0207705_106472301 169
2 3300005937 Ga0081455_10316718 Ga0081455_103167182 181
3 3300044673 Ga0453683_0099926 Ga0453683_0099926_22_615 182
4 3300009551 Ga0105238_10949694 Ga0105238_109496941 187
5 3300046477 Ga0495664_0019173 Ga0495664_0019173_653_1315 187
6 3300046511 Ga0495608_0240364 Ga0495608_0240364_63_725 187
7 3300046516 Ga0495628_0049519 Ga0495628_0049519_263_925 187
8 3300047471 Ga0495684_0249459 Ga0495684_0249459_464_1126 187
9 3300005327 Ga0070658_10803503 Ga0070658_108035031 188
10 3300006028 Ga0070717_10482459 Ga0070717_104824591 188
11 3300010375 Ga0105239_10793258 Ga0105239_107932582 188
12 3300031456 Ga0307513_10001098 Ga0307513_1000109812 188
13 3300021384 Ga0213876_10025058 Ga0213876_100250583 189
14 3300039437 Ga0436365_1283925 Ga0436365_1283925_2404_3030 189
15 3300005336 Ga0070680_100074748 Ga0070680_1000747482 191
16 3300005530 Ga0070679_100019010 Ga0070679_1000190103 191
17 3300025909 Ga0207705_10185472 Ga0207705_101854723 191
18 3300025917 Ga0207660_10110123 Ga0207660_101101233 191
19 3300025921 Ga0207652_10049328 Ga0207652_100493284 191
20 3300005458 Ga0070681_10266167 Ga0070681_102661673 192
21 3300005530 Ga0070679_100002363 Ga0070679_10000236312 192
22 3300025917 Ga0207660_10339101 Ga0207660_103391012 192
23 3300025921 Ga0207652_10003089 Ga0207652_1000308911 192
24 3300053139 Ga0500568_0026214 Ga0500568_0026214_1320_1958 192
25 3300006880 Ga0075429_100121451 Ga0075429_1001214512 193
26 3300025926 Ga0207659_10014891 Ga0207659_100148912 193
27 3300031507 Ga0307509_10016950 Ga0307509_100169508 193
28 3300050511 nmdc:mga08y16_33928_c1 nmdc:mga08y16_33928_c1_1237_1857 193
29 3300013297 Ga0157378_10254610 Ga0157378_102546102 194
30 3300013307 Ga0157372_10527139 Ga0157372_105271392 194
31 3300014325 Ga0163163_10596092 Ga0163163_105960922 194
32 3300046516 Ga0495628_0234383 Ga0495628_0234383_164_766 194
33 3300047317 Ga0495604_0493237 Ga0495604_0493237_102_704 194
34 3300048915 Ga0496112_0263036 Ga0496112_0263036_647_1249 194
35 3300005354 Ga0070675_100019908 Ga0070675_1000199082 195
36 3300009094 Ga0111539_10417147 Ga0111539_104171472 195
37 3300035115 Ga0373941_0004218 Ga0373941_0004218_29_652 195
38 3300039438 Ga0436360_1180516 Ga0436360_1180516_185_796 195
39 3300044712 Ga0453684_0073900 Ga0453684_0073900_2242_2880 197
40 3300045051 Ga0451576_0319199 Ga0451576_0319199_602_1240 197
41 3300045051 Ga0451576_0662607 Ga0451576_0662607_392_1003 197
42 3300049586 Ga0501070_0873335 Ga0501070_0873335_29_640 197
43 3300005467 Ga0070706_100944682 Ga0070706_1009446821 198
44 3300031507 Ga0307509_10104680 Ga0307509_101046803 198
45 3300034818 Ga0373950_0000012 Ga0373950_0000012_158693_159313 198
46 3300035111 Ga0373923_0327819 Ga0373923_0327819_19_648 198
47 3300035724 Ga0373933_0000297 Ga0373933_0000297_26917_27546 198
48 3300036401 Ga0373937_0032416 Ga0373937_0032416_1542_2171 198
49 3300048917 Ga0496114_0310649 Ga0496114_0310649_277_897 198
50 3300049571 Ga0501034_0378355 Ga0501034_0378355_665_1282 198
51 3300049586 Ga0501070_0081758 Ga0501070_0081758_736_1353 198
52 3300049823 Ga0501044_0369421 Ga0501044_0369421_233_850 198
53 3300005338 Ga0068868_100403619 Ga0068868_1004036192 199
54 3300005340 Ga0070689_100195058 Ga0070689_1001950582 199
55 3300005341 Ga0070691_10050796 Ga0070691_100507963 199
56 3300005354 Ga0070675_100215426 Ga0070675_1002154262 199
57 3300005406 Ga0070703_10053417 Ga0070703_100534172 199
58 3300005530 Ga0070679_100000979 Ga0070679_10000097912 199
59 3300005535 Ga0070684_100158267 Ga0070684_1001582673 199
60 3300005563 Ga0068855_100191744 Ga0068855_1001917443 199
61 3300005577 Ga0068857_100458425 Ga0068857_1004584252 199
62 3300025912 Ga0207707_10162296 Ga0207707_101622962 199
63 3300025916 Ga0207663_10720874 Ga0207663_107208741 199
64 3300025936 Ga0207670_10198049 Ga0207670_101980492 199
65 3300026095 Ga0207676_10885627 Ga0207676_108856271 199
66 3300026116 Ga0207674_10144874 Ga0207674_101448742 199
67 3300026116 Ga0207674_10757103 Ga0207674_107571031 199
68 3300026116 Ga0207674_10858888 Ga0207674_108588881 199
69 3300031733 Ga0316577_10018007 Ga0316577_100180072 199
70 3300035692 Ga0373935_0188479 Ga0373935_0188479_94_726 199
71 3300036401 Ga0373937_0605731 Ga0373937_0605731_219_851 199
72 3300036712 Ga0316584_0000010 Ga0316584_0000010_21683_22300 199
73 3300046459 Ga0495629_0126616 Ga0495629_0126616_740_1357 199
74 3300046462 Ga0495651_0110956 Ga0495651_0110956_1114_1731 199
75 3300046531 Ga0495665_0328131 Ga0495665_0328131_12_629 199
76 3300046663 Ga0495635_0390950 Ga0495635_0390950_181_798 199
77 3300047471 Ga0495684_0227874 Ga0495684_0227874_453_1070 199
78 3300048088 Ga0495602_0085155 Ga0495602_0085155_1661_2278 199
79 3300048088 Ga0495602_0205809 Ga0495602_0205809_305_925 199
80 3300005329 Ga0070683_100181482 Ga0070683_1001814822 200
81 3300005334 Ga0068869_100018572 Ga0068869_1000185724 200
82 3300005340 Ga0070689_100020157 Ga0070689_1000201574 200
83 3300005365 Ga0070688_100089831 Ga0070688_1000898313 200
84 3300005441 Ga0070700_100481581 Ga0070700_1004815811 200
85 3300005444 Ga0070694_100215791 Ga0070694_1002157912 200
86 3300005444 Ga0070694_100569286 Ga0070694_1005692862 200
87 3300005471 Ga0070698_100240931 Ga0070698_1002409312 200
88 3300005535 Ga0070684_100371290 Ga0070684_1003712902 200
89 3300005842 Ga0068858_100989547 Ga0068858_1009895472 200
90 3300006871 Ga0075434_100688725 Ga0075434_1006887252 200
91 3300007076 Ga0075435_100266230 Ga0075435_1002662302 200
92 3300009094 Ga0111539_10002977 Ga0111539_1000297718 200
93 3300009553 Ga0105249_10259450 Ga0105249_102594502 200
94 3300014969 Ga0157376_10460815 Ga0157376_104608152 200
95 3300021384 Ga0213876_10259816 Ga0213876_102598162 200
96 3300025918 Ga0207662_10083883 Ga0207662_100838832 200
97 3300025918 Ga0207662_10103139 Ga0207662_101031392 200
98 3300025944 Ga0207661_10315097 Ga0207661_103150972 200
99 3300026075 Ga0207708_10381117 Ga0207708_103811172 200
100 3300026095 Ga0207676_10569503 Ga0207676_105695032 200
101 3300027907 Ga0207428_10016398 Ga0207428_100163985 200
102 3300028794 Ga0307515_10018598 Ga0307515_100185986 200
103 3300028800 Ga0265338_10022434 Ga0265338_100224343 200
104 3300028800 Ga0265338_10134969 Ga0265338_101349692 200
105 3300031507 Ga0307509_10000042 Ga0307509_10000042123 200
106 3300031507 Ga0307509_10085929 Ga0307509_100859292 200
107 3300031616 Ga0307508_10281886 Ga0307508_102818862 200
108 3300031616 Ga0307508_10461041 Ga0307508_104610412 200
109 3300035113 Ga0373936_0000008 Ga0373936_0000008_5449_6072 200
110 3300035241 Ga0373961_0000021 Ga0373961_0000021_45010_45633 200
111 3300037312 Ga0395899_0342407 Ga0395899_0342407_53_673 200
112 3300039437 Ga0436365_1343922 Ga0436365_1343922_462_1082 200
113 3300042876 Ga0451577_0000990 Ga0451577_0000990_10540_11190 200
114 3300044712 Ga0453684_0003604 Ga0453684_0003604_25054_25704 200
115 3300049585 Ga0501069_0284356 Ga0501069_0284356_244_864 200
116 3300049586 Ga0501070_0287504 Ga0501070_0287504_224_844 200
117 3300049586 Ga0501070_0743060 Ga0501070_0743060_143_763 200
118 3300049744 Ga0501083_0149103 Ga0501083_0149103_59_679 200
119 3300050510 nmdc:mga06r32_608456_c1 nmdc:mga06r32_608456_c1_332_955 200
120 3300050511 nmdc:mga08y16_2414_c1 nmdc:mga08y16_2414_c1_3855_4490 200
121 3300053092 Ga0500583_0231319 Ga0500583_0231319_237_860 200
122 3300053094 Ga0500566_0001530 Ga0500566_0001530_5111_5734 200
123 3300053094 Ga0500566_0020547 Ga0500566_0020547_919_1542 200
124 3300053120 Ga0500597_106097 Ga0500597_106097_45_668 200
125 3300053123 Ga0500614_022681 Ga0500614_022681_743_1366 200
126 3300053130 Ga0500642_0005544 Ga0500642_0005544_1419_2042 200
127 3300053138 Ga0500564_052346 Ga0500564_052346_1126_1749 200
128 3300053150 Ga0500603_001465 Ga0500603_001465_4131_4754 200
129 3300005337 Ga0070682_100159119 Ga0070682_1001591192 201
130 3300005365 Ga0070688_100518480 Ga0070688_1005184802 201
131 3300005367 Ga0070667_100281945 Ga0070667_1002819452 201
132 3300005445 Ga0070708_100030230 Ga0070708_1000302305 201
133 3300005459 Ga0068867_100504960 Ga0068867_1005049601 201
134 3300005459 Ga0068867_100930023 Ga0068867_1009300231 201
135 3300005471 Ga0070698_100002720 Ga0070698_1000027206 201
136 3300005471 Ga0070698_100514640 Ga0070698_1005146402 201
137 3300005518 Ga0070699_100824852 Ga0070699_1008248521 201
138 3300005530 Ga0070679_100089542 Ga0070679_1000895422 201
139 3300005563 Ga0068855_100791079 Ga0068855_1007910791 201
140 3300005614 Ga0068856_100062667 Ga0068856_1000626672 201
141 3300005618 Ga0068864_101230009 Ga0068864_1012300091 201
142 3300005719 Ga0068861_100295260 Ga0068861_1002952601 201
143 3300005719 Ga0068861_100398961 Ga0068861_1003989612 201
144 3300005841 Ga0068863_100152845 Ga0068863_1001528452 201
145 3300006358 Ga0068871_100294038 Ga0068871_1002940382 201
146 3300006846 Ga0075430_100254410 Ga0075430_1002544102 201
147 3300006847 Ga0075431_100107176 Ga0075431_1001071762 201
148 3300006847 Ga0075431_100488004 Ga0075431_1004880042 201
149 3300006880 Ga0075429_100170293 Ga0075429_1001702932 201
150 3300009098 Ga0105245_10003579 Ga0105245_100035799 201
151 3300009098 Ga0105245_10047054 Ga0105245_100470544 201
152 3300009177 Ga0105248_10934121 Ga0105248_109341212 201
153 3300009545 Ga0105237_10593710 Ga0105237_105937101 201
154 3300009551 Ga0105238_11290927 Ga0105238_112909271 201
155 3300013102 Ga0157371_10813913 Ga0157371_108139131 201
156 3300013297 Ga0157378_10409912 Ga0157378_104099121 201
157 3300014969 Ga0157376_10223165 Ga0157376_102231651 201
158 3300025921 Ga0207652_10194747 Ga0207652_101947472 201
159 3300025927 Ga0207687_10001578 Ga0207687_100015784 201
160 3300025927 Ga0207687_10134828 Ga0207687_101348281 201
161 3300025938 Ga0207704_10181569 Ga0207704_101815692 201
162 3300025941 Ga0207711_10580502 Ga0207711_105805022 201
163 3300026078 Ga0207702_10124320 Ga0207702_101243202 201
164 3300026088 Ga0207641_10153835 Ga0207641_101538352 201
165 3300026095 Ga0207676_10594442 Ga0207676_105944421 201
166 3300026118 Ga0207675_100319884 Ga0207675_1003198842 201
167 3300026121 Ga0207683_10140694 Ga0207683_101406942 201
168 3300028381 Ga0268264_10207822 Ga0268264_102078222 201
169 3300031251 Ga0265327_10009262 Ga0265327_100092623 201
170 3300031711 Ga0265314_10176227 Ga0265314_101762272 201
171 3300037312 Ga0395899_0056677 Ga0395899_0056677_1758_2384 201
172 3300037418 Ga0395900_0134125 Ga0395900_0134125_25_651 201
173 3300037471 Ga0395905_0068464 Ga0395905_0068464_298_921 201
174 3300038443 Ga0395901_0017257 Ga0395901_0017257_2860_3486 201
175 3300041512 Ga0451853_0105965 Ga0451853_0105965_33_656 201
176 3300042876 Ga0451577_0004468 Ga0451577_0004468_7385_8038 201
177 3300042876 Ga0451577_0096800 Ga0451577_0096800_1027_1680 201
178 3300044673 Ga0453683_0020048 Ga0453683_0020048_2991_3644 201
179 3300044712 Ga0453684_0107996 Ga0453684_0107996_1374_2027 201
180 3300044712 Ga0453684_0115152 Ga0453684_0115152_1389_2042 201
181 3300044712 Ga0453684_0221735 Ga0453684_0221735_997_1650 201
182 3300045051 Ga0451576_0122884 Ga0451576_0122884_1038_1691 201
183 3300045051 Ga0451576_0181844 Ga0451576_0181844_645_1298 201
184 3300046471 Ga0495650_0036043 Ga0495650_0036043_1527_2153 201
185 3300049571 Ga0501034_0036322 Ga0501034_0036322_3285_3908 201
186 3300049580 Ga0501046_0229011 Ga0501046_0229011_458_1081 201
187 3300049581 Ga0501047_0006811 Ga0501047_0006811_7067_7690 201
188 3300049581 Ga0501047_0069160 Ga0501047_0069160_183_806 201
189 3300049586 Ga0501070_0091943 Ga0501070_0091943_1374_1997 201
190 3300049586 Ga0501070_0109623 Ga0501070_0109623_1450_2073 201
191 3300049590 Ga0501074_0026642 Ga0501074_0026642_2521_3144 201
192 3300049665 Ga0501227_025391 Ga0501227_025391_155_796 201
193 3300049704 Ga0501221_036993 Ga0501221_036993_59_700 201
194 3300049705 Ga0501225_0005581 Ga0501225_0005581_1163_1804 201
195 3300049822 Ga0501035_0355468 Ga0501035_0355468_97_720 201
196 3300049823 Ga0501044_0039385 Ga0501044_0039385_1300_1923 201
197 3300049823 Ga0501044_0216311 Ga0501044_0216311_473_1096 201
198 3300050507 nmdc:mga05p37_611264_c1 nmdc:mga05p37_611264_c1_14_640 201
199 3300050510 nmdc:mga06r32_676186_c1 nmdc:mga06r32_676186_c1_135_761 201
200 3300053086 Ga0500578_0021972 Ga0500578_0021972_3104_3730 201
201 3300053094 Ga0500566_0101116 Ga0500566_0101116_849_1475 201
202 3300053159 Ga0500630_023595 Ga0500630_023595_1532_2164 201
203 3300053162 Ga0500638_083309 Ga0500638_083309_75_701 201
204 3300053177 Ga0500636_0064348 Ga0500636_0064348_1319_1945 201
205 3300003320 rootH2_10175143 rootH2_101751432 202
206 3300005338 Ga0068868_100249072 Ga0068868_1002490722 202
207 3300005456 Ga0070678_100017701 Ga0070678_1000177011 202
208 3300005456 Ga0070678_100276313 Ga0070678_1002763131 202
209 3300005468 Ga0070707_100236520 Ga0070707_1002365202 202
210 3300005536 Ga0070697_100341530 Ga0070697_1003415302 202
211 3300005548 Ga0070665_100006461 Ga0070665_1000064617 202
212 3300005618 Ga0068864_100750834 Ga0068864_1007508342 202
213 3300005719 Ga0068861_100198053 Ga0068861_1001980532 202
214 3300009148 Ga0105243_10962099 Ga0105243_109620991 202
215 3300009553 Ga0105249_10232943 Ga0105249_102329432 202
216 3300025961 Ga0207712_10146664 Ga0207712_101466642 202
217 3300026023 Ga0207677_10791805 Ga0207677_107918052 202
218 3300026118 Ga0207675_100476662 Ga0207675_1004766622 202
219 3300026121 Ga0207683_10008054 Ga0207683_100080542 202
220 3300028379 Ga0268266_10013403 Ga0268266_100134033 202
221 3300031238 Ga0265332_10004035 Ga0265332_100040356 202
222 3300031507 Ga0307509_10485139 Ga0307509_104851392 202
223 3300031691 Ga0316579_10010687 Ga0316579_100106873 202
224 3300031727 Ga0316576_10006857 Ga0316576_100068574 202
225 3300031733 Ga0316577_10000093 Ga0316577_1000009320 202
226 3300032126 Ga0307415_100080442 Ga0307415_1000804422 202
227 3300032126 Ga0307415_100282588 Ga0307415_1002825882 202
228 3300032137 Ga0316585_10045618 Ga0316585_100456182 202
229 3300032139 Ga0316580_10004154 Ga0316580_100041542 202
230 3300035090 Ga0373949_0000058 Ga0373949_0000058_27820_28455 202
231 3300035398 Ga0316574_0279050 Ga0316574_0279050_277_909 202
232 3300036647 Ga0316582_0016407 Ga0316582_0016407_3304_3936 202
233 3300036712 Ga0316584_0008506 Ga0316584_0008506_3657_4289 202
234 3300042876 Ga0451577_0053267 Ga0451577_0053267_544_1221 202
235 3300044684 Ga0466966_0009813 Ga0466966_0009813_3447_4127 202
236 3300045049 Ga0466959_0024486 Ga0466959_0024486_2567_3247 202
237 3300045976 Ga0466967_0441074 Ga0466967_0441074_629_1258 202
238 3300047472 Ga0495686_0121609 Ga0495686_0121609_881_1510 202
239 3300048917 Ga0496114_0143989 Ga0496114_0143989_1006_1644 202
240 3300050508 nmdc:mga09592_38389_c1 nmdc:mga09592_38389_c1_3007_3738 202
241 3300050510 nmdc:mga06r32_38853_c1 nmdc:mga06r32_38853_c1_1204_1935 202
242 3300053118 Ga0500594_0083504 Ga0500594_0083504_106_795 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00485

PRK

Phosphoribulokinase / Uridine kinase family

36

222

0.92

PF06414

Zeta_toxin

Zeta toxin

24

97

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w8r-assembly1.cif.gz_B mutant structure of thermus thermophilus hb8 uridine-cytidine kinase 0.9424 4 200
6pwz-assembly1.cif.gz_D crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidocytidine 0.9353 4 201
1ufq-assembly1.cif.gz_B crystal structure of ligand-free human uridine-cytidine kinase 2 0.931 5 198
6n55-assembly1.cif.gz_H crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine 0.9291 5 201
6pwz-assembly1.cif.gz_A crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidocytidine 0.922 4 202
ID Description Score Start End Superfamily
af_Q2FXW6_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 4 198 3.40.50.300
af_O74427_22_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9224 7 197 3.40.50.300
af_P0A8F4_7_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9197 6 198 3.40.50.300
af_I1JJM2_43_250_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9165 1 202 3.40.50.300
af_Q5ANN6_93_307_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9153 5 200 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E0THS1-F1-model_v4 Uridine kinase (EC 2.7.1.48) 0.9769 5 198 GO:0004849
GO:0005524
GO:0005737
GO:0043771
GO:0044206
GO:0044211
AF-A0A0K1PZE2-F1-model_v4 Uridine kinase (EC 2.7.1.48) 0.9671 3 200 GO:0004849
GO:0005524
GO:0005737
GO:0043771
GO:0044206
GO:0044211
AF-A0A497E8L9-F1-model_v4 Uridine kinase (EC 2.7.1.48) 0.965 4 202 GO:0004849
GO:0005524
GO:0005737
GO:0043771
GO:0044206
GO:0044211
AF-A0A6H2H1Q9-F1-model_v4 Uridine kinase (EC 2.7.1.48) (Cytidine monophosphokinase) (Uridine monophosphokinase) 0.965 6 198 GO:0004849
GO:0005524
GO:0005737
GO:0016773
GO:0044206
GO:0044211
AF-A0A7S1XWE6-F1-model_v4 Uridine kinase (EC 2.7.1.48) 0.9639 4 198 GO:0005524
GO:0016301
GO:0044206
GO:0044211

Feature Viewer

pLDDT pTM Quality
88.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map