F354128

General Info

Members Datasets Scaffolds Average Seq Length
241 178 241 301

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0031272|Ga0501037_0031272_192_1244
Length 350
Sequence MRQMVKSRTLKKKLNAQHDKGVTTMRVIMTGGTGFIGRALITKLVDNGHSVTVLSRNAVKARTLLPPSATCIAWNPCSKGVWWEVFEDAEAVINLAGAPIAEGRWTEARKRLIRDSRVNATRAVVEAVRSHAAKSCVLINASGIGYYGASNGISINETVGPGNGFLADLCVEWEGEARRAEEWGVRVVRLRFGMVLERDGGALPQMALPFRLFIGGPIMPGSQWVSWIHRRDLIGLIEWALTNPKVSGAVNAVSLEPVTMRTFCHALGIALHRPSWLPVPEIALRVGLGDLGSVMTTGQRVLPLVAVKEGYNFQYPELQPALRAIWRRNEETVASREEAGNTFMSMRRAK

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
139 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
140 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
141 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
159 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
160 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
163 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
166 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
167 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
168 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 1.24
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10143325 3300005289 Viruses 1496
2 Ga0065715_10095905 3300005293 Bacteria 3982
3 Ga0065707_10109119 3300005295 Viruses 2481
4 Ga0070676_10049237 3300005328 Viruses 2466
5 Ga0070683_100117547 3300005329 Unclassified 2510
6 Ga0070690_100023843 3300005330 Unclassified 3758
7 Ga0068869_100019513 3300005334 Unclassified 4634
8 Ga0068869_100113979 3300005334 Bacteria 2060
9 Ga0070666_10140063 3300005335 Bacteria 1685
10 Ga0070680_100034103 3300005336 Viruses 4104
11 Ga0070682_100332306 3300005337 Bacteria 1127
12 Ga0068868_100043775 3300005338 Unclassified 3498
13 Ga0070660_100377618 3300005339 Bacteria 1170
14 Ga0070689_100002851 3300005340 Bacteria 11365
15 Ga0070689_100036124 3300005340 Viruses 3778
16 Ga0070689_100059071 3300005340 Bacteria 2980
17 Ga0070687_100015978 3300005343 Bacteria 3408
18 Ga0070687_100037908 3300005343 Viruses 2413
19 Ga0070668_100041772 3300005347 Viruses 3514
20 Ga0070669_100025320 3300005353 Unclassified 4260
21 Ga0070675_100125574 3300005354 Viruses 2182
22 Ga0070674_100005770 3300005356 Bacteria 7185
23 Ga0070673_100084289 3300005364 Unclassified 2584
24 Ga0070688_100036003 3300005365 Viruses 3009
25 Ga0070688_100116605 3300005365 Bacteria 1783
26 Ga0070659_100033736 3300005366 Viruses 3978
27 Ga0070700_100018018 3300005441 Unclassified 4052
28 Ga0070694_100041544 3300005444 Bacteria 3068
29 Ga0070681_10057341 3300005458 Unclassified 3875
30 Ga0068867_100021863 3300005459 Unclassified 4568
31 Ga0070707_100028910 3300005468 Bacteria 5276
32 Ga0070707_100149376 3300005468 Unclassified 2275
33 Ga0070698_100000349 3300005471 Bacteria 47759
34 Ga0070699_100001010 3300005518 Bacteria 26157
35 Ga0070699_100012231 3300005518 Bacteria 7406
36 Ga0070699_100239185 3300005518 Bacteria 1620
37 Ga0070679_100084933 3300005530 Viruses 3153
38 Ga0070679_100113890 3300005530 Bacteria 2690
39 Ga0070684_100168170 3300005535 Bacteria 1991
40 Ga0070697_100015326 3300005536 Bacteria 6015
41 Ga0070672_100034620 3300005543 Bacteria 3834
42 Ga0070695_100031880 3300005545 Viruses 3292
43 Ga0070696_100121956 3300005546 Viruses 1887
44 Ga0070665_100214903 3300005548 Viruses 1924
45 Ga0070704_100047635 3300005549 Bacteria 2997
46 Ga0070704_100064580 3300005549 Unclassified 2632
47 Ga0068855_100303147 3300005563 Viruses 1769
48 Ga0070664_100312448 3300005564 Unclassified 1422
49 Ga0068859_100172389 3300005617 Bacteria 2245
50 Ga0068859_100204069 3300005617 Bacteria 2062
51 Ga0068864_100268942 3300005618 Bacteria 1588
52 Ga0068862_100081371 3300005844 Unclassified 2810
53 Ga0068862_100251541 3300005844 Viruses 1611
54 Ga0081539_10004156 3300005985 Bacteria 16440
55 Ga0075432_10016178 3300006058 Viruses 2547
56 Ga0097621_100243833 3300006237 Viruses 1572
57 Ga0068871_100162545 3300006358 Bacteria 1910
58 Ga0068871_100349467 3300006358 Viruses 1308
59 Ga0075428_100000957 3300006844 Bacteria 30618
60 Ga0075428_100038135 3300006844 Bacteria 5289
61 Ga0075428_100056740 3300006844 Bacteria 4288
62 Ga0075428_100189854 3300006844 Viruses 2222
63 Ga0075430_100000407 3300006846 Bacteria 31945
64 Ga0075430_100007925 3300006846 Bacteria 8981
65 Ga0075430_100012431 3300006846 Bacteria 7243
66 Ga0075430_100126135 3300006846 Viruses 2133
67 Ga0075431_100000321 3300006847 Bacteria 37773
68 Ga0075431_100009237 3300006847 Bacteria 9895
69 Ga0075433_10016758 3300006852 Bacteria 6050
70 Ga0075433_10358469 3300006852 Viruses 1288
71 Ga0075434_100254930 3300006871 Viruses 1773
72 Ga0075429_100001231 3300006880 Bacteria 20763
73 Ga0075429_100444967 3300006880 Bacteria 1135
74 Ga0068865_100025361 3300006881 Viruses 3899
75 Ga0075436_100046543 3300006914 Viruses 2991
76 Ga0097620_100172403 3300006931 Bacteria 2245
77 Ga0097620_100204052 3300006931 Bacteria 2062
78 Ga0111539_10109375 3300009094 Unclassified 3244
79 Ga0111539_10274602 3300009094 Bacteria 1961
80 Ga0111539_10333801 3300009094 Bacteria 1765
81 Ga0111539_10422522 3300009094 Bacteria 1552
82 Ga0105245_10041312 3300009098 Viruses 4111
83 Ga0114129_10002373 3300009147 Bacteria 26153
84 Ga0114129_10141351 3300009147 Bacteria 3299
85 Ga0114129_10222742 3300009147 Bacteria 2544
86 Ga0114129_10266612 3300009147 Bacteria 2293
87 Ga0114129_10380883 3300009147 Viruses 1863
88 Ga0114129_10614118 3300009147 Bacteria 1407
89 Ga0105243_10044200 3300009148 Unclassified 3494
90 Ga0105249_10085530 3300009553 Viruses 2939
91 Ga0105239_10265174 3300010375 Viruses 1931
92 Ga0157371_10138400 3300013102 Bacteria 1734
93 Ga0157374_10107209 3300013296 Bacteria 2685
94 Ga0157378_10159889 3300013297 Viruses 2106
95 Ga0163162_10141928 3300013306 Unclassified 2515
96 Ga0157380_10005982 3300014326 Bacteria 8513
97 Ga0157377_10110085 3300014745 Bacteria 1654
98 Ga0157376_10022032 3300014969 Bacteria 4957
99 Ga0157376_10087578 3300014969 Viruses 2688
100 Ga0213875_10018737 3300021388 Bacteria 3334
101 Ga0207682_10185935 3300025893 Bacteria 950
102 Ga0207680_10021530 3300025903 Bacteria 3490
103 Ga0207645_10015627 3300025907 Bacteria 5038
104 Ga0207707_10071710 3300025912 Viruses 3019
105 Ga0207707_10134849 3300025912 Unclassified 2159
106 Ga0207660_10222026 3300025917 Bacteria 1483
107 Ga0207662_10025437 3300025918 Bacteria 3409
108 Ga0207662_10040694 3300025918 Viruses 2733
109 Ga0207657_10064576 3300025919 Viruses 3124
110 Ga0207652_10372671 3300025921 Bacteria 1289
111 Ga0207646_10000436 3300025922 Bacteria 55841
112 Ga0207646_10076437 3300025922 Unclassified 2992
113 Ga0207659_10284415 3300025926 Bacteria 1353
114 Ga0207687_10045685 3300025927 Viruses 3028
115 Ga0207706_10027079 3300025933 Bacteria 5127
116 Ga0207686_10006800 3300025934 Bacteria 6158
117 Ga0207686_10044438 3300025934 Viruses 2727
118 Ga0207709_10022994 3300025935 Viruses 3543
119 Ga0207670_10016606 3300025936 Bacteria 4429
120 Ga0207669_10040468 3300025937 Viruses 2704
121 Ga0207704_10181840 3300025938 Viruses 1520
122 Ga0207691_10038471 3300025940 Viruses 4427
123 Ga0207689_10081134 3300025942 Viruses 2667
124 Ga0207689_10197765 3300025942 Bacteria 1659
125 Ga0207679_10272453 3300025945 Viruses 1448
126 Ga0207712_10101366 3300025961 Viruses 2141
127 Ga0207668_10108817 3300025972 Viruses 2075
128 Ga0207658_10148920 3300025986 Viruses 1904
129 Ga0207678_10360176 3300026067 Bacteria 1255
130 Ga0207708_10012192 3300026075 Bacteria 6412
131 Ga0207641_10077608 3300026088 Bacteria 2875
132 Ga0207648_10001445 3300026089 Bacteria 26161
133 Ga0207676_10191005 3300026095 Bacteria 1802
134 Ga0207676_10255207 3300026095 Bacteria 1580
135 Ga0207675_100318896 3300026118 Unclassified 1517
136 Ga0207683_10026121 3300026121 Bacteria 5041
137 Ga0209967_1001393 3300027364 Bacteria 3099
138 Ga0209996_1000337 3300027395 Bacteria 5811
139 Ga0209984_1000471 3300027424 Viruses 4389
140 Ga0209995_1000688 3300027471 Bacteria 5171
141 Ga0209968_1001689 3300027526 Viruses 3334
142 Ga0209999_1002639 3300027543 Bacteria 3178
143 Ga0210002_1001400 3300027617 Viruses 3390
144 Ga0209983_1002722 3300027665 Viruses 3838
145 Ga0209971_1004992 3300027682 Viruses 3152
146 Ga0209966_1001509 3300027695 Unclassified 4040
147 Ga0209966_1022482 3300027695 Bacteria 1233
148 Ga0209998_10001098 3300027717 Bacteria 6753
149 Ga0209974_10001499 3300027876 Bacteria 8483
150 Ga0209974_10009203 3300027876 Bacteria 3353
151 Ga0207428_10099367 3300027907 Bacteria 2250
152 Ga0207428_10105633 3300027907 Viruses 2172
153 Ga0207428_10341832 3300027907 Unclassified 1102
154 Ga0268265_10317125 3300028380 Unclassified 1410
155 Ga0307509_10027155 3300031507 Bacteria 6372
156 Ga0307408_100042447 3300031548 Bacteria 3230
157 Ga0307405_10057628 3300031731 Bacteria 2441
158 Ga0307407_10032595 3300031903 Bacteria 2834
159 Ga0307409_100379226 3300031995 Unclassified 1344
160 Ga0307416_100016222 3300032002 Bacteria 5169
161 Ga0307411_10026200 3300032005 Bacteria 3507
162 Ga0373950_0015871 3300034818 Bacteria 1282
163 Ga0373949_0039709 3300035090 Bacteria 1153
164 Ga0373936_0000015 3300035113 Bacteria 200263
165 Ga0373939_0030243 3300035114 Viruses 1556
166 Ga0373925_0018775 3300037068 Bacteria 5026
167 Ga0436364_0285297 3300037853 Bacteria 3524
168 Ga0395901_0266903 3300038443 Bacteria 1781
169 Ga0439450_020982 3300042008 Bacteria 1399
170 Ga0439446_0012854 3300042156 Bacteria 2291
171 Ga0439435_0013208 3300042436 Unclassified 2015
172 Ga0439460_0007808 3300042461 Unclassified 2686
173 Ga0495643_0002387 3300046522 Bacteria 14998
174 Ga0495657_0082923 3300046675 Bacteria 2070
175 Ga0495676_0173822 3300047321 Unclassified 1514
176 Ga0496108_0000060 3300048911 Bacteria 123058
177 Ga0496109_0061508 3300048912 Bacteria 3433
178 Ga0496110_0207111 3300048913 Unclassified 1782
179 Ga0496125_0007937 3300048928 Bacteria 11208
180 Ga0501290_002197 3300049513 Unclassified 2539
181 Ga0501295_003076 3300049518 Bacteria 2000
182 Ga0501298_018133 3300049521 Unclassified 1292
183 Ga0501299_003038 3300049522 Unclassified 2392
184 Ga0501031_0002747 3300049568 Bacteria 11216
185 Ga0501031_0062713 3300049568 Bacteria 2422
186 Ga0501032_0044950 3300049569 Bacteria 2988
187 Ga0501032_0045444 3300049569 Bacteria 2970
188 Ga0501036_0024075 3300049572 Bacteria 5132
189 Ga0501036_0202656 3300049572 Bacteria 1669
190 Ga0501037_0031272 3300049573 Bacteria 3930
191 Ga0501037_0057269 3300049573 Bacteria 2845
192 Ga0501038_0086630 3300049574 Bacteria 2631
193 Ga0501039_0001138 3300049575 Bacteria 19609
194 Ga0501039_0074286 3300049575 Bacteria 2642
195 Ga0501041_0156463 3300049577 Bacteria 1424
196 Ga0501041_0387198 3300049577 Unclassified 885
197 Ga0501042_0033061 3300049578 Bacteria 3665
198 Ga0501043_0033596 3300049579 Bacteria 4036
199 Ga0501046_0071870 3300049580 Bacteria 2687
200 Ga0501048_0073465 3300049582 Bacteria 2414
201 Ga0501048_0389264 3300049582 Bacteria 996
202 Ga0501069_0071368 3300049585 Unclassified 1946
203 Ga0501070_0017345 3300049586 Bacteria 6045
204 Ga0501070_0158925 3300049586 Unclassified 1863
205 Ga0501071_0198957 3300049587 Unclassified 1505
206 Ga0501072_0126020 3300049588 Bacteria 2040
207 Ga0501076_0072459 3300049592 Unclassified 2757
208 Ga0501199_004449 3300049650 Unclassified 1381
209 Ga0501207_017312 3300049654 Unclassified 1124
210 Ga0501209_007359 3300049656 Unclassified 2107
211 Ga0501217_043101 3300049661 Unclassified 1155
212 Ga0501235_026979 3300049669 Unclassified 1288
213 Ga0501258_001168 3300049687 Unclassified 2075
214 Ga0501079_0125965 3300049741 Bacteria 1993
215 Ga0501273_012605 3300049770 Unclassified 1067
216 Ga0501278_002494 3300049774 Unclassified 1296
217 Ga0501279_006020 3300049775 Unclassified 1599
218 Ga0501283_005096 3300049779 Unclassified 1796
219 Ga0501035_0002126 3300049822 Bacteria 19714
220 Ga0501035_0022351 3300049822 Bacteria 5808
221 Ga0501035_0379346 3300049822 Bacteria 1179
222 nmdc:mga05p37_278357_c1 3300050507 Unclassified 1996
223 nmdc:mga05p37_32576_c1 3300050507 Bacteria 6374
224 nmdc:mga05p37_389214_c1 3300050507 Bacteria 1631
225 nmdc:mga09592_31687_c1 3300050508 Bacteria 4406
226 nmdc:mga09592_729_c1 3300050508 Bacteria 25319
227 nmdc:mga0qj67_207379_c1 3300050509 Bacteria 1592
228 nmdc:mga0qj67_3065_c1 3300050509 Bacteria 12010
229 nmdc:mga0qj67_9721_c1 3300050509 Bacteria 7164
230 nmdc:mga06r32_19618_c1 3300050510 Bacteria 6209
231 nmdc:mga06r32_3869_c1 3300050510 Bacteria 13401
232 nmdc:mga08y16_142830_c1 3300050511 Bacteria 2489
233 nmdc:mga08y16_459773_c1 3300050511 Bacteria 1297
234 nmdc:mga0n895_225569_c1 3300050512 Bacteria 1902
235 nmdc:mga0n895_372240_c1 3300050512 Bacteria 1446
236 nmdc:mga0a205_162142_c1 3300050515 Bacteria 1287
237 nmdc:mga0a205_240507_c1 3300050515 Bacteria 1691
238 nmdc:mga0a205_7397_c1 3300050515 Bacteria 9945
239 Ga0500646_0021402 3300053090 Bacteria 1723
240 Ga0500646_0029841 3300053090 Bacteria 1494
241 Ga0501084_0490091 3300054114 Bacteria 1039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10185935 Ga0207682_101859351 230
2 3300049577 Ga0501041_0387198 Ga0501041_0387198_37_822 256
3 3300026088 Ga0207641_10077608 Ga0207641_100776083 267
4 3300026095 Ga0207676_10191005 Ga0207676_101910053 267
5 3300026118 Ga0207675_100318896 Ga0207675_1003188962 267
6 3300048912 Ga0496109_0061508 Ga0496109_0061508_2196_3092 267
7 3300050511 nmdc:mga08y16_459773_c1 nmdc:mga08y16_459773_c1_174_1070 267
8 3300050512 nmdc:mga0n895_372240_c1 nmdc:mga0n895_372240_c1_264_1160 267
9 3300050515 nmdc:mga0a205_162142_c1 nmdc:mga0a205_162142_c1_263_1159 267
10 3300005844 Ga0068862_100081371 Ga0068862_1000813712 269
11 3300031548 Ga0307408_100042447 Ga0307408_1000424471 273
12 3300031903 Ga0307407_10032595 Ga0307407_100325951 273
13 3300032002 Ga0307416_100016222 Ga0307416_1000162223 273
14 3300032005 Ga0307411_10026200 Ga0307411_100262003 273
15 3300031731 Ga0307405_10057628 Ga0307405_100576281 279
16 3300005618 Ga0068864_100268942 Ga0068864_1002689422 281
17 3300026095 Ga0207676_10255207 Ga0207676_102552072 281
18 3300050510 nmdc:mga06r32_19618_c1 nmdc:mga06r32_19618_c1_1047_1934 281
19 3300042436 Ga0439435_0013208 Ga0439435_0013208_1073_1969 283
20 3300054114 Ga0501084_0490091 Ga0501084_0490091_68_964 283
21 3300005328 Ga0070676_10049237 Ga0070676_100492373 286
22 3300005338 Ga0068868_100043775 Ga0068868_1000437754 286
23 3300005356 Ga0070674_100005770 Ga0070674_1000057705 286
24 3300006237 Ga0097621_100243833 Ga0097621_1002438331 286
25 3300006846 Ga0075430_100126135 Ga0075430_1001261351 286
26 3300009094 Ga0111539_10274602 Ga0111539_102746022 286
27 3300009098 Ga0105245_10041312 Ga0105245_100413122 286
28 3300009147 Ga0114129_10380883 Ga0114129_103808832 286
29 3300009148 Ga0105243_10044200 Ga0105243_100442004 286
30 3300009553 Ga0105249_10085530 Ga0105249_100855302 286
31 3300010375 Ga0105239_10265174 Ga0105239_102651742 286
32 3300013102 Ga0157371_10138400 Ga0157371_101384002 286
33 3300013297 Ga0157378_10159889 Ga0157378_101598892 286
34 3300013306 Ga0163162_10141928 Ga0163162_101419281 286
35 3300014745 Ga0157377_10110085 Ga0157377_101100851 286
36 3300014969 Ga0157376_10087578 Ga0157376_100875783 286
37 3300025934 Ga0207686_10044438 Ga0207686_100444383 286
38 3300025935 Ga0207709_10022994 Ga0207709_100229943 286
39 3300025937 Ga0207669_10040468 Ga0207669_100404683 286
40 3300025942 Ga0207689_10081134 Ga0207689_100811342 286
41 3300025972 Ga0207668_10108817 Ga0207668_101088171 286
42 3300025986 Ga0207658_10148920 Ga0207658_101489202 286
43 3300026075 Ga0207708_10012192 Ga0207708_100121922 286
44 3300026089 Ga0207648_10001445 Ga0207648_100014453 286
45 3300026121 Ga0207683_10026121 Ga0207683_100261214 286
46 3300027364 Ga0209967_1001393 Ga0209967_10013932 286
47 3300027395 Ga0209996_1000337 Ga0209996_10003372 286
48 3300027424 Ga0209984_1000471 Ga0209984_10004713 286
49 3300027471 Ga0209995_1000688 Ga0209995_10006884 286
50 3300027543 Ga0209999_1002639 Ga0209999_10026391 286
51 3300027682 Ga0209971_1004992 Ga0209971_10049923 286
52 3300027717 Ga0209998_10001098 Ga0209998_100010982 286
53 3300027876 Ga0209974_10001499 Ga0209974_100014994 286
54 3300035114 Ga0373939_0030243 Ga0373939_0030243_11_871 286
55 3300050512 nmdc:mga0n895_225569_c1 nmdc:mga0n895_225569_c1_473_1333 286
56 3300005985 Ga0081539_10004156 Ga0081539_100041567 288
57 3300005293 Ga0065715_10095905 Ga0065715_100959051 290
58 3300005340 Ga0070689_100059071 Ga0070689_1000590711 290
59 3300005365 Ga0070688_100116605 Ga0070688_1001166052 290
60 3300005468 Ga0070707_100149376 Ga0070707_1001493762 290
61 3300006844 Ga0075428_100000957 Ga0075428_10000095726 290
62 3300006844 Ga0075428_100038135 Ga0075428_1000381352 290
63 3300006846 Ga0075430_100000407 Ga0075430_10000040721 290
64 3300006847 Ga0075431_100000321 Ga0075431_10000032130 290
65 3300006880 Ga0075429_100001231 Ga0075429_10000123110 290
66 3300009094 Ga0111539_10422522 Ga0111539_104225221 290
67 3300009147 Ga0114129_10002373 Ga0114129_1000237314 290
68 3300009147 Ga0114129_10222742 Ga0114129_102227422 290
69 3300025942 Ga0207689_10197765 Ga0207689_101977652 290
70 3300027907 Ga0207428_10341832 Ga0207428_103418321 290
71 3300035090 Ga0373949_0039709 Ga0373949_0039709_173_1066 290
72 3300042008 Ga0439450_020982 Ga0439450_020982_122_1015 290
73 3300046522 Ga0495643_0002387 Ga0495643_0002387_2129_3028 290
74 3300049577 Ga0501041_0156463 Ga0501041_0156463_181_1074 290
75 3300049582 Ga0501048_0389264 Ga0501048_0389264_89_982 290
76 3300050507 nmdc:mga05p37_32576_c1 nmdc:mga05p37_32576_c1_610_1503 290
77 3300050508 nmdc:mga09592_729_c1 nmdc:mga09592_729_c1_18060_18953 290
78 3300050509 nmdc:mga0qj67_3065_c1 nmdc:mga0qj67_3065_c1_312_1205 290
79 3300050510 nmdc:mga06r32_3869_c1 nmdc:mga06r32_3869_c1_3160_4053 290
80 3300005334 Ga0068869_100113979 Ga0068869_1001139792 291
81 3300031507 Ga0307509_10027155 Ga0307509_100271553 291
82 3300038443 Ga0395901_0266903 Ga0395901_0266903_65_976 291
83 3300053090 Ga0500646_0021402 Ga0500646_0021402_55_972 291
84 3300053090 Ga0500646_0029841 Ga0500646_0029841_23_940 291
85 3300005471 Ga0070698_100000349 Ga0070698_10000034942 293
86 3300037853 Ga0436364_0285297 Ga0436364_0285297_1432_2316 293
87 3300048928 Ga0496125_0007937 Ga0496125_0007937_591_1508 294
88 3300049585 Ga0501069_0071368 Ga0501069_0071368_466_1395 294
89 3300049586 Ga0501070_0158925 Ga0501070_0158925_637_1566 294
90 3300005340 Ga0070689_100002851 Ga0070689_1000028516 295
91 3300005518 Ga0070699_100239185 Ga0070699_1002391851 295
92 3300006844 Ga0075428_100056740 Ga0075428_1000567403 295
93 3300025936 Ga0207670_10016606 Ga0207670_100166061 295
94 3300049586 Ga0501070_0017345 Ga0501070_0017345_3306_4244 295
95 3300035113 Ga0373936_0000015 Ga0373936_0000015_104868_105806 296
96 3300049568 Ga0501031_0062713 Ga0501031_0062713_491_1408 296
97 3300049575 Ga0501039_0074286 Ga0501039_0074286_1495_2412 296
98 3300005549 Ga0070704_100064580 Ga0070704_1000645803 297
99 3300005444 Ga0070694_100041544 Ga0070694_1000415444 298
100 3300005549 Ga0070704_100047635 Ga0070704_1000476353 298
101 3300005617 Ga0068859_100172389 Ga0068859_1001723892 298
102 3300006846 Ga0075430_100007925 Ga0075430_1000079256 298
103 3300006847 Ga0075431_100009237 Ga0075431_10000923711 298
104 3300006931 Ga0097620_100172403 Ga0097620_1001724032 298
105 3300009147 Ga0114129_10141351 Ga0114129_101413518 298
106 3300027695 Ga0209966_1022482 Ga0209966_10224822 298
107 3300034818 Ga0373950_0015871 Ga0373950_0015871_98_1024 298
108 3300050507 nmdc:mga05p37_389214_c1 nmdc:mga05p37_389214_c1_698_1612 298
109 3300050509 nmdc:mga0qj67_207379_c1 nmdc:mga0qj67_207379_c1_543_1490 298
110 3300005289 Ga0065704_10143325 Ga0065704_101433251 299
111 3300005295 Ga0065707_10109119 Ga0065707_101091193 299
112 3300005329 Ga0070683_100117547 Ga0070683_1001175471 299
113 3300005330 Ga0070690_100023843 Ga0070690_1000238435 299
114 3300005334 Ga0068869_100019513 Ga0068869_1000195134 299
115 3300005335 Ga0070666_10140063 Ga0070666_101400631 299
116 3300005336 Ga0070680_100034103 Ga0070680_1000341033 299
117 3300005337 Ga0070682_100332306 Ga0070682_1003323061 299
118 3300005339 Ga0070660_100377618 Ga0070660_1003776181 299
119 3300005340 Ga0070689_100036124 Ga0070689_1000361244 299
120 3300005343 Ga0070687_100015978 Ga0070687_1000159783 299
121 3300005343 Ga0070687_100037908 Ga0070687_1000379081 299
122 3300005347 Ga0070668_100041772 Ga0070668_1000417722 299
123 3300005353 Ga0070669_100025320 Ga0070669_1000253204 299
124 3300005354 Ga0070675_100125574 Ga0070675_1001255742 299
125 3300005364 Ga0070673_100084289 Ga0070673_1000842891 299
126 3300005365 Ga0070688_100036003 Ga0070688_1000360033 299
127 3300005366 Ga0070659_100033736 Ga0070659_1000337363 299
128 3300005441 Ga0070700_100018018 Ga0070700_1000180183 299
129 3300005458 Ga0070681_10057341 Ga0070681_100573413 299
130 3300005459 Ga0068867_100021863 Ga0068867_1000218636 299
131 3300005468 Ga0070707_100028910 Ga0070707_1000289105 299
132 3300005518 Ga0070699_100001010 Ga0070699_10000101020 299
133 3300005518 Ga0070699_100012231 Ga0070699_1000122312 299
134 3300005530 Ga0070679_100084933 Ga0070679_1000849333 299
135 3300005530 Ga0070679_100113890 Ga0070679_1001138903 299
136 3300005535 Ga0070684_100168170 Ga0070684_1001681702 299
137 3300005536 Ga0070697_100015326 Ga0070697_1000153267 299
138 3300005543 Ga0070672_100034620 Ga0070672_1000346204 299
139 3300005545 Ga0070695_100031880 Ga0070695_1000318803 299
140 3300005546 Ga0070696_100121956 Ga0070696_1001219562 299
141 3300005548 Ga0070665_100214903 Ga0070665_1002149031 299
142 3300005563 Ga0068855_100303147 Ga0068855_1003031472 299
143 3300005564 Ga0070664_100312448 Ga0070664_1003124481 299
144 3300005617 Ga0068859_100204069 Ga0068859_1002040692 299
145 3300005844 Ga0068862_100251541 Ga0068862_1002515412 299
146 3300006058 Ga0075432_10016178 Ga0075432_100161782 299
147 3300006358 Ga0068871_100162545 Ga0068871_1001625452 299
148 3300006358 Ga0068871_100349467 Ga0068871_1003494672 299
149 3300006844 Ga0075428_100189854 Ga0075428_1001898542 299
150 3300006846 Ga0075430_100012431 Ga0075430_1000124318 299
151 3300006852 Ga0075433_10016758 Ga0075433_100167584 299
152 3300006852 Ga0075433_10358469 Ga0075433_103584692 299
153 3300006871 Ga0075434_100254930 Ga0075434_1002549302 299
154 3300006880 Ga0075429_100444967 Ga0075429_1004449671 299
155 3300006881 Ga0068865_100025361 Ga0068865_1000253613 299
156 3300006914 Ga0075436_100046543 Ga0075436_1000465432 299
157 3300006931 Ga0097620_100204052 Ga0097620_1002040522 299
158 3300009094 Ga0111539_10109375 Ga0111539_101093752 299
159 3300009094 Ga0111539_10333801 Ga0111539_103338012 299
160 3300009147 Ga0114129_10266612 Ga0114129_102666121 299
161 3300009147 Ga0114129_10614118 Ga0114129_106141181 299
162 3300013296 Ga0157374_10107209 Ga0157374_101072092 299
163 3300014326 Ga0157380_10005982 Ga0157380_100059824 299
164 3300014969 Ga0157376_10022032 Ga0157376_100220322 299
165 3300021388 Ga0213875_10018737 Ga0213875_100187373 299
166 3300025903 Ga0207680_10021530 Ga0207680_100215302 299
167 3300025907 Ga0207645_10015627 Ga0207645_100156274 299
168 3300025912 Ga0207707_10071710 Ga0207707_100717103 299
169 3300025912 Ga0207707_10134849 Ga0207707_101348494 299
170 3300025917 Ga0207660_10222026 Ga0207660_102220262 299
171 3300025918 Ga0207662_10025437 Ga0207662_100254373 299
172 3300025918 Ga0207662_10040694 Ga0207662_100406942 299
173 3300025919 Ga0207657_10064576 Ga0207657_100645762 299
174 3300025921 Ga0207652_10372671 Ga0207652_103726711 299
175 3300025922 Ga0207646_10000436 Ga0207646_1000043632 299
176 3300025922 Ga0207646_10076437 Ga0207646_100764373 299
177 3300025926 Ga0207659_10284415 Ga0207659_102844152 299
178 3300025927 Ga0207687_10045685 Ga0207687_100456852 299
179 3300025933 Ga0207706_10027079 Ga0207706_100270794 299
180 3300025934 Ga0207686_10006800 Ga0207686_100068006 299
181 3300025938 Ga0207704_10181840 Ga0207704_101818402 299
182 3300025940 Ga0207691_10038471 Ga0207691_100384713 299
183 3300025945 Ga0207679_10272453 Ga0207679_102724531 299
184 3300025961 Ga0207712_10101366 Ga0207712_101013661 299
185 3300026067 Ga0207678_10360176 Ga0207678_103601761 299
186 3300027526 Ga0209968_1001689 Ga0209968_10016892 299
187 3300027617 Ga0210002_1001400 Ga0210002_10014003 299
188 3300027665 Ga0209983_1002722 Ga0209983_10027222 299
189 3300027695 Ga0209966_1001509 Ga0209966_10015093 299
190 3300027876 Ga0209974_10009203 Ga0209974_100092034 299
191 3300027907 Ga0207428_10099367 Ga0207428_100993672 299
192 3300027907 Ga0207428_10105633 Ga0207428_101056332 299
193 3300028380 Ga0268265_10317125 Ga0268265_103171252 299
194 3300031995 Ga0307409_100379226 Ga0307409_1003792262 299
195 3300037068 Ga0373925_0018775 Ga0373925_0018775_1728_2645 299
196 3300042156 Ga0439446_0012854 Ga0439446_0012854_414_1334 299
197 3300042461 Ga0439460_0007808 Ga0439460_0007808_1169_2101 299
198 3300046675 Ga0495657_0082923 Ga0495657_0082923_194_1111 299
199 3300047321 Ga0495676_0173822 Ga0495676_0173822_232_1149 299
200 3300048911 Ga0496108_0000060 Ga0496108_0000060_3104_4036 299
201 3300048913 Ga0496110_0207111 Ga0496110_0207111_278_1219 299
202 3300049513 Ga0501290_002197 Ga0501290_002197_600_1520 299
203 3300049518 Ga0501295_003076 Ga0501295_003076_862_1782 299
204 3300049521 Ga0501298_018133 Ga0501298_018133_190_1110 299
205 3300049522 Ga0501299_003038 Ga0501299_003038_394_1314 299
206 3300049568 Ga0501031_0002747 Ga0501031_0002747_6619_7587 299
207 3300049569 Ga0501032_0044950 Ga0501032_0044950_1621_2589 299
208 3300049569 Ga0501032_0045444 Ga0501032_0045444_1350_2306 299
209 3300049572 Ga0501036_0024075 Ga0501036_0024075_3169_4131 299
210 3300049572 Ga0501036_0202656 Ga0501036_0202656_461_1429 299
211 3300049573 Ga0501037_0031272 Ga0501037_0031272_192_1244 299
212 3300049573 Ga0501037_0057269 Ga0501037_0057269_359_1315 299
213 3300049574 Ga0501038_0086630 Ga0501038_0086630_379_1341 299
214 3300049575 Ga0501039_0001138 Ga0501039_0001138_7387_8355 299
215 3300049578 Ga0501042_0033061 Ga0501042_0033061_289_1251 299
216 3300049579 Ga0501043_0033596 Ga0501043_0033596_25_993 299
217 3300049580 Ga0501046_0071870 Ga0501046_0071870_1589_2545 299
218 3300049582 Ga0501048_0073465 Ga0501048_0073465_1365_2327 299
219 3300049587 Ga0501071_0198957 Ga0501071_0198957_125_1087 299
220 3300049588 Ga0501072_0126020 Ga0501072_0126020_661_1623 299
221 3300049592 Ga0501076_0072459 Ga0501076_0072459_1688_2650 299
222 3300049650 Ga0501199_004449 Ga0501199_004449_421_1341 299
223 3300049654 Ga0501207_017312 Ga0501207_017312_88_1008 299
224 3300049656 Ga0501209_007359 Ga0501209_007359_240_1160 299
225 3300049661 Ga0501217_043101 Ga0501217_043101_139_1059 299
226 3300049669 Ga0501235_026979 Ga0501235_026979_261_1181 299
227 3300049687 Ga0501258_001168 Ga0501258_001168_356_1276 299
228 3300049741 Ga0501079_0125965 Ga0501079_0125965_661_1623 299
229 3300049770 Ga0501273_012605 Ga0501273_012605_95_1015 299
230 3300049774 Ga0501278_002494 Ga0501278_002494_363_1283 299
231 3300049775 Ga0501279_006020 Ga0501279_006020_596_1516 299
232 3300049779 Ga0501283_005096 Ga0501283_005096_684_1604 299
233 3300049822 Ga0501035_0002126 Ga0501035_0002126_13399_14361 299
234 3300049822 Ga0501035_0022351 Ga0501035_0022351_1195_2151 299
235 3300049822 Ga0501035_0379346 Ga0501035_0379346_83_1012 299
236 3300050507 nmdc:mga05p37_278357_c1 nmdc:mga05p37_278357_c1_690_1622 299
237 3300050508 nmdc:mga09592_31687_c1 nmdc:mga09592_31687_c1_1759_2679 299
238 3300050509 nmdc:mga0qj67_9721_c1 nmdc:mga0qj67_9721_c1_752_1726 299
239 3300050511 nmdc:mga08y16_142830_c1 nmdc:mga08y16_142830_c1_387_1340 299
240 3300050515 nmdc:mga0a205_240507_c1 nmdc:mga0a205_240507_c1_577_1482 299
241 3300050515 nmdc:mga0a205_7397_c1 nmdc:mga0a205_7397_c1_7764_8696 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08338

DUF1731

Domain of unknown function (DUF1731)

279

325

0.98

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

27

253

0.89

PF13460

NAD_binding_10

NAD(P)H-binding

31

168

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

28

156

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b4o-assembly6.cif.gz_F crystal structure of human epimerase family protein sdr39u1 (isoform2) with nadph 0.9094 2 297
3oh8-assembly1.cif.gz_A crystal structure of the nucleoside-diphosphate sugar epimerase from corynebacterium glutamicum. northeast structural genomics consortium target cgr91 0.8904 2 298
4b4o-assembly6.cif.gz_F crystal structure of human epimerase family protein sdr39u1 (isoform2) with nadph 0.8797 2 297
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8337 2 297
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.828 2 297
ID Description Score Start End Superfamily
af_P77775_2_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9724 2 297 3.40.50.720
af_Q2G035_4_300_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 2 299 3.40.50.720
af_P9WGP7_2_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 2 287 3.40.50.720
af_I1LPX1_44_338_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 2 288 3.40.50.720
af_P77775_2_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9498 2 297 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y4WC36-F1-model_v4 TIGR01777 family protein 0.9913 2 298
AF-A0A2N1V724-F1-model_v4 TIGR01777 family protein 0.9849 124 298
AF-A0A1G3JCI9-F1-model_v4 TIGR01777 family protein 0.9848 114 299
AF-A0A2V9QGL1-F1-model_v4 TIGR01777 family protein 0.9835 99 297
AF-A0A0K1PYN9-F1-model_v4 Cell division inhibitor 0.983 46 298 GO:0051301

Feature Viewer

pLDDT pTM Quality
91.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map