F354182

General Info

Members Datasets Scaffolds Average Seq Length
241 140 482 185

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0106877|Ga0501084_0106877_1511_2077
Length 188
Sequence MAHPADYGRTGPGRPIYGLMAEFDNAEALVEAAKRTHAEGYRKTDAYSPFPIEAVWEALHADDRRVQLFVLCGGIVGALAGFGLCYWTQVIAYPLNIGGRPFNSWPAFIPVTFETTILVASFTAVISMFALNGLPMPYHPAFNVPGFAMASRDKFFLAIEAADPKFDRQKTFEFLKSLAPKEINEIEP

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.83
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 19.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0106877 3300054114 Bacteria 2351
2 Ga0065714_10002186 3300005288 Bacteria 191932
3 Ga0065704_10017458 3300005289 Bacteria 1786
4 Ga0065712_10000113 3300005290 Bacteria 191931
5 Ga0065707_10103654 3300005295 Bacteria 2700
6 Ga0065707_10138683 3300005295 Bacteria 1803
7 Ga0070690_100009961 3300005330 Bacteria 5515
8 Ga0070690_100098519 3300005330 Unclassified 1935
9 Ga0070690_100165368 3300005330 Bacteria 1519
10 Ga0070690_100717638 3300005330 Unclassified 769
11 Ga0068869_100014796 3300005334 Bacteria 5219
12 Ga0068869_100027671 3300005334 Bacteria 3955
13 Ga0068869_100152357 3300005334 Bacteria 1794
14 Ga0068869_100717115 3300005334 Bacteria 854
15 Ga0070689_100479220 3300005340 Unclassified 1063
16 Ga0070687_100092529 3300005343 Bacteria 1676
17 Ga0070687_100360573 3300005343 Bacteria 941
18 Ga0070668_100001118 3300005347 Bacteria 18921
19 Ga0070671_100387903 3300005355 Bacteria 1194
20 Ga0070671_100641599 3300005355 Bacteria 919
21 Ga0070673_100056578 3300005364 Bacteria 3095
22 Ga0070673_100161959 3300005364 Unclassified 1903
23 Ga0070688_100192445 3300005365 Bacteria 1422
24 Ga0070688_100543543 3300005365 Bacteria 882
25 Ga0070709_11219846 3300005434 Unclassified 605
26 Ga0070705_100438340 3300005440 Bacteria 977
27 Ga0070700_100297119 3300005441 Unclassified 1177
28 Ga0070694_100002428 3300005444 Bacteria 10998
29 Ga0070708_100143545 3300005445 Bacteria 2215
30 Ga0070708_100158031 3300005445 Unclassified 2111
31 Ga0070708_100781024 3300005445 Bacteria 898
32 Ga0070708_100882624 3300005445 Bacteria 840
33 Ga0070708_101212348 3300005445 Bacteria 706
34 Ga0068867_100580718 3300005459 Bacteria 975
35 Ga0070706_100005412 3300005467 Bacteria 12159
36 Ga0070706_100067323 3300005467 Bacteria 3312
37 Ga0070706_100084768 3300005467 Bacteria 2935
38 Ga0070706_101055256 3300005467 Bacteria 748
39 Ga0070706_101182481 3300005467 Unclassified 703
40 Ga0070707_100000671 3300005468 Bacteria 33971
41 Ga0070707_100306618 3300005468 Bacteria 1543
42 Ga0070707_100738023 3300005468 Bacteria 948
43 Ga0070698_100002133 3300005471 Bacteria 21955
44 Ga0070698_100036843 3300005471 Bacteria 5048
45 Ga0070698_100046788 3300005471 Bacteria 4423
46 Ga0070698_100053381 3300005471 Bacteria 4107
47 Ga0070698_100131419 3300005471 Bacteria 2459
48 Ga0070698_100594394 3300005471 Bacteria 1047
49 Ga0070698_101006400 3300005471 Unclassified 781
50 Ga0070699_100104870 3300005518 Bacteria 2480
51 Ga0070699_100152221 3300005518 Bacteria 2046
52 Ga0070697_100025140 3300005536 Bacteria 4747
53 Ga0070697_100027449 3300005536 Bacteria 4554
54 Ga0070697_100110845 3300005536 Bacteria 2287
55 Ga0070697_100336164 3300005536 Bacteria 1303
56 Ga0070697_101022328 3300005536 Bacteria 735
57 Ga0070686_100158270 3300005544 Bacteria 1593
58 Ga0070686_100336325 3300005544 Unclassified 1130
59 Ga0070695_100477779 3300005545 Bacteria 960
60 Ga0070695_100848381 3300005545 Bacteria 735
61 Ga0070695_100863295 3300005545 Unclassified 729
62 Ga0070696_100441264 3300005546 Unclassified 1025
63 Ga0070696_100543657 3300005546 Bacteria 930
64 Ga0070696_100942498 3300005546 Bacteria 718
65 Ga0070704_100022713 3300005549 Bacteria 4086
66 Ga0070704_100166119 3300005549 Bacteria 1750
67 Ga0070704_100295693 3300005549 Bacteria 1347
68 Ga0070704_100327819 3300005549 Bacteria 1285
69 Ga0070704_100596024 3300005549 Bacteria 971
70 Ga0070704_100745155 3300005549 Bacteria 872
71 Ga0068857_100668673 3300005577 Unclassified 985
72 Ga0068854_100800422 3300005578 Unclassified 821
73 Ga0068856_100974803 3300005614 Unclassified 866
74 Ga0070702_100799123 3300005615 Bacteria 729
75 Ga0068852_101493763 3300005616 Unclassified 698
76 Ga0068859_100131107 3300005617 Bacteria 2578
77 Ga0068859_100218128 3300005617 Bacteria 1995
78 Ga0068859_100412495 3300005617 Bacteria 1447
79 Ga0068859_102011791 3300005617 Unclassified 638
80 Ga0068864_100157296 3300005618 Bacteria 2063
81 Ga0068864_100328660 3300005618 Bacteria 1438
82 Ga0068864_100879323 3300005618 Bacteria 884
83 Ga0068866_10009506 3300005718 Bacteria 4129
84 Ga0068861_100353365 3300005719 Unclassified 1290
85 Ga0068861_100422574 3300005719 Bacteria 1188
86 Ga0068858_100223105 3300005842 Unclassified 1786
87 Ga0068860_100700408 3300005843 Bacteria 1023
88 Ga0068862_100387100 3300005844 Bacteria 1305
89 Ga0081538_10019143 3300005981 Bacteria 5105
90 Ga0081539_10001769 3300005985 Bacteria 34433
91 Ga0070715_10000010 3300006163 Bacteria 184687
92 Ga0070716_100000003 3300006173 Bacteria 312721
93 Ga0068871_100260998 3300006358 Bacteria 1511
94 Ga0075431_100354365 3300006847 Bacteria 1475
95 Ga0075433_10390614 3300006852 Bacteria 1228
96 Ga0075429_100181240 3300006880 Bacteria 1846
97 Ga0097620_100131115 3300006931 Bacteria 2578
98 Ga0097620_100218126 3300006931 Bacteria 1995
99 Ga0097620_100412507 3300006931 Bacteria 1447
100 Ga0097620_102012153 3300006931 Unclassified 638
101 Ga0099794_10004702 3300007265 Bacteria 5409
102 Ga0105240_10036878 3300009093 Bacteria 6285
103 Ga0111539_10122095 3300009094 Bacteria 3053
104 Ga0111539_10254373 3300009094 Bacteria 2045
105 Ga0105245_10060575 3300009098 Bacteria 3409
106 Ga0105245_10143598 3300009098 Unclassified 2250
107 Ga0114129_10084320 3300009147 Bacteria 4412
108 Ga0114129_10230216 3300009147 Bacteria 2496
109 Ga0114129_10498135 3300009147 Bacteria 1591
110 Ga0105243_10000015 3300009148 Bacteria 251115
111 Ga0105243_10345180 3300009148 Bacteria 1365
112 Ga0105241_10399994 3300009174 Bacteria 1204
113 Ga0105241_10597971 3300009174 Bacteria 996
114 Ga0105242_10000028 3300009176 Bacteria 106293
115 Ga0105242_10002527 3300009176 Bacteria 14352
116 Ga0105242_10877110 3300009176 Bacteria 895
117 Ga0105242_12029190 3300009176 Bacteria 618
118 Ga0105248_10406375 3300009177 Bacteria 1533
119 Ga0105248_11519842 3300009177 Bacteria 758
120 Ga0105238_10571236 3300009551 Bacteria 1136
121 Ga0105249_10000480 3300009553 Bacteria 37106
122 Ga0105249_10038574 3300009553 Bacteria 4335
123 Ga0105249_10902898 3300009553 Bacteria 950
124 Ga0105239_10820508 3300010375 Unclassified 1066
125 Ga0157373_10088973 3300013100 Bacteria 2175
126 Ga0157373_10219508 3300013100 Bacteria 1341
127 Ga0157373_10292237 3300013100 Bacteria 1156
128 Ga0157369_10000217 3300013105 Bacteria 79801
129 Ga0157378_10011111 3300013297 Bacteria 7879
130 Ga0157378_10035045 3300013297 Bacteria 4438
131 Ga0157378_10047857 3300013297 Bacteria 3802
132 Ga0157378_10110992 3300013297 Bacteria 2514
133 Ga0157378_10129620 3300013297 Bacteria 2333
134 Ga0157378_11079383 3300013297 Bacteria 839
135 Ga0163162_10279792 3300013306 Unclassified 1801
136 Ga0157375_10480723 3300013308 Unclassified 1407
137 Ga0157375_11619741 3300013308 Bacteria 766
138 Ga0157380_10004589 3300014326 Bacteria 9591
139 Ga0157380_10495905 3300014326 Bacteria 1185
140 Ga0157380_11984210 3300014326 Unclassified 644
141 Ga0157377_10000129 3300014745 Bacteria 48882
142 Ga0163161_10012255 3300017792 Bacteria 5949
143 Ga0163161_10462342 3300017792 Bacteria 1027
144 Ga0213876_10168663 3300021384 Bacteria 1164
145 Ga0207642_10005179 3300025899 Bacteria 4244
146 Ga0207685_10000006 3300025905 Bacteria 284255
147 Ga0207643_10224636 3300025908 Bacteria 1150
148 Ga0207684_10044181 3300025910 Bacteria 3777
149 Ga0207684_10053810 3300025910 Bacteria 3415
150 Ga0207684_10068757 3300025910 Bacteria 3010
151 Ga0207684_11064373 3300025910 Unclassified 674
152 Ga0207654_10387127 3300025911 Bacteria 970
153 Ga0207707_10060944 3300025912 Bacteria 3283
154 Ga0207695_10064028 3300025913 Bacteria 3788
155 Ga0207662_10301566 3300025918 Bacteria 1065
156 Ga0207662_10653598 3300025918 Unclassified 734
157 Ga0207646_10000151 3300025922 Bacteria 95358
158 Ga0207646_10046403 3300025922 Bacteria 3898
159 Ga0207681_10372951 3300025923 Bacteria 1147
160 Ga0207687_10844907 3300025927 Unclassified 782
161 Ga0207686_10000031 3300025934 Bacteria 158735
162 Ga0207686_10000361 3300025934 Bacteria 32074
163 Ga0207709_10000009 3300025935 Bacteria 619238
164 Ga0207709_10257182 3300025935 Bacteria 1278
165 Ga0207709_10415628 3300025935 Bacteria 1032
166 Ga0207709_10831413 3300025935 Unclassified 747
167 Ga0207669_10194466 3300025937 Unclassified 1466
168 Ga0207665_10000009 3300025939 Bacteria 162252
169 Ga0207711_10368788 3300025941 Bacteria 1331
170 Ga0207711_10541070 3300025941 Bacteria 1086
171 Ga0207689_10161793 3300025942 Bacteria 1844
172 Ga0207689_10575376 3300025942 Unclassified 947
173 Ga0207651_10054302 3300025960 Bacteria 2744
174 Ga0207651_10618387 3300025960 Bacteria 949
175 Ga0207712_10000164 3300025961 Bacteria 68361
176 Ga0207712_10092697 3300025961 Bacteria 2228
177 Ga0207668_10001056 3300025972 Bacteria 16429
178 Ga0207640_10672811 3300025981 Bacteria 884
179 Ga0207703_10163817 3300026035 Unclassified 1949
180 Ga0207703_10262199 3300026035 Bacteria 1562
181 Ga0207708_10115581 3300026075 Bacteria 2087
182 Ga0207708_10359017 3300026075 Bacteria 1197
183 Ga0207702_11268580 3300026078 Unclassified 731
184 Ga0207641_10918033 3300026088 Bacteria 870
185 Ga0207641_11423042 3300026088 Bacteria 694
186 Ga0207648_10450697 3300026089 Bacteria 1172
187 Ga0207648_10748475 3300026089 Bacteria 908
188 Ga0207648_10938451 3300026089 Unclassified 809
189 Ga0207676_10174328 3300026095 Bacteria 1877
190 Ga0207675_100097908 3300026118 Bacteria 2763
191 Ga0207675_100694197 3300026118 Bacteria 1026
192 Ga0207675_100774951 3300026118 Bacteria 971
193 Ga0207698_11008397 3300026142 Bacteria 843
194 Ga0268265_10100125 3300028380 Bacteria 2338
195 Ga0268264_10767901 3300028381 Bacteria 961
196 Ga0307513_10386791 3300031456 Bacteria 1137
197 Ga0316576_10956996 3300031727 Bacteria 611
198 Ga0307410_10571409 3300031852 Unclassified 940
199 Ga0373937_0053786 3300036401 Bacteria 3693
200 Ga0395898_0877801 3300037466 Bacteria 836
201 Ga0242420_056585 3300038996 Unclassified 775
202 Ga0436365_0208600 3300039437 Bacteria 2618
203 Ga0436365_0894711 3300039437 Bacteria 2050
204 Ga0439433_0040245 3300041999 Bacteria 1087
205 Ga0439462_0094583 3300042015 Unclassified 821
206 Ga0453683_0191089 3300044673 Bacteria 1299
207 Ga0453683_0407524 3300044673 Bacteria 877
208 Ga0453684_0717251 3300044712 Unclassified 1085
209 Ga0451576_0074056 3300045051 Unclassified 3543
210 Ga0495630_0182163 3300046517 Unclassified 1602
211 Ga0495586_0276420 3300046535 Unclassified 961
212 Ga0495621_0045984 3300046539 Bacteria 1547
213 Ga0495621_0254608 3300046539 Unclassified 718
214 Ga0495635_0320568 3300046663 Unclassified 1037
215 Ga0495588_0433663 3300046674 Bacteria 690
216 Ga0495658_0270385 3300046683 Unclassified 1071
217 Ga0495613_0145908 3300046689 Bacteria 1689
218 Ga0495636_0042744 3300047318 Bacteria 1884
219 Ga0495672_0006734 3300047320 Bacteria 8820
220 Ga0495677_0027416 3300047445 Bacteria 2068
221 Ga0496112_0038056 3300048915 Bacteria 4697
222 Ga0496112_0517362 3300048915 Bacteria 1128
223 Ga0501034_0033463 3300049571 Bacteria 5214
224 Ga0501036_0198792 3300049572 Bacteria 1686
225 Ga0501043_0190662 3300049579 Bacteria 1594
226 Ga0501047_0032278 3300049581 Bacteria 5054
227 Ga0501048_0198817 3300049582 Unclassified 1421
228 Ga0501081_0410798 3300049743 Unclassified 1003
229 Ga0501044_0022341 3300049823 Bacteria 6742
230 nmdc:mga05p37_276263_c1 3300050507 Bacteria 2006
231 nmdc:mga05p37_74915_c1 3300050507 Bacteria 4166
232 nmdc:mga05p37_874352_c1 3300050507 Unclassified 973
233 nmdc:mga09592_123574_c1 3300050508 Bacteria 2224
234 nmdc:mga0qj67_35020_c1 3300050509 Bacteria 3924
235 nmdc:mga06r32_102010_c1 3300050510 Bacteria 2816
236 nmdc:mga06r32_450981_c1 3300050510 Bacteria 1266
237 nmdc:mga08y16_87309_c1 3300050511 Bacteria 3250
238 nmdc:mga0n895_199886_c1 3300050512 Bacteria 2030
239 nmdc:mga08x19_813220_c1 3300050514 Bacteria 664
240 nmdc:mga0a205_73392_c1 3300050515 Bacteria 3306
241 Ga0501082_0263297 3300060353 Bacteria 1500
242 Ga0501084_0106877
243 Ga0065714_10002186
244 Ga0065704_10017458
245 Ga0065712_10000113
246 Ga0065707_10103654
247 Ga0065707_10138683
248 Ga0070690_100009961
249 Ga0070690_100098519
250 Ga0070690_100165368
251 Ga0070690_100717638
252 Ga0068869_100014796
253 Ga0068869_100027671
254 Ga0068869_100152357
255 Ga0068869_100717115
256 Ga0070689_100479220
257 Ga0070687_100092529
258 Ga0070687_100360573
259 Ga0070668_100001118
260 Ga0070671_100387903
261 Ga0070671_100641599
262 Ga0070673_100056578
263 Ga0070673_100161959
264 Ga0070688_100192445
265 Ga0070688_100543543
266 Ga0070709_11219846
267 Ga0070705_100438340
268 Ga0070700_100297119
269 Ga0070694_100002428
270 Ga0070708_100143545
271 Ga0070708_100158031
272 Ga0070708_100781024
273 Ga0070708_100882624
274 Ga0070708_101212348
275 Ga0068867_100580718
276 Ga0070706_100005412
277 Ga0070706_100067323
278 Ga0070706_100084768
279 Ga0070706_101055256
280 Ga0070706_101182481
281 Ga0070707_100000671
282 Ga0070707_100306618
283 Ga0070707_100738023
284 Ga0070698_100002133
285 Ga0070698_100036843
286 Ga0070698_100046788
287 Ga0070698_100053381
288 Ga0070698_100131419
289 Ga0070698_100594394
290 Ga0070698_101006400
291 Ga0070699_100104870
292 Ga0070699_100152221
293 Ga0070697_100025140
294 Ga0070697_100027449
295 Ga0070697_100110845
296 Ga0070697_100336164
297 Ga0070697_101022328
298 Ga0070686_100158270
299 Ga0070686_100336325
300 Ga0070695_100477779
301 Ga0070695_100848381
302 Ga0070695_100863295
303 Ga0070696_100441264
304 Ga0070696_100543657
305 Ga0070696_100942498
306 Ga0070704_100022713
307 Ga0070704_100166119
308 Ga0070704_100295693
309 Ga0070704_100327819
310 Ga0070704_100596024
311 Ga0070704_100745155
312 Ga0068857_100668673
313 Ga0068854_100800422
314 Ga0068856_100974803
315 Ga0070702_100799123
316 Ga0068852_101493763
317 Ga0068859_100131107
318 Ga0068859_100218128
319 Ga0068859_100412495
320 Ga0068859_102011791
321 Ga0068864_100157296
322 Ga0068864_100328660
323 Ga0068864_100879323
324 Ga0068866_10009506
325 Ga0068861_100353365
326 Ga0068861_100422574
327 Ga0068858_100223105
328 Ga0068860_100700408
329 Ga0068862_100387100
330 Ga0081538_10019143
331 Ga0081539_10001769
332 Ga0070715_10000010
333 Ga0070716_100000003
334 Ga0068871_100260998
335 Ga0075431_100354365
336 Ga0075433_10390614
337 Ga0075429_100181240
338 Ga0097620_100131115
339 Ga0097620_100218126
340 Ga0097620_100412507
341 Ga0097620_102012153
342 Ga0099794_10004702
343 Ga0105240_10036878
344 Ga0111539_10122095
345 Ga0111539_10254373
346 Ga0105245_10060575
347 Ga0105245_10143598
348 Ga0114129_10084320
349 Ga0114129_10230216
350 Ga0114129_10498135
351 Ga0105243_10000015
352 Ga0105243_10345180
353 Ga0105241_10399994
354 Ga0105241_10597971
355 Ga0105242_10000028
356 Ga0105242_10002527
357 Ga0105242_10877110
358 Ga0105242_12029190
359 Ga0105248_10406375
360 Ga0105248_11519842
361 Ga0105238_10571236
362 Ga0105249_10000480
363 Ga0105249_10038574
364 Ga0105249_10902898
365 Ga0105239_10820508
366 Ga0157373_10088973
367 Ga0157373_10219508
368 Ga0157373_10292237
369 Ga0157369_10000217
370 Ga0157378_10011111
371 Ga0157378_10035045
372 Ga0157378_10047857
373 Ga0157378_10110992
374 Ga0157378_10129620
375 Ga0157378_11079383
376 Ga0163162_10279792
377 Ga0157375_10480723
378 Ga0157375_11619741
379 Ga0157380_10004589
380 Ga0157380_10495905
381 Ga0157380_11984210
382 Ga0157377_10000129
383 Ga0163161_10012255
384 Ga0163161_10462342
385 Ga0213876_10168663
386 Ga0207642_10005179
387 Ga0207685_10000006
388 Ga0207643_10224636
389 Ga0207684_10044181
390 Ga0207684_10053810
391 Ga0207684_10068757
392 Ga0207684_11064373
393 Ga0207654_10387127
394 Ga0207707_10060944
395 Ga0207695_10064028
396 Ga0207662_10301566
397 Ga0207662_10653598
398 Ga0207646_10000151
399 Ga0207646_10046403
400 Ga0207681_10372951
401 Ga0207687_10844907
402 Ga0207686_10000031
403 Ga0207686_10000361
404 Ga0207709_10000009
405 Ga0207709_10257182
406 Ga0207709_10415628
407 Ga0207709_10831413
408 Ga0207669_10194466
409 Ga0207665_10000009
410 Ga0207711_10368788
411 Ga0207711_10541070
412 Ga0207689_10161793
413 Ga0207689_10575376
414 Ga0207651_10054302
415 Ga0207651_10618387
416 Ga0207712_10000164
417 Ga0207712_10092697
418 Ga0207668_10001056
419 Ga0207640_10672811
420 Ga0207703_10163817
421 Ga0207703_10262199
422 Ga0207708_10115581
423 Ga0207708_10359017
424 Ga0207702_11268580
425 Ga0207641_10918033
426 Ga0207641_11423042
427 Ga0207648_10450697
428 Ga0207648_10748475
429 Ga0207648_10938451
430 Ga0207676_10174328
431 Ga0207675_100097908
432 Ga0207675_100694197
433 Ga0207675_100774951
434 Ga0207698_11008397
435 Ga0268265_10100125
436 Ga0268264_10767901
437 Ga0307513_10386791
438 Ga0316576_10956996
439 Ga0307410_10571409
440 Ga0373937_0053786
441 Ga0395898_0877801
442 Ga0242420_056585
443 Ga0436365_0208600
444 Ga0436365_0894711
445 Ga0439433_0040245
446 Ga0439462_0094583
447 Ga0453683_0191089
448 Ga0453683_0407524
449 Ga0453684_0717251
450 Ga0451576_0074056
451 Ga0495630_0182163
452 Ga0495586_0276420
453 Ga0495621_0045984
454 Ga0495621_0254608
455 Ga0495635_0320568
456 Ga0495588_0433663
457 Ga0495658_0270385
458 Ga0495613_0145908
459 Ga0495636_0042744
460 Ga0495672_0006734
461 Ga0495677_0027416
462 Ga0496112_0038056
463 Ga0496112_0517362
464 Ga0501034_0033463
465 Ga0501036_0198792
466 Ga0501043_0190662
467 Ga0501047_0032278
468 Ga0501048_0198817
469 Ga0501081_0410798
470 Ga0501044_0022341
471 nmdc:mga05p37_276263_c1
472 nmdc:mga05p37_74915_c1
473 nmdc:mga05p37_874352_c1
474 nmdc:mga09592_123574_c1
475 nmdc:mga0qj67_35020_c1
476 nmdc:mga06r32_102010_c1
477 nmdc:mga06r32_450981_c1
478 nmdc:mga08y16_87309_c1
479 nmdc:mga0n895_199886_c1
480 nmdc:mga08x19_813220_c1
481 nmdc:mga0a205_73392_c1
482 Ga0501082_0263297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

17

185

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8173 19 191
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8092 19 191
6f0k-assembly1.cif.gz_D alternative complex iii 0.7655 19 189
6f0k-assembly1.cif.gz_D alternative complex iii 0.7618 19 189
6btm-assembly1.cif.gz_D structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.6927 22 191
ID Description Score Start End Superfamily
af_Q9LZH8_11_121_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7918 69 135 1.10.10.1740
af_Q8IN78_69_185_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.778 68 135 1.10.10.1740
af_A4HU35_25_141_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6681 65 144 1.10.10.1740
af_Q6AY94_77_199_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6107 68 135 1.10.10.1740
2uv9E08 Special;Helix non-globular;Helix Hairpins; 0.5857 66 137 6.10.140.1410
ID Description Score Start End GO Terms
AF-M6K509-F1-model_v4 PF11821 domain protein 0.9124 63 132 GO:0016020
AF-M6K509-F1-model_v4 PF11821 domain protein 0.8776 63 132 GO:0016020
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8747 13 191 GO:0016020
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8702 13 191 GO:0016020
AF-A0A518KZD0-F1-model_v4 deleted 0.8558 12 191

Map