F353994

General Info

Members Datasets Scaffolds Average Seq Length
241 138 482 245

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0653869|Ga0451577_0653869_60_884
Length 274
Sequence MAQRKKQSRRAWTHEGETMTPVAEKQVLSGPQVLGTENLVKIYHHKHVVNQVNVEVRRGEIVGLLGPNGAGKTTTFYMVVGFIKPNDGRIVLSGPDGKQDITDVPMYKRARLGISYLSQEPSIFRKMTVEENILAILETLPLSKEDRAQRLDQLLNELNIAHLRRQRAYTLSGGERRRLEITRALVINPSFILLDEPFVGVDPIAVLDIQNVIRQLRKRGIGIMITDHNVRETLSITDRAYILYEGKILLAGTAKKLASSKKAKEIYLGEKFTL

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0653869 3300042876 Bacteria 953
2 Ga0065704_10080916 3300005289 Bacteria 3854
3 Ga0065704_10124912 3300005289 Bacteria 1703
4 Ga0065707_10002744 3300005295 Bacteria 5586
5 Ga0065707_10122376 3300005295 Bacteria 2089
6 Ga0070680_100623794 3300005336 Bacteria 926
7 Ga0070675_100039338 3300005354 Bacteria 3859
8 Ga0070688_100200083 3300005365 Bacteria 1397
9 Ga0070714_100049055 3300005435 Bacteria 3593
10 Ga0070711_100054225 3300005439 Bacteria 2766
11 Ga0070694_100103519 3300005444 Bacteria 2017
12 Ga0070694_100134083 3300005444 Bacteria 1793
13 Ga0070694_100251074 3300005444 Bacteria 1338
14 Ga0070708_100020285 3300005445 Bacteria 5603
15 Ga0070681_10222630 3300005458 Bacteria 1802
16 Ga0068867_100560811 3300005459 Bacteria 991
17 Ga0070706_100007293 3300005467 Bacteria 10382
18 Ga0070706_100009999 3300005467 Bacteria 8809
19 Ga0070706_100042795 3300005467 Bacteria 4184
20 Ga0070706_100047790 3300005467 Bacteria 3949
21 Ga0070706_100431102 3300005467 Bacteria 1227
22 Ga0070707_100003640 3300005468 Bacteria 14537
23 Ga0070707_100011391 3300005468 Bacteria 8293
24 Ga0070707_100305982 3300005468 Bacteria 1545
25 Ga0070707_100613902 3300005468 Bacteria 1050
26 Ga0070698_100009863 3300005471 Bacteria 10209
27 Ga0070698_100025073 3300005471 Bacteria 6216
28 Ga0070698_100073668 3300005471 Bacteria 3421
29 Ga0070698_100149511 3300005471 Bacteria 2284
30 Ga0070699_100008205 3300005518 Bacteria 9063
31 Ga0070699_100238579 3300005518 Bacteria 1622
32 Ga0070697_100021604 3300005536 Bacteria 5101
33 Ga0070697_100058727 3300005536 Bacteria 3130
34 Ga0070697_100241672 3300005536 Bacteria 1542
35 Ga0070695_100161528 3300005545 Bacteria 1573
36 Ga0070696_100192172 3300005546 Bacteria 1520
37 Ga0070665_100122608 3300005548 Bacteria 2601
38 Ga0068864_100077314 3300005618 Bacteria 2910
39 Ga0068861_100262091 3300005719 Bacteria 1480
40 Ga0081455_10001045 3300005937 Bacteria 34907
41 Ga0081538_10002997 3300005981 Bacteria 16089
42 Ga0081538_10130269 3300005981 Bacteria 1184
43 Ga0081540_1007720 3300005983 Bacteria 7624
44 Ga0075432_10013877 3300006058 Bacteria 2741
45 Ga0070715_10038326 3300006163 Bacteria 1989
46 Ga0070715_10063224 3300006163 Bacteria 1631
47 Ga0068871_100269521 3300006358 Bacteria 1487
48 Ga0075428_100003238 3300006844 Bacteria 17824
49 Ga0075428_100010712 3300006844 Bacteria 10191
50 Ga0075428_100036472 3300006844 Bacteria 5415
51 Ga0075428_100177956 3300006844 Bacteria 2303
52 Ga0075428_100210457 3300006844 Bacteria 2101
53 Ga0075430_100179879 3300006846 Bacteria 1759
54 Ga0075431_100001737 3300006847 Bacteria 20493
55 Ga0075431_100032845 3300006847 Bacteria 5349
56 Ga0075431_100071300 3300006847 Bacteria 3585
57 Ga0075431_100369944 3300006847 Bacteria 1438
58 Ga0075431_100419257 3300006847 Bacteria 1338
59 Ga0075433_10049540 3300006852 Bacteria 3655
60 Ga0075433_10385341 3300006852 Bacteria 1237
61 Ga0075433_10454255 3300006852 Bacteria 1129
62 Ga0075434_100040689 3300006871 Bacteria 4603
63 Ga0075434_100102058 3300006871 Bacteria 2876
64 Ga0075434_100767096 3300006871 Bacteria 981
65 Ga0075429_100001689 3300006880 Bacteria 18259
66 Ga0075429_100017542 3300006880 Bacteria 6190
67 Ga0075429_100374159 3300006880 Bacteria 1247
68 Ga0068865_100328621 3300006881 Bacteria 1232
69 Ga0075436_100008133 3300006914 Bacteria 7179
70 Ga0075436_100079210 3300006914 Bacteria 2276
71 Ga0075435_100012757 3300007076 Bacteria 6225
72 Ga0075435_100116153 3300007076 Bacteria 2229
73 Ga0075435_100167477 3300007076 Bacteria 1853
74 Ga0111539_10412478 3300009094 Bacteria 1573
75 Ga0111539_10761684 3300009094 Bacteria 1127
76 Ga0111539_10902037 3300009094 Bacteria 1028
77 Ga0114129_10072455 3300009147 Bacteria 4802
78 Ga0114129_10666075 3300009147 Bacteria 1341
79 Ga0114129_10709295 3300009147 Bacteria 1292
80 Ga0105242_10092701 3300009176 Bacteria 2545
81 Ga0105249_10170236 3300009553 Bacteria 2112
82 Ga0157326_1011955 3300012513 Bacteria 985
83 Ga0163162_10046047 3300013306 Bacteria 4372
84 Ga0163162_10077072 3300013306 Bacteria 3397
85 Ga0157372_10342712 3300013307 Bacteria 1741
86 Ga0157375_10438947 3300013308 Bacteria 1471
87 Ga0157379_10006296 3300014968 Bacteria 10221
88 Ga0157376_10123429 3300014969 Bacteria 2299
89 Ga0207685_10036574 3300025905 Bacteria 1801
90 Ga0207684_10023140 3300025910 Bacteria 5306
91 Ga0207684_10033062 3300025910 Bacteria 4399
92 Ga0207684_10035886 3300025910 Bacteria 4208
93 Ga0207684_10296864 3300025910 Bacteria 1393
94 Ga0207660_10352643 3300025917 Bacteria 1179
95 Ga0207646_10001197 3300025922 Bacteria 32667
96 Ga0207646_10048633 3300025922 Bacteria 3801
97 Ga0207646_10079105 3300025922 Bacteria 2939
98 Ga0207646_10219501 3300025922 Bacteria 1718
99 Ga0207686_10095381 3300025934 Bacteria 1974
100 Ga0207704_10753784 3300025938 Bacteria 810
101 Ga0207665_10401037 3300025939 Bacteria 1044
102 Ga0207678_10449734 3300026067 Bacteria 1119
103 Ga0207676_10183115 3300026095 Bacteria 1836
104 Ga0207675_100024077 3300026118 Bacteria 5660
105 Ga0207675_100069749 3300026118 Bacteria 3285
106 Ga0207675_100332656 3300026118 Bacteria 1485
107 Ga0207683_10679053 3300026121 Bacteria 954
108 Ga0207428_10313143 3300027907 Unclassified 1160
109 Ga0268266_10805569 3300028379 Bacteria 907
110 Ga0265326_10001472 3300028558 Bacteria 8283
111 Ga0265319_1000161 3300028563 Bacteria 50866
112 Ga0265319_1025763 3300028563 Unclassified 2102
113 Ga0265334_10001513 3300028573 Bacteria 11229
114 Ga0265334_10046480 3300028573 Bacteria 1678
115 Ga0265318_10021098 3300028577 Bacteria 2620
116 Ga0265318_10022249 3300028577 Bacteria 2537
117 Ga0265336_10005507 3300028666 Bacteria 4665
118 Ga0265338_10001601 3300028800 Bacteria 36330
119 Ga0265338_10068045 3300028800 Bacteria 3071
120 Ga0265338_10128130 3300028800 Bacteria 2010
121 Ga0265338_10152543 3300028800 Bacteria 1794
122 Ga0265320_10028100 3300031240 Bacteria 2923
123 Ga0265320_10087557 3300031240 Unclassified 1446
124 Ga0265327_10240355 3300031251 Bacteria 809
125 Ga0265316_10006266 3300031344 Bacteria 11401
126 Ga0307408_100679688 3300031548 Bacteria 923
127 Ga0265342_10000223 3300031712 Bacteria 64311
128 Ga0307413_10020695 3300031824 Bacteria 3506
129 Ga0307410_10001871 3300031852 Bacteria 9814
130 Ga0307406_10061711 3300031901 Bacteria 2422
131 Ga0307409_100005707 3300031995 Bacteria 7213
132 Ga0307409_100087515 3300031995 Bacteria 2539
133 Ga0307416_100001523 3300032002 Bacteria 12653
134 Ga0307414_10019374 3300032004 Bacteria 4215
135 Ga0307411_10008128 3300032005 Bacteria 5411
136 Ga0307415_100098418 3300032126 Bacteria 2138
137 Ga0307415_100267739 3300032126 Bacteria 1398
138 Ga0373926_0024355 3300035083 Bacteria 2107
139 Ga0373934_0010335 3300035086 Bacteria 3503
140 Ga0373934_0204207 3300035086 Bacteria 814
141 Ga0373923_0183331 3300035111 Bacteria 962
142 Ga0373932_0016604 3300035112 Bacteria 1880
143 Ga0373932_0028891 3300035112 Bacteria 1527
144 Ga0373957_0054434 3300035120 Bacteria 1537
145 Ga0373955_0042743 3300035172 Bacteria 2435
146 Ga0373931_0039572 3300035691 Bacteria 2470
147 Ga0373931_0138486 3300035691 Bacteria 1407
148 Ga0373931_0196202 3300035691 Bacteria 1203
149 Ga0373935_0018596 3300035692 Bacteria 4230
150 Ga0373935_0068874 3300035692 Bacteria 2277
151 Ga0373927_0006385 3300035695 Bacteria 8030
152 Ga0373927_0011266 3300035695 Bacteria 5953
153 Ga0373933_0008932 3300035724 Bacteria 5466
154 Ga0373933_0051087 3300035724 Bacteria 2470
155 Ga0373947_0019811 3300035725 Bacteria 3882
156 Ga0373947_0027869 3300035725 Bacteria 3308
157 Ga0373937_0004019 3300036401 Bacteria 12456
158 Ga0373937_0296276 3300036401 Bacteria 1528
159 Ga0373925_0008616 3300037068 Bacteria 7432
160 Ga0373925_0021801 3300037068 Bacteria 4670
161 Ga0373925_0254021 3300037068 Bacteria 1410
162 Ga0451577_0068948 3300042876 Bacteria 3154
163 Ga0451577_0363457 3300042876 Bacteria 1313
164 Ga0453683_0000355 3300044673 Bacteria 55441
165 Ga0453683_0000462 3300044673 Bacteria 46608
166 Ga0453683_0002183 3300044673 Bacteria 15564
167 Ga0453684_0039618 3300044712 Bacteria 6418
168 Ga0453684_0050049 3300044712 Bacteria 5501
169 Ga0453684_0117631 3300044712 Bacteria 3216
170 Ga0453684_0749893 3300044712 Bacteria 1057
171 Ga0451576_0000319 3300045051 Bacteria 116651
172 Ga0451576_0000836 3300045051 Bacteria 59974
173 Ga0451576_0010413 3300045051 Bacteria 10672
174 Ga0451576_0029198 3300045051 Bacteria 5902
175 Ga0451576_0870240 3300045051 Bacteria 946
176 Ga0495603_0157361 3300046455 Bacteria 1319
177 Ga0495580_0019692 3300046472 Bacteria 5010
178 Ga0495630_0308866 3300046517 Bacteria 1209
179 Ga0495647_0055612 3300046681 Bacteria 1550
180 Ga0495613_0326739 3300046689 Bacteria 1058
181 Ga0501296_012735 3300049519 Bacteria 1018
182 Ga0501031_0147186 3300049568 Bacteria 1539
183 Ga0501032_0012130 3300049569 Bacteria 6170
184 Ga0501036_0003418 3300049572 Bacteria 12686
185 Ga0501036_0220437 3300049572 Bacteria 1593
186 Ga0501037_0005036 3300049573 Bacteria 9613
187 Ga0501038_0002519 3300049574 Bacteria 17073
188 Ga0501038_0003698 3300049574 Bacteria 14253
189 Ga0501039_0001159 3300049575 Bacteria 19420
190 Ga0501039_0021109 3300049575 Bacteria 4995
191 Ga0501040_0001010 3300049576 Bacteria 17855
192 Ga0501041_0001428 3300049577 Bacteria 13213
193 Ga0501041_0017257 3300049577 Bacteria 4295
194 Ga0501042_0000636 3300049578 Bacteria 18763
195 Ga0501042_0005863 3300049578 Bacteria 7940
196 Ga0501043_0037635 3300049579 Bacteria 3805
197 Ga0501046_0002861 3300049580 Bacteria 16043
198 Ga0501048_0005132 3300049582 Bacteria 9976
199 Ga0501048_0477476 3300049582 Bacteria 893
200 Ga0501068_0111470 3300049584 Bacteria 1701
201 Ga0501071_0015273 3300049587 Bacteria 5269
202 Ga0501072_0000264 3300049588 Bacteria 38361
203 Ga0501074_0023677 3300049590 Bacteria 4463
204 Ga0501075_0000251 3300049591 Bacteria 28975
205 Ga0501076_0003120 3300049592 Bacteria 11546
206 Ga0501077_0000523 3300049593 Bacteria 23236
207 Ga0501077_0002903 3300049593 Bacteria 10283
208 Ga0501079_0000526 3300049741 Bacteria 24912
209 Ga0501080_0004788 3300049742 Bacteria 12070
210 Ga0501081_0000699 3300049743 Bacteria 19385
211 Ga0501083_0157492 3300049744 Bacteria 1486
212 Ga0501035_0012688 3300049822 Bacteria 7785
213 Ga0501045_0001516 3300049824 Bacteria 15443
214 nmdc:mga05p37_17142_c1 3300050507 Bacteria 8740
215 nmdc:mga05p37_278428_c1 3300050507 Bacteria 1996
216 nmdc:mga05p37_390040_c1 3300050507 Bacteria 1629
217 nmdc:mga05p37_50194_c1 3300050507 Bacteria 5131
218 nmdc:mga05p37_718639_c1 3300050507 Bacteria 1107
219 nmdc:mga09592_232457_c1 3300050508 Bacteria 1598
220 nmdc:mga09592_337606_c1 3300050508 Bacteria 1304
221 nmdc:mga0qj67_186785_c1 3300050509 Bacteria 1684
222 nmdc:mga0qj67_26964_c1 3300050509 Bacteria 4450
223 nmdc:mga0qj67_57291_c1 3300050509 Bacteria 3089
224 nmdc:mga06r32_341101_c1 3300050510 Bacteria 1483
225 nmdc:mga06r32_53678_c1 3300050510 Bacteria 3862
226 nmdc:mga06r32_9186_c1 3300050510 Bacteria 8912
227 nmdc:mga08y16_595763_c1 3300050511 Bacteria 1114
228 nmdc:mga0n895_107367_c1 3300050512 Bacteria 2805
229 nmdc:mga0n895_139104_c1 3300050512 Bacteria 2456
230 nmdc:mga0n895_65725_c1 3300050512 Bacteria 3590
231 nmdc:mga0rr50_331480_c1 3300050513 Bacteria 1278
232 nmdc:mga0rr50_60350_c1 3300050513 Bacteria 2852
233 nmdc:mga08x19_40124_c1 3300050514 Bacteria 2978
234 nmdc:mga08x19_61988_c1 3300050514 Bacteria 2424
235 nmdc:mga0a205_482613_c1 3300050515 Bacteria 1098
236 nmdc:mga0a205_587654_c1 3300050515 Bacteria 967
237 nmdc:mga0a205_765646_c1 3300050515 Bacteria 814
238 Ga0501084_0006076 3300054114 Bacteria 9933
239 Ga0501082_0000318 3300060353 Bacteria 42881
240 Ga0530510_0003728 3300061734 Bacteria 10490
241 Ga0530510_0008978 3300061734 Bacteria 7005
242 Ga0451577_0653869
243 Ga0065704_10080916
244 Ga0065704_10124912
245 Ga0065707_10002744
246 Ga0065707_10122376
247 Ga0070680_100623794
248 Ga0070675_100039338
249 Ga0070688_100200083
250 Ga0070714_100049055
251 Ga0070711_100054225
252 Ga0070694_100103519
253 Ga0070694_100134083
254 Ga0070694_100251074
255 Ga0070708_100020285
256 Ga0070681_10222630
257 Ga0068867_100560811
258 Ga0070706_100007293
259 Ga0070706_100009999
260 Ga0070706_100042795
261 Ga0070706_100047790
262 Ga0070706_100431102
263 Ga0070707_100003640
264 Ga0070707_100011391
265 Ga0070707_100305982
266 Ga0070707_100613902
267 Ga0070698_100009863
268 Ga0070698_100025073
269 Ga0070698_100073668
270 Ga0070698_100149511
271 Ga0070699_100008205
272 Ga0070699_100238579
273 Ga0070697_100021604
274 Ga0070697_100058727
275 Ga0070697_100241672
276 Ga0070695_100161528
277 Ga0070696_100192172
278 Ga0070665_100122608
279 Ga0068864_100077314
280 Ga0068861_100262091
281 Ga0081455_10001045
282 Ga0081538_10002997
283 Ga0081538_10130269
284 Ga0081540_1007720
285 Ga0075432_10013877
286 Ga0070715_10038326
287 Ga0070715_10063224
288 Ga0068871_100269521
289 Ga0075428_100003238
290 Ga0075428_100010712
291 Ga0075428_100036472
292 Ga0075428_100177956
293 Ga0075428_100210457
294 Ga0075430_100179879
295 Ga0075431_100001737
296 Ga0075431_100032845
297 Ga0075431_100071300
298 Ga0075431_100369944
299 Ga0075431_100419257
300 Ga0075433_10049540
301 Ga0075433_10385341
302 Ga0075433_10454255
303 Ga0075434_100040689
304 Ga0075434_100102058
305 Ga0075434_100767096
306 Ga0075429_100001689
307 Ga0075429_100017542
308 Ga0075429_100374159
309 Ga0068865_100328621
310 Ga0075436_100008133
311 Ga0075436_100079210
312 Ga0075435_100012757
313 Ga0075435_100116153
314 Ga0075435_100167477
315 Ga0111539_10412478
316 Ga0111539_10761684
317 Ga0111539_10902037
318 Ga0114129_10072455
319 Ga0114129_10666075
320 Ga0114129_10709295
321 Ga0105242_10092701
322 Ga0105249_10170236
323 Ga0157326_1011955
324 Ga0163162_10046047
325 Ga0163162_10077072
326 Ga0157372_10342712
327 Ga0157375_10438947
328 Ga0157379_10006296
329 Ga0157376_10123429
330 Ga0207685_10036574
331 Ga0207684_10023140
332 Ga0207684_10033062
333 Ga0207684_10035886
334 Ga0207684_10296864
335 Ga0207660_10352643
336 Ga0207646_10001197
337 Ga0207646_10048633
338 Ga0207646_10079105
339 Ga0207646_10219501
340 Ga0207686_10095381
341 Ga0207704_10753784
342 Ga0207665_10401037
343 Ga0207678_10449734
344 Ga0207676_10183115
345 Ga0207675_100024077
346 Ga0207675_100069749
347 Ga0207675_100332656
348 Ga0207683_10679053
349 Ga0207428_10313143
350 Ga0268266_10805569
351 Ga0265326_10001472
352 Ga0265319_1000161
353 Ga0265319_1025763
354 Ga0265334_10001513
355 Ga0265334_10046480
356 Ga0265318_10021098
357 Ga0265318_10022249
358 Ga0265336_10005507
359 Ga0265338_10001601
360 Ga0265338_10068045
361 Ga0265338_10128130
362 Ga0265338_10152543
363 Ga0265320_10028100
364 Ga0265320_10087557
365 Ga0265327_10240355
366 Ga0265316_10006266
367 Ga0307408_100679688
368 Ga0265342_10000223
369 Ga0307413_10020695
370 Ga0307410_10001871
371 Ga0307406_10061711
372 Ga0307409_100005707
373 Ga0307409_100087515
374 Ga0307416_100001523
375 Ga0307414_10019374
376 Ga0307411_10008128
377 Ga0307415_100098418
378 Ga0307415_100267739
379 Ga0373926_0024355
380 Ga0373934_0010335
381 Ga0373934_0204207
382 Ga0373923_0183331
383 Ga0373932_0016604
384 Ga0373932_0028891
385 Ga0373957_0054434
386 Ga0373955_0042743
387 Ga0373931_0039572
388 Ga0373931_0138486
389 Ga0373931_0196202
390 Ga0373935_0018596
391 Ga0373935_0068874
392 Ga0373927_0006385
393 Ga0373927_0011266
394 Ga0373933_0008932
395 Ga0373933_0051087
396 Ga0373947_0019811
397 Ga0373947_0027869
398 Ga0373937_0004019
399 Ga0373937_0296276
400 Ga0373925_0008616
401 Ga0373925_0021801
402 Ga0373925_0254021
403 Ga0451577_0068948
404 Ga0451577_0363457
405 Ga0453683_0000355
406 Ga0453683_0000462
407 Ga0453683_0002183
408 Ga0453684_0039618
409 Ga0453684_0050049
410 Ga0453684_0117631
411 Ga0453684_0749893
412 Ga0451576_0000319
413 Ga0451576_0000836
414 Ga0451576_0010413
415 Ga0451576_0029198
416 Ga0451576_0870240
417 Ga0495603_0157361
418 Ga0495580_0019692
419 Ga0495630_0308866
420 Ga0495647_0055612
421 Ga0495613_0326739
422 Ga0501296_012735
423 Ga0501031_0147186
424 Ga0501032_0012130
425 Ga0501036_0003418
426 Ga0501036_0220437
427 Ga0501037_0005036
428 Ga0501038_0002519
429 Ga0501038_0003698
430 Ga0501039_0001159
431 Ga0501039_0021109
432 Ga0501040_0001010
433 Ga0501041_0001428
434 Ga0501041_0017257
435 Ga0501042_0000636
436 Ga0501042_0005863
437 Ga0501043_0037635
438 Ga0501046_0002861
439 Ga0501048_0005132
440 Ga0501048_0477476
441 Ga0501068_0111470
442 Ga0501071_0015273
443 Ga0501072_0000264
444 Ga0501074_0023677
445 Ga0501075_0000251
446 Ga0501076_0003120
447 Ga0501077_0000523
448 Ga0501077_0002903
449 Ga0501079_0000526
450 Ga0501080_0004788
451 Ga0501081_0000699
452 Ga0501083_0157492
453 Ga0501035_0012688
454 Ga0501045_0001516
455 nmdc:mga05p37_17142_c1
456 nmdc:mga05p37_278428_c1
457 nmdc:mga05p37_390040_c1
458 nmdc:mga05p37_50194_c1
459 nmdc:mga05p37_718639_c1
460 nmdc:mga09592_232457_c1
461 nmdc:mga09592_337606_c1
462 nmdc:mga0qj67_186785_c1
463 nmdc:mga0qj67_26964_c1
464 nmdc:mga0qj67_57291_c1
465 nmdc:mga06r32_341101_c1
466 nmdc:mga06r32_53678_c1
467 nmdc:mga06r32_9186_c1
468 nmdc:mga08y16_595763_c1
469 nmdc:mga0n895_107367_c1
470 nmdc:mga0n895_139104_c1
471 nmdc:mga0n895_65725_c1
472 nmdc:mga0rr50_331480_c1
473 nmdc:mga0rr50_60350_c1
474 nmdc:mga08x19_40124_c1
475 nmdc:mga08x19_61988_c1
476 nmdc:mga0a205_482613_c1
477 nmdc:mga0a205_587654_c1
478 nmdc:mga0a205_765646_c1
479 Ga0501084_0006076
480 Ga0501082_0000318
481 Ga0530510_0003728
482 Ga0530510_0008978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

199

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9779 1 240
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9739 1 240
5x5y-assembly1.cif.gz_A a membrane protein complex 0.9718 3 239
4wbs-assembly2.cif.gz_B crystal structure of an abc transporter related protein from burkholderia phymatum 0.9698 2 240
6hs3-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia pseudomallei 0.9695 1 240
ID Description Score Start End Superfamily
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9779 1 240 3.40.50.300
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9739 1 240 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 4 236 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 1 219 3.40.50.300
af_K7LAD3_8_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9366 78 189 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520NCX8-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9926 4 240 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A1I2K4U1-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB 0.9922 2 240 GO:0005524
GO:0005737
GO:0016887
GO:0043190
GO:0055085
AF-A0A2S6SA39-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB (EC 3.6.3.-) 0.9916 3 240 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A5M6I481-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.991 3 240 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A2V7MZW3-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9907 2 235 GO:0005524
GO:0016887
GO:0043190
GO:0055085

Map