F353608

General Info

Members Datasets Scaffolds Average Seq Length
241 163 235 189

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100111343|Ga0068854_1001113434
Length 209
Sequence LSRSASPLVLASGSPRRAELIARLGLSPAAIDPADIDETPGKGELPLPYAARMAAEKAMAVAARHPGMAVLGADTVVAAGRRILPKTEDAEAARNCLTLLSGRRHRVHSAVTLIDAGGVARHRLSTSIVAFKRLTVAEIDSYLIDGEWHGKAGGYAIQGYAESWIRMLSGSHSGVMGLPLFETRALLASAGLLPAAGAVHHPIPSDRPR

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
101 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
102 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
103 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
122 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
123 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
124 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
125 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
126 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
129 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
135 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
136 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
137 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
156 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
157 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
158 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
159 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
160 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
161 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
162 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.41
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.52
Nodule 0
Rhizoplane 0.41
Rhizosphere 77.59
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10779141 3300005327 Bacteria 831
2 Ga0070670_100000213 3300005331 Bacteria 53498
3 Ga0070677_10001313 3300005333 Bacteria 7944
4 Ga0070692_10791098 3300005345 Bacteria 647
5 Ga0070668_100000049 3300005347 Bacteria 74953
6 Ga0070668_100000061 3300005347 Bacteria 66924
7 Ga0070669_100000044 3300005353 Bacteria 121087
8 Ga0070671_100017736 3300005355 Bacteria 5771
9 Ga0070671_100197661 3300005355 Bacteria 1705
10 Ga0070688_100503371 3300005365 Bacteria 914
11 Ga0070659_100009642 3300005366 Bacteria 7097
12 Ga0070667_100000009 3300005367 Bacteria 281488
13 Ga0070667_100000453 3300005367 Bacteria 42432
14 Ga0070667_100001030 3300005367 Bacteria 25481
15 Ga0068853_100446839 3300005539 Bacteria 1216
16 Ga0070665_100000410 3300005548 Bacteria 62835
17 Ga0070665_100685337 3300005548 Bacteria 1038
18 Ga0068855_100667830 3300005563 Bacteria 1115
19 Ga0068855_100944463 3300005563 Bacteria 909
20 Ga0068857_100147044 3300005577 Bacteria 2133
21 Ga0068854_100111343 3300005578 Bacteria 2065
22 Ga0068859_100041029 3300005617 Bacteria 4649
23 Ga0068859_100155936 3300005617 Bacteria 2360
24 Ga0068859_100329863 3300005617 Bacteria 1620
25 Ga0068859_101364019 3300005617 Bacteria 782
26 Ga0068864_100000005 3300005618 Bacteria 400840
27 Ga0068861_100000774 3300005719 Bacteria 19183
28 Ga0068863_100000053 3300005841 Bacteria 125195
29 Ga0068863_100062035 3300005841 Bacteria 3535
30 Ga0068863_100066277 3300005841 Bacteria 3416
31 Ga0068858_100001456 3300005842 Bacteria 24348
32 Ga0068860_100000036 3300005843 Bacteria 234917
33 Ga0068860_100045738 3300005843 Bacteria 4174
34 Ga0068860_100136451 3300005843 Bacteria 2356
35 Ga0068862_100000001 3300005844 Bacteria 523031
36 Ga0068862_100001447 3300005844 Bacteria 21867
37 Ga0068862_100896852 3300005844 Bacteria 871
38 Ga0081455_10000846 3300005937 Bacteria 39458
39 Ga0075365_10259991 3300006038 Bacteria 1220
40 Ga0075363_100124087 3300006048 Bacteria 1444
41 Ga0075364_10083558 3300006051 Bacteria 2114
42 Ga0075364_10186583 3300006051 Bacteria 1404
43 Ga0075364_10339543 3300006051 Bacteria 1023
44 Ga0075364_10369245 3300006051 Bacteria 978
45 Ga0075366_10057505 3300006195 Bacteria 2312
46 Ga0075366_10079410 3300006195 Bacteria 1959
47 Ga0097620_100041030 3300006931 Bacteria 4649
48 Ga0097620_100155941 3300006931 Bacteria 2360
49 Ga0097620_100329913 3300006931 Bacteria 1620
50 Ga0097620_101364142 3300006931 Bacteria 782
51 Ga0105240_10014669 3300009093 Bacteria 10693
52 Ga0105240_10015067 3300009093 Bacteria 10523
53 Ga0105243_10483160 3300009148 Bacteria 1169
54 Ga0105243_11078872 3300009148 Bacteria 810
55 Ga0105248_10000287 3300009177 Bacteria 59537
56 Ga0105248_10003168 3300009177 Bacteria 18225
57 Ga0105248_10003543 3300009177 Bacteria 17304
58 Ga0105237_10002773 3300009545 Bacteria 21295
59 Ga0105237_11361030 3300009545 Bacteria 716
60 Ga0105249_10403448 3300009553 Bacteria 1398
61 Ga0105249_10546586 3300009553 Bacteria 1208
62 Ga0105239_10000801 3300010375 Bacteria 44468
63 Ga0163163_10090992 3300014325 Bacteria 3065
64 Ga0163163_10112158 3300014325 Bacteria 2756
65 Ga0157380_10000288 3300014326 Bacteria 30220
66 Ga0213872_10210862 3300021361 Bacteria 829
67 Ga0228598_1018449 3300024227 Bacteria 1376
68 Ga0207682_10003977 3300025893 Bacteria 6292
69 Ga0207680_10033515 3300025903 Bacteria 2931
70 Ga0207695_10000516 3300025913 Bacteria 81914
71 Ga0207695_10008833 3300025913 Bacteria 12546
72 Ga0207671_10001970 3300025914 Bacteria 22658
73 Ga0207681_10000041 3300025923 Bacteria 140201
74 Ga0207681_10027913 3300025923 Bacteria 3654
75 Ga0207681_10048333 3300025923 Bacteria 2871
76 Ga0207650_10000004 3300025925 Bacteria 743372
77 Ga0207650_10219282 3300025925 Bacteria 1530
78 Ga0207644_10000088 3300025931 Bacteria 65977
79 Ga0207644_10262610 3300025931 Bacteria 1381
80 Ga0207690_10003088 3300025932 Bacteria 10033
81 Ga0207709_10044229 3300025935 Bacteria 2689
82 Ga0207711_10000480 3300025941 Bacteria 41229
83 Ga0207711_10005969 3300025941 Bacteria 10296
84 Ga0207711_10008286 3300025941 Bacteria 8699
85 Ga0207667_11045598 3300025949 Bacteria 802
86 Ga0207668_10000027 3300025972 Bacteria 125575
87 Ga0207668_10000077 3300025972 Bacteria 73595
88 Ga0207640_10050748 3300025981 Bacteria 2694
89 Ga0207658_10000009 3300025986 Bacteria 264118
90 Ga0207658_10000853 3300025986 Bacteria 25495
91 Ga0207658_10002323 3300025986 Bacteria 13972
92 Ga0207703_10002603 3300026035 Bacteria 15579
93 Ga0207703_10986484 3300026035 Bacteria 808
94 Ga0207639_10285710 3300026041 Bacteria 1453
95 Ga0207641_10000093 3300026088 Bacteria 125747
96 Ga0207641_10019452 3300026088 Bacteria 5575
97 Ga0207641_10027362 3300026088 Bacteria 4708
98 Ga0207641_10035106 3300026088 Bacteria 4175
99 Ga0207641_10079769 3300026088 Bacteria 2838
100 Ga0207676_10000006 3300026095 Bacteria 681936
101 Ga0207674_10169381 3300026116 Bacteria 2138
102 Ga0207675_100000309 3300026118 Bacteria 46765
103 Ga0207675_100047525 3300026118 Bacteria 4006
104 Ga0268266_10000294 3300028379 Bacteria 81573
105 Ga0268266_10863678 3300028379 Bacteria 875
106 Ga0268265_10000001 3300028380 Bacteria 1230727
107 Ga0268265_10000580 3300028380 Bacteria 37079
108 Ga0268265_10247690 3300028380 Bacteria 1576
109 Ga0268265_11271389 3300028380 Bacteria 735
110 Ga0268264_10000001 3300028381 Bacteria 1221000
111 Ga0268264_10034140 3300028381 Bacteria 4183
112 Ga0268264_10119013 3300028381 Bacteria 2325
113 Ga0307406_10531264 3300031901 Bacteria 959
114 Ga0307412_10068869 3300031911 Bacteria 2407
115 Ga0307412_10199214 3300031911 Bacteria 1519
116 Ga0307416_100220572 3300032002 Bacteria 1818
117 Ga0307414_10147096 3300032004 Bacteria 1853
118 Ga0307414_10668907 3300032004 Bacteria 937
119 Ga0307414_11155852 3300032004 Bacteria 716
120 Ga0307415_100769310 3300032126 Bacteria 876
121 Ga0395905_0166586 3300037471 Bacteria 2071
122 Ga0436364_0867279 3300037853 Bacteria 2139
123 Ga0395901_0040474 3300038443 Bacteria 4828
124 Ga0436365_0363047 3300039437 Bacteria 77624
125 Ga0436360_0056255 3300039438 Bacteria 1303
126 Ga0436361_0487650 3300039447 Bacteria 776
127 Ga0436363_0275063 3300039450 Bacteria 1152
128 Ga0436362_0354233 3300039453 Bacteria 2215
129 Ga0451837_0572486 3300041494 Bacteria 627
130 Ga0466963_0604686 3300044694 Bacteria 774
131 Ga0495620_0013868 3300046515 Bacteria 4114
132 Ga0495620_0175939 3300046515 Bacteria 828
133 Ga0495643_0012318 3300046522 Bacteria 5165
134 Ga0495654_0082253 3300046530 Bacteria 1507
135 Ga0495597_0009352 3300046542 Bacteria 4847
136 Ga0495622_0005504 3300046557 Bacteria 5873
137 Ga0495668_0021630 3300046616 Bacteria 3686
138 Ga0495649_0203777 3300046694 Bacteria 1026
139 Ga0495686_0000100 3300047472 Bacteria 180492
140 Ga0495593_0070255 3300047673 Bacteria 1820
141 Ga0496101_0535221 3300048904 Bacteria 926
142 Ga0496117_0043360 3300048920 Bacteria 3271
143 Ga0496118_0008554 3300048921 Bacteria 10550
144 Ga0496118_0148966 3300048921 Bacteria 1468
145 Ga0496120_0399924 3300048923 Bacteria 607
146 Ga0496121_0000949 3300048924 Bacteria 52413
147 Ga0496121_0005836 3300048924 Bacteria 15606
148 Ga0496121_0208789 3300048924 Bacteria 1385
149 Ga0496125_0090886 3300048928 Bacteria 2289
150 Ga0496126_0022918 3300048929 Bacteria 6063
151 Ga0496126_0368981 3300048929 Bacteria 1171
152 Ga0501305_028590 3300049161 Bacteria 859
153 Ga0501292_000021 3300049515 Bacteria 51994
154 Ga0501294_001689 3300049517 Bacteria 2183
155 Ga0501297_005115 3300049520 Bacteria 1362
156 Ga0501301_000817 3300049524 Bacteria 1928
157 Ga0501031_0006570 3300049568 Bacteria 7589
158 Ga0501032_0010153 3300049569 Bacteria 6795
159 Ga0501032_0240662 3300049569 Bacteria 1176
160 Ga0501034_0019909 3300049571 Bacteria 6855
161 Ga0501034_0314137 3300049571 Bacteria 1501
162 Ga0501036_0008749 3300049572 Bacteria 8308
163 Ga0501036_1193173 3300049572 Bacteria 620
164 Ga0501037_0214330 3300049573 Bacteria 1357
165 Ga0501039_0032456 3300049575 Bacteria 4026
166 Ga0501040_0006172 3300049576 Bacteria 7774
167 Ga0501041_0035730 3300049577 Bacteria 3011
168 Ga0501042_0012982 3300049578 Bacteria 5659
169 Ga0501042_0405784 3300049578 Bacteria 987
170 Ga0501043_0006031 3300049579 Bacteria 9737
171 Ga0501043_0187172 3300049579 Bacteria 1611
172 Ga0501046_0204898 3300049580 Bacteria 1466
173 Ga0501046_0240537 3300049580 Bacteria 1335
174 Ga0501047_0002935 3300049581 Bacteria 16185
175 Ga0501047_0720992 3300049581 Bacteria 814
176 Ga0501048_0351510 3300049582 Bacteria 1051
177 Ga0501068_0062645 3300049584 Bacteria 2262
178 Ga0501071_0000413 3300049587 Bacteria 21242
179 Ga0501071_0195975 3300049587 Bacteria 1516
180 Ga0501075_0044055 3300049591 Bacteria 3347
181 Ga0501076_0026343 3300049592 Bacteria 4503
182 Ga0501076_0386037 3300049592 Bacteria 1151
183 Ga0501202_011527 3300049652 Bacteria 1657
184 Ga0501222_037772 3300049662 Bacteria 678
185 Ga0501223_000033 3300049663 Bacteria 49156
186 Ga0501223_000579 3300049663 Bacteria 8850
187 Ga0501224_000026 3300049664 Bacteria 54620
188 Ga0501224_000731 3300049664 Bacteria 4125
189 Ga0501227_012299 3300049665 Bacteria 1873
190 Ga0501235_001962 3300049669 Bacteria 4410
191 Ga0501235_020158 3300049669 Bacteria 1480
192 Ga0501259_000383 3300049688 Bacteria 6990
193 Ga0501261_000805 3300049690 Bacteria 3918
194 Ga0501221_103139 3300049704 Bacteria 710
195 Ga0501225_0000382 3300049705 Bacteria 13944
196 Ga0501080_0133010 3300049742 Bacteria 2302
197 Ga0501081_0245442 3300049743 Bacteria 1306
198 Ga0501083_0012538 3300049744 Bacteria 5930
199 Ga0501279_000014 3300049775 Bacteria 70029
200 Ga0501280_000045 3300049776 Bacteria 37097
201 Ga0501281_00237 3300049777 Bacteria 5990
202 Ga0501282_000824 3300049778 Bacteria 3533
203 Ga0501044_0019940 3300049823 Bacteria 7162
204 Ga0501045_0002950 3300049824 Bacteria 11636
205 Ga0501045_0408994 3300049824 Bacteria 1010
206 Ga0501226_000066 3300049853 Bacteria 34204
207 nmdc:mga03n38_134009_c1 3300050490 Bacteria 1231
208 nmdc:mga03n38_95045_c1 3300050490 Bacteria 1427
209 nmdc:mga00v17_258323_c1 3300050491 Bacteria 1130
210 nmdc:mga00v17_262830_c1 3300050491 Bacteria 1120
211 nmdc:mga00v17_47718_c1 3300050491 Bacteria 2026
212 nmdc:mga0yw44_203475_c1 3300050492 Bacteria 1308
213 nmdc:mga0k408_54860_c1 3300050493 Bacteria 2310
214 Ga0500635_0000244 3300053080 Bacteria 23787
215 Ga0500643_005717 3300053087 Bacteria 5304
216 Ga0500644_0025649 3300053088 Bacteria 1817
217 Ga0500583_0230886 3300053092 Bacteria 916
218 Ga0500566_0043306 3300053094 Bacteria 2594
219 Ga0500569_012508 3300053109 Bacteria 2055
220 Ga0500592_000061 3300053116 Bacteria 30237
221 Ga0500595_025254 3300053119 Bacteria 2062
222 Ga0500607_031171 3300053121 Bacteria 2935
223 Ga0500607_138317 3300053121 Bacteria 1150
224 Ga0500614_002787 3300053123 Bacteria 3848
225 Ga0500590_011068 3300053148 Bacteria 4565
226 Ga0500619_062383 3300053154 Bacteria 1228
227 Ga0500627_0000342 3300053158 Bacteria 12625
228 Ga0500636_0071676 3300053177 Bacteria 2009
229 Ga0500637_0009893 3300053178 Bacteria 4877
230 Ga0500637_0166595 3300053178 Bacteria 1268
231 Ga0500576_074107 3300053725 Bacteria 1456
232 Ga0500625_018657 3300053729 Bacteria 3252
233 Ga0500596_001588 3300053735 Bacteria 4611
234 Ga0530510_0021307 3300061734 Bacteria 4612
235 Ga0530510_0442825 3300061734 Unclassified 982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_11361030 Ga0105237_113610302 154
2 3300039437 Ga0436365_0363047 Ga0436365_0363047_25146_25712 155
3 3300046530 Ga0495654_0082253 Ga0495654_0082253_813_1394 155
4 3300053116 Ga0500592_000061 Ga0500592_000061_1187_1768 155
5 3300053158 Ga0500627_0000342 Ga0500627_0000342_9496_10077 155
6 3300005331 Ga0070670_100000213 Ga0070670_10000021328 156
7 3300005347 Ga0070668_100000049 Ga0070668_10000004920 156
8 3300005355 Ga0070671_100017736 Ga0070671_1000177365 156
9 3300005367 Ga0070667_100000009 Ga0070667_10000000954 156
10 3300005617 Ga0068859_100155936 Ga0068859_1001559363 156
11 3300005841 Ga0068863_100062035 Ga0068863_1000620355 156
12 3300005842 Ga0068858_100001456 Ga0068858_1000014562 156
13 3300005843 Ga0068860_100000036 Ga0068860_100000036119 156
14 3300005844 Ga0068862_100001447 Ga0068862_10000144713 156
15 3300006931 Ga0097620_100155941 Ga0097620_1001559413 156
16 3300025923 Ga0207681_10027913 Ga0207681_100279132 156
17 3300025925 Ga0207650_10219282 Ga0207650_102192822 156
18 3300025931 Ga0207644_10000088 Ga0207644_100000885 156
19 3300025972 Ga0207668_10000077 Ga0207668_1000007720 156
20 3300025986 Ga0207658_10000009 Ga0207658_10000009213 156
21 3300026035 Ga0207703_10002603 Ga0207703_1000260312 156
22 3300026088 Ga0207641_10027362 Ga0207641_100273625 156
23 3300028380 Ga0268265_10000580 Ga0268265_1000058026 156
24 3300028381 Ga0268264_10000001 Ga0268264_10000001213 156
25 3300037471 Ga0395905_0166586 Ga0395905_0166586_53_682 160
26 3300009553 Ga0105249_10403448 Ga0105249_104034482 161
27 3300025923 Ga0207681_10048333 Ga0207681_100483333 161
28 3300026088 Ga0207641_10035106 Ga0207641_100351065 161
29 3300026118 Ga0207675_100047525 Ga0207675_1000475253 161
30 3300005366 Ga0070659_100009642 Ga0070659_1000096423 163
31 3300025932 Ga0207690_10003088 Ga0207690_100030885 163
32 iso_pu_bacteria 2643221541 2643730087 163
33 iso_pu_bacteria 2643221606 2644045573 163
34 iso_pu_bacteria 2643221671 2644392801 163
35 3300005548 Ga0070665_100685337 Ga0070665_1006853372 164
36 3300028379 Ga0268266_10863678 Ga0268266_108636782 164
37 3300005353 Ga0070669_100000044 Ga0070669_1000000447 165
38 3300005367 Ga0070667_100000453 Ga0070667_10000045331 165
39 3300005617 Ga0068859_100041029 Ga0068859_1000410292 165
40 3300005617 Ga0068859_100329863 Ga0068859_1003298633 165
41 3300005618 Ga0068864_100000005 Ga0068864_10000000537 165
42 3300005719 Ga0068861_100000774 Ga0068861_1000007744 165
43 3300005844 Ga0068862_100000001 Ga0068862_100000001431 165
44 3300006931 Ga0097620_100041030 Ga0097620_1000410302 165
45 3300006931 Ga0097620_100329913 Ga0097620_1003299133 165
46 3300009177 Ga0105248_10000287 Ga0105248_1000028758 165
47 3300009553 Ga0105249_10546586 Ga0105249_105465861 165
48 3300014325 Ga0163163_10090992 Ga0163163_100909925 165
49 3300014326 Ga0157380_10000288 Ga0157380_100002889 165
50 3300025923 Ga0207681_10000041 Ga0207681_10000041124 165
51 3300025925 Ga0207650_10000004 Ga0207650_10000004170 165
52 3300025941 Ga0207711_10000480 Ga0207711_100004809 165
53 3300025986 Ga0207658_10002323 Ga0207658_100023239 165
54 3300026035 Ga0207703_10986484 Ga0207703_109864841 165
55 3300026095 Ga0207676_10000006 Ga0207676_10000006540 165
56 3300026118 Ga0207675_100000309 Ga0207675_1000003094 165
57 3300028380 Ga0268265_10000001 Ga0268265_10000001605 165
58 3300005843 Ga0068860_100045738 Ga0068860_1000457383 166
59 3300028381 Ga0268264_10034140 Ga0268264_100341404 166
60 3300005333 Ga0070677_10001313 Ga0070677_100013135 168
61 3300005548 Ga0070665_100000410 Ga0070665_10000041049 168
62 3300025893 Ga0207682_10003977 Ga0207682_100039773 168
63 3300028379 Ga0268266_10000294 Ga0268266_1000029435 168
64 3300005345 Ga0070692_10791098 Ga0070692_107910981 169
65 3300005539 Ga0068853_100446839 Ga0068853_1004468391 169
66 3300005563 Ga0068855_100667830 Ga0068855_1006678302 169
67 3300026041 Ga0207639_10285710 Ga0207639_102857102 169
68 3300049161 Ga0501305_028590 Ga0501305_028590_21_602 169
69 3300005937 Ga0081455_10000846 Ga0081455_1000084639 171
70 3300006038 Ga0075365_10259991 Ga0075365_102599912 171
71 3300006048 Ga0075363_100124087 Ga0075363_1001240872 171
72 3300006051 Ga0075364_10186583 Ga0075364_101865832 171
73 3300006051 Ga0075364_10339543 Ga0075364_103395431 171
74 3300006051 Ga0075364_10369245 Ga0075364_103692451 171
75 3300050490 nmdc:mga03n38_134009_c1 nmdc:mga03n38_134009_c1_150_743 171
76 3300050490 nmdc:mga03n38_95045_c1 nmdc:mga03n38_95045_c1_327_920 171
77 3300050491 nmdc:mga00v17_258323_c1 nmdc:mga00v17_258323_c1_186_779 171
78 3300050491 nmdc:mga00v17_262830_c1 nmdc:mga00v17_262830_c1_394_987 171
79 3300050492 nmdc:mga0yw44_203475_c1 nmdc:mga0yw44_203475_c1_460_1053 171
80 3300049568 Ga0501031_0006570 Ga0501031_0006570_55_648 172
81 3300049569 Ga0501032_0010153 Ga0501032_0010153_1627_2220 172
82 3300049572 Ga0501036_0008749 Ga0501036_0008749_1547_2140 172
83 3300049573 Ga0501037_0214330 Ga0501037_0214330_492_1085 172
84 3300049575 Ga0501039_0032456 Ga0501039_0032456_2867_3460 172
85 3300049576 Ga0501040_0006172 Ga0501040_0006172_1570_2163 172
86 3300049577 Ga0501041_0035730 Ga0501041_0035730_234_827 172
87 3300049578 Ga0501042_0012982 Ga0501042_0012982_4778_5371 172
88 3300049578 Ga0501042_0405784 Ga0501042_0405784_78_671 172
89 3300049579 Ga0501043_0187172 Ga0501043_0187172_699_1292 172
90 3300049582 Ga0501048_0351510 Ga0501048_0351510_349_942 172
91 3300049584 Ga0501068_0062645 Ga0501068_0062645_886_1479 172
92 3300049587 Ga0501071_0000413 Ga0501071_0000413_4922_5515 172
93 3300049587 Ga0501071_0195975 Ga0501071_0195975_128_721 172
94 3300049591 Ga0501075_0044055 Ga0501075_0044055_2399_2992 172
95 3300049592 Ga0501076_0026343 Ga0501076_0026343_335_928 172
96 3300049592 Ga0501076_0386037 Ga0501076_0386037_346_939 172
97 3300049743 Ga0501081_0245442 Ga0501081_0245442_587_1180 172
98 3300049824 Ga0501045_0002950 Ga0501045_0002950_13_606 172
99 3300049824 Ga0501045_0408994 Ga0501045_0408994_347_940 172
100 3300061734 Ga0530510_0021307 Ga0530510_0021307_902_1495 172
101 3300061734 Ga0530510_0442825 Ga0530510_0442825_314_907 172
102 3300046515 Ga0495620_0175939 Ga0495620_0175939_174_749 173
103 3300005327 Ga0070658_10779141 Ga0070658_107791411 174
104 3300005347 Ga0070668_100000061 Ga0070668_1000000613 174
105 3300005355 Ga0070671_100197661 Ga0070671_1001976612 174
106 3300005365 Ga0070688_100503371 Ga0070688_1005033712 174
107 3300005367 Ga0070667_100001030 Ga0070667_10000103021 174
108 3300005563 Ga0068855_100944463 Ga0068855_1009444632 174
109 3300005577 Ga0068857_100147044 Ga0068857_1001470443 174
110 3300005578 Ga0068854_100111343 Ga0068854_1001113434 174
111 3300005617 Ga0068859_101364019 Ga0068859_1013640192 174
112 3300005841 Ga0068863_100000053 Ga0068863_100000053118 174
113 3300005841 Ga0068863_100066277 Ga0068863_1000662774 174
114 3300005843 Ga0068860_100136451 Ga0068860_1001364513 174
115 3300005844 Ga0068862_100896852 Ga0068862_1008968521 174
116 3300006051 Ga0075364_10083558 Ga0075364_100835584 174
117 3300006195 Ga0075366_10057505 Ga0075366_100575053 174
118 3300006195 Ga0075366_10079410 Ga0075366_100794103 174
119 3300006931 Ga0097620_101364142 Ga0097620_1013641422 174
120 3300009093 Ga0105240_10014669 Ga0105240_1001466911 174
121 3300009093 Ga0105240_10015067 Ga0105240_1001506712 174
122 3300009148 Ga0105243_10483160 Ga0105243_104831602 174
123 3300009148 Ga0105243_11078872 Ga0105243_110788722 174
124 3300009177 Ga0105248_10003168 Ga0105248_100031685 174
125 3300009177 Ga0105248_10003543 Ga0105248_1000354311 174
126 3300009545 Ga0105237_10002773 Ga0105237_1000277316 174
127 3300010375 Ga0105239_10000801 Ga0105239_100008014 174
128 3300014325 Ga0163163_10112158 Ga0163163_101121585 174
129 3300021361 Ga0213872_10210862 Ga0213872_102108622 174
130 3300024227 Ga0228598_1018449 Ga0228598_10184493 174
131 3300025903 Ga0207680_10033515 Ga0207680_100335153 174
132 3300025913 Ga0207695_10000516 Ga0207695_100005166 174
133 3300025913 Ga0207695_10008833 Ga0207695_1000883310 174
134 3300025914 Ga0207671_10001970 Ga0207671_1000197015 174
135 3300025931 Ga0207644_10262610 Ga0207644_102626102 174
136 3300025935 Ga0207709_10044229 Ga0207709_100442292 174
137 3300025941 Ga0207711_10005969 Ga0207711_100059692 174
138 3300025941 Ga0207711_10008286 Ga0207711_100082865 174
139 3300025949 Ga0207667_11045598 Ga0207667_110455981 174
140 3300025972 Ga0207668_10000027 Ga0207668_10000027118 174
141 3300025981 Ga0207640_10050748 Ga0207640_100507482 174
142 3300025986 Ga0207658_10000853 Ga0207658_1000085321 174
143 3300026088 Ga0207641_10000093 Ga0207641_100000934 174
144 3300026088 Ga0207641_10019452 Ga0207641_100194526 174
145 3300026088 Ga0207641_10079769 Ga0207641_100797693 174
146 3300026116 Ga0207674_10169381 Ga0207674_101693813 174
147 3300028380 Ga0268265_10247690 Ga0268265_102476902 174
148 3300028380 Ga0268265_11271389 Ga0268265_112713891 174
149 3300028381 Ga0268264_10119013 Ga0268264_101190133 174
150 3300031901 Ga0307406_10531264 Ga0307406_105312642 174
151 3300031911 Ga0307412_10068869 Ga0307412_100688691 174
152 3300031911 Ga0307412_10199214 Ga0307412_101992141 174
153 3300032002 Ga0307416_100220572 Ga0307416_1002205722 174
154 3300032004 Ga0307414_10147096 Ga0307414_101470963 174
155 3300032004 Ga0307414_10668907 Ga0307414_106689071 174
156 3300032004 Ga0307414_11155852 Ga0307414_111558521 174
157 3300032126 Ga0307415_100769310 Ga0307415_1007693102 174
158 3300037853 Ga0436364_0867279 Ga0436364_0867279_20_598 174
159 3300038443 Ga0395901_0040474 Ga0395901_0040474_1069_1650 174
160 3300039438 Ga0436360_0056255 Ga0436360_0056255_368_964 174
161 3300039447 Ga0436361_0487650 Ga0436361_0487650_24_635 174
162 3300039450 Ga0436363_0275063 Ga0436363_0275063_171_737 174
163 3300039453 Ga0436362_0354233 Ga0436362_0354233_812_1393 174
164 3300041494 Ga0451837_0572486 Ga0451837_0572486_24_548 174
165 3300044694 Ga0466963_0604686 Ga0466963_0604686_22_615 174
166 3300046515 Ga0495620_0013868 Ga0495620_0013868_3329_3892 174
167 3300046522 Ga0495643_0012318 Ga0495643_0012318_2414_2977 174
168 3300046542 Ga0495597_0009352 Ga0495597_0009352_2969_3532 174
169 3300046557 Ga0495622_0005504 Ga0495622_0005504_3732_4295 174
170 3300046616 Ga0495668_0021630 Ga0495668_0021630_2143_2706 174
171 3300046694 Ga0495649_0203777 Ga0495649_0203777_189_755 174
172 3300047472 Ga0495686_0000100 Ga0495686_0000100_148773_149345 174
173 3300047673 Ga0495593_0070255 Ga0495593_0070255_738_1301 174
174 3300048904 Ga0496101_0535221 Ga0496101_0535221_76_648 174
175 3300048920 Ga0496117_0043360 Ga0496117_0043360_1439_2044 174
176 3300048921 Ga0496118_0008554 Ga0496118_0008554_7265_7870 174
177 3300048921 Ga0496118_0148966 Ga0496118_0148966_210_782 174
178 3300048923 Ga0496120_0399924 Ga0496120_0399924_10_582 174
179 3300048924 Ga0496121_0000949 Ga0496121_0000949_4938_5510 174
180 3300048924 Ga0496121_0005836 Ga0496121_0005836_4946_5518 174
181 3300048924 Ga0496121_0208789 Ga0496121_0208789_561_1133 174
182 3300048928 Ga0496125_0090886 Ga0496125_0090886_378_968 174
183 3300048929 Ga0496126_0022918 Ga0496126_0022918_4666_5238 174
184 3300048929 Ga0496126_0368981 Ga0496126_0368981_452_1042 174
185 3300049515 Ga0501292_000021 Ga0501292_000021_48240_48812 174
186 3300049517 Ga0501294_001689 Ga0501294_001689_528_1100 174
187 3300049520 Ga0501297_005115 Ga0501297_005115_104_676 174
188 3300049524 Ga0501301_000817 Ga0501301_000817_1213_1785 174
189 3300049569 Ga0501032_0240662 Ga0501032_0240662_429_995 174
190 3300049571 Ga0501034_0019909 Ga0501034_0019909_1112_1684 174
191 3300049571 Ga0501034_0314137 Ga0501034_0314137_350_952 174
192 3300049572 Ga0501036_1193173 Ga0501036_1193173_10_576 174
193 3300049579 Ga0501043_0006031 Ga0501043_0006031_394_996 174
194 3300049580 Ga0501046_0204898 Ga0501046_0204898_568_1170 174
195 3300049580 Ga0501046_0240537 Ga0501046_0240537_463_1035 174
196 3300049581 Ga0501047_0002935 Ga0501047_0002935_5533_6135 174
197 3300049581 Ga0501047_0720992 Ga0501047_0720992_172_744 174
198 3300049652 Ga0501202_011527 Ga0501202_011527_921_1493 174
199 3300049662 Ga0501222_037772 Ga0501222_037772_33_605 174
200 3300049663 Ga0501223_000033 Ga0501223_000033_24132_24704 174
201 3300049663 Ga0501223_000579 Ga0501223_000579_7966_8538 174
202 3300049664 Ga0501224_000026 Ga0501224_000026_29903_30475 174
203 3300049664 Ga0501224_000731 Ga0501224_000731_466_1038 174
204 3300049665 Ga0501227_012299 Ga0501227_012299_751_1323 174
205 3300049669 Ga0501235_001962 Ga0501235_001962_3199_3771 174
206 3300049669 Ga0501235_020158 Ga0501235_020158_106_678 174
207 3300049688 Ga0501259_000383 Ga0501259_000383_526_1098 174
208 3300049690 Ga0501261_000805 Ga0501261_000805_2703_3275 174
209 3300049704 Ga0501221_103139 Ga0501221_103139_10_582 174
210 3300049705 Ga0501225_0000382 Ga0501225_0000382_593_1165 174
211 3300049742 Ga0501080_0133010 Ga0501080_0133010_1038_1643 174
212 3300049744 Ga0501083_0012538 Ga0501083_0012538_1775_2380 174
213 3300049775 Ga0501279_000014 Ga0501279_000014_21225_21797 174
214 3300049776 Ga0501280_000045 Ga0501280_000045_33341_33913 174
215 3300049777 Ga0501281_00237 Ga0501281_00237_2614_3186 174
216 3300049778 Ga0501282_000824 Ga0501282_000824_1293_1865 174
217 3300049823 Ga0501044_0019940 Ga0501044_0019940_391_963 174
218 3300049853 Ga0501226_000066 Ga0501226_000066_9197_9769 174
219 3300050491 nmdc:mga00v17_47718_c1 nmdc:mga00v17_47718_c1_944_1531 174
220 3300050493 nmdc:mga0k408_54860_c1 nmdc:mga0k408_54860_c1_692_1276 174
221 3300053080 Ga0500635_0000244 Ga0500635_0000244_15697_16260 174
222 3300053087 Ga0500643_005717 Ga0500643_005717_346_888 174
223 3300053088 Ga0500644_0025649 Ga0500644_0025649_643_1206 174
224 3300053092 Ga0500583_0230886 Ga0500583_0230886_313_876 174
225 3300053094 Ga0500566_0043306 Ga0500566_0043306_42_605 174
226 3300053109 Ga0500569_012508 Ga0500569_012508_725_1288 174
227 3300053119 Ga0500595_025254 Ga0500595_025254_154_717 174
228 3300053121 Ga0500607_031171 Ga0500607_031171_1323_1886 174
229 3300053121 Ga0500607_138317 Ga0500607_138317_446_1009 174
230 3300053123 Ga0500614_002787 Ga0500614_002787_2687_3250 174
231 3300053148 Ga0500590_011068 Ga0500590_011068_1551_2114 174
232 3300053154 Ga0500619_062383 Ga0500619_062383_274_837 174
233 3300053177 Ga0500636_0071676 Ga0500636_0071676_1321_1884 174
234 3300053178 Ga0500637_0009893 Ga0500637_0009893_599_1162 174
235 3300053178 Ga0500637_0166595 Ga0500637_0166595_140_703 174
236 3300053725 Ga0500576_074107 Ga0500576_074107_175_738 174
237 3300053729 Ga0500625_018657 Ga0500625_018657_901_1464 174
238 3300053735 Ga0500596_001588 Ga0500596_001588_3844_4407 174
239 iso_pu_bacteria 2582581305 2585260890 174
240 iso_pu_bacteria 2643221605 2644039732 174
241 iso_pu_bacteria 2883354860 2883358543 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

7

190

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oo0-assembly1.cif.gz_B crystal structure of maf-like protein bcej2315_23540 from burkholderia cenocepacia 0.9453 19 173
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9424 2 168
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9414 2 168
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.9359 2 170
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9314 2 172
ID Description Score Start End Superfamily
4oo0B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9453 19 173 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9424 2 168 3.90.950.10
af_Q18851_2_193_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9375 15 167 3.90.950.10
af_F4K330_90_229_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9286 47 168 3.90.950.10
af_Q55G28_10_210_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9183 2 168 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A838VA29-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9977 2 174 GO:0005737
GO:0009117
GO:0047429
AF-A0A519Y2T4-F1-model_v4 deleted 0.997 61 172
AF-A0A7C9VMY8-F1-model_v4 Septum formation inhibitor Maf 0.9934 45 172 GO:0009117
GO:0047429
AF-A0A4Q3YFJ8-F1-model_v4 Septum formation inhibitor Maf 0.993 46 172 GO:0009117
GO:0047429
AF-A0A522W578-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9929 2 171 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379

Feature Viewer

pLDDT pTM Quality
95.57 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map