F353565

General Info

Members Datasets Scaffolds Average Seq Length
241 182 235 258

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100096723|Ga0070706_1000967232
Length 289
Sequence MKVVILAGGFGTRISEESVLKPKPMIEIGHKPILWHIMKIYAAAGLTDFIICCGYRGEMIKDYFASYFLRKADVTFDLAKNEMHLHHTNAEPWRVTVVDTGEDSMTGGRIKRVGKYLGSETFCLTYGDGVTDLDFKKLISFHREQKTLATLTAVQPPGRFGAFTLHEDTKLITQFREKPPGDGAYINGGFFVLEPKVLDYIDGDSIVWEQAPMQRLAHEHQLSAYKHDGFWQNMDTLRDKMYLENLWASGEAPWKVWDTPGKQRSEAGSITTRYGIPALNLPVTKEMKS

Samples

Sample ID Description Type Environment
1 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
2 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
3 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
4 2899924645 Variovorax sp. 369 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
102 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
103 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
104 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
105 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
106 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
107 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.47
Nodule 0
Rhizoplane 2.07
Rhizosphere 78.42
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003585 3300003320 Bacteria 34811
2 Ga0055529_1000274 3300003763 Bacteria 61422
3 Ga0065704_10119015 3300005289 Unclassified 1776
4 Ga0065715_10169982 3300005293 Bacteria 1555
5 Ga0070676_10134269 3300005328 Unclassified 1568
6 Ga0070683_100166581 3300005329 Bacteria 2091
7 Ga0070666_10027073 3300005335 Unclassified 3751
8 Ga0070680_100032367 3300005336 Bacteria 4209
9 Ga0070682_100069231 3300005337 Bacteria 2253
10 Ga0068868_100107883 3300005338 Bacteria 2260
11 Ga0070660_100032209 3300005339 Bacteria 3943
12 Ga0070660_100127124 3300005339 Bacteria 2037
13 Ga0070675_100114336 3300005354 Bacteria 2287
14 Ga0070700_100161532 3300005441 Bacteria 1543
15 Ga0070678_100130292 3300005456 Bacteria 1997
16 Ga0070662_100101080 3300005457 Bacteria 2182
17 Ga0070681_10135001 3300005458 Bacteria 2398
18 Ga0068867_100031072 3300005459 Bacteria 3855
19 Ga0070706_100096723 3300005467 Bacteria 2741
20 Ga0070679_100139635 3300005530 Bacteria 2403
21 Ga0070686_100015287 3300005544 Bacteria 4441
22 Ga0070696_100079533 3300005546 Bacteria 2320
23 Ga0068854_100159609 3300005578 Bacteria 1745
24 Ga0068856_100135593 3300005614 Bacteria 2467
25 Ga0068856_100661442 3300005614 Unclassified 1065
26 Ga0070702_100035319 3300005615 Bacteria 2761
27 Ga0068861_100526493 3300005719 Bacteria 1073
28 Ga0081538_10018597 3300005981 Bacteria 5208
29 Ga0081538_10028953 3300005981 Bacteria 3795
30 Ga0081538_10052527 3300005981 Bacteria 2434
31 Ga0075368_10028662 3300006042 Bacteria 2152
32 Ga0075363_100035529 3300006048 Bacteria 2609
33 Ga0075364_10040167 3300006051 Bacteria 3035
34 Ga0075364_10140183 3300006051 Bacteria 1626
35 Ga0070715_10296499 3300006163 Bacteria 863
36 Ga0070716_100104325 3300006173 Bacteria 1745
37 Ga0075367_10052078 3300006178 Bacteria 2422
38 Ga0075367_10078085 3300006178 Bacteria 1999
39 Ga0075428_100224924 3300006844 Bacteria 2026
40 Ga0075428_100379215 3300006844 Bacteria 1516
41 Ga0075430_100001618 3300006846 Bacteria 18398
42 Ga0075431_100000526 3300006847 Bacteria 32123
43 Ga0075431_100001973 3300006847 Bacteria 19571
44 Ga0075429_100085070 3300006880 Bacteria 2757
45 Ga0075435_100533205 3300007076 Bacteria 1016
46 Ga0099794_10000281 3300007265 Bacteria 17563
47 Ga0111539_10000030 3300009094 Bacteria 175454
48 Ga0111539_10002204 3300009094 Bacteria 26011
49 Ga0105245_10006486 3300009098 Bacteria 10286
50 Ga0105245_10010198 3300009098 Bacteria 8180
51 Ga0105245_10018692 3300009098 Bacteria 6064
52 Ga0105245_10941916 3300009098 Bacteria 906
53 Ga0105247_10071538 3300009101 Bacteria 2169
54 Ga0114129_10013718 3300009147 Bacteria 11548
55 Ga0114129_10030909 3300009147 Bacteria 7574
56 Ga0114129_10282842 3300009147 Bacteria 2216
57 Ga0105243_10118912 3300009148 Bacteria 2224
58 Ga0105241_10024231 3300009174 Bacteria 4507
59 Ga0105242_10003075 3300009176 Bacteria 13016
60 Ga0105249_10016675 3300009553 Bacteria 6520
61 Ga0105239_10055776 3300010375 Bacteria 4334
62 Ga0157373_10328683 3300013100 Bacteria 1088
63 Ga0163162_10006995 3300013306 Bacteria 10942
64 Ga0157372_10342039 3300013307 Bacteria 1743
65 Ga0157380_10199179 3300014326 Unclassified 1775
66 Ga0157379_10017344 3300014968 Bacteria 6344
67 Ga0163161_10065986 3300017792 Bacteria 2642
68 Ga0213872_10009680 3300021361 Bacteria 4612
69 Ga0207425_1000593 3300025245 Bacteria 21092
70 Ga0209758_1004286 3300025297 Bacteria 12032
71 Ga0207710_10041565 3300025900 Bacteria 2039
72 Ga0207680_10017535 3300025903 Unclassified 3786
73 Ga0207645_10254763 3300025907 Unclassified 1162
74 Ga0207707_10202992 3300025912 Bacteria 1728
75 Ga0207657_10007542 3300025919 Bacteria 11151
76 Ga0207652_10094848 3300025921 Bacteria 2628
77 Ga0207681_10273964 3300025923 Bacteria 1326
78 Ga0207687_10034150 3300025927 Bacteria 3453
79 Ga0207687_10038175 3300025927 Bacteria 3281
80 Ga0207644_10469455 3300025931 Bacteria 1035
81 Ga0207690_10275020 3300025932 Bacteria 1310
82 Ga0207706_10164321 3300025933 Unclassified 1951
83 Ga0207709_10062530 3300025935 Bacteria 2330
84 Ga0207669_10265214 3300025937 Bacteria 1287
85 Ga0207665_10064855 3300025939 Bacteria 2482
86 Ga0207640_10106967 3300025981 Bacteria 1974
87 Ga0207677_10078694 3300026023 Bacteria 2355
88 Ga0207702_10118947 3300026078 Bacteria 2361
89 Ga0207648_10046030 3300026089 Bacteria 3826
90 Ga0207675_100001628 3300026118 Bacteria 22492
91 Ga0207675_100458906 3300026118 Bacteria 1263
92 Ga0207683_10128993 3300026121 Bacteria 2274
93 Ga0207428_10000038 3300027907 Bacteria 216105
94 Ga0207428_10019897 3300027907 Bacteria 5716
95 Ga0316575_10027144 3300031665 Bacteria 2227
96 Ga0316576_10014549 3300031727 Bacteria 5258
97 Ga0316576_10107280 3300031727 Bacteria 2092
98 Ga0316578_10021207 3300031728 Bacteria 3604
99 Ga0316578_10050692 3300031728 Bacteria 2429
100 Ga0316578_10127138 3300031728 Unclassified 1533
101 Ga0307410_10162216 3300031852 Bacteria 1676
102 Ga0307406_10319625 3300031901 Bacteria 1200
103 Ga0307407_10079290 3300031903 Bacteria 1981
104 Ga0307409_100312671 3300031995 Bacteria 1467
105 Ga0307416_100242600 3300032002 Bacteria 1747
106 Ga0307414_10043591 3300032004 Bacteria 3058
107 Ga0316585_10081947 3300032137 Bacteria 1051
108 Ga0316574_0004525 3300035398 Bacteria 7296
109 Ga0316574_0007436 3300035398 Bacteria 6005
110 Ga0316574_0012184 3300035398 Bacteria 4914
111 Ga0316582_0137011 3300036647 Bacteria 1648
112 Ga0316584_0035667 3300036712 Bacteria 3691
113 Ga0395899_0094728 3300037312 Bacteria 2160
114 Ga0395900_0004823 3300037418 Bacteria 14206
115 Ga0395900_0170002 3300037418 Bacteria 2220
116 Ga0395898_0013130 3300037466 Bacteria 8538
117 Ga0395898_0414441 3300037466 Bacteria 1284
118 Ga0395905_0000034 3300037471 Bacteria 275823
119 Ga0436364_0511179 3300037853 Bacteria 1723
120 Ga0395901_0084683 3300038443 Bacteria 3313
121 Ga0400484_42704 3300038725 Bacteria 9708
122 Ga0400485_04873 3300038735 Bacteria 24547
123 Ga0400485_16954 3300038735 Bacteria 48148
124 Ga0400488_02805 3300038741 Bacteria 1706
125 Ga0400488_28115 3300038741 Bacteria 3234
126 Ga0400488_46399 3300038741 Bacteria 1519
127 Ga0400488_50471 3300038741 Bacteria 3621
128 Ga0400488_63331 3300038741 Bacteria 1163
129 Ga0400486_05232 3300038742 Bacteria 21600
130 Ga0400486_25893 3300038742 Bacteria 20017
131 Ga0400483_030294 3300039062 Bacteria 10461
132 Ga0400483_090761 3300039062 Bacteria 1092
133 Ga0400483_127758 3300039062 Bacteria 5127
134 Ga0400483_168581 3300039062 Bacteria 7968
135 Ga0400483_274005 3300039062 Bacteria 4864
136 Ga0400483_279313 3300039062 Bacteria 10421
137 Ga0400489_20843 3300039093 Bacteria 17747
138 Ga0400489_44596 3300039093 Bacteria 5766
139 Ga0400489_74884 3300039093 Bacteria 5908
140 Ga0400487_15688 3300039110 Bacteria 53104
141 Ga0439461_0010481 3300041410 Bacteria 1703
142 Ga0439446_0055714 3300042156 Bacteria 1187
143 Ga0439446_0076866 3300042156 Bacteria 1028
144 Ga0466961_0181421 3300044693 Bacteria 1307
145 Ga0466970_0020112 3300044765 Bacteria 3465
146 Ga0451576_0006970 3300045051 Bacteria 13679
147 Ga0451576_0021722 3300045051 Bacteria 6969
148 Ga0451576_0215039 3300045051 Bacteria 2007
149 Ga0495590_0000056 3300046457 Bacteria 96913
150 Ga0495638_0003410 3300046460 Bacteria 12526
151 Ga0495650_0001444 3300046471 Bacteria 22917
152 Ga0495639_0004282 3300046475 Bacteria 6121
153 Ga0495607_0001066 3300046501 Bacteria 25057
154 Ga0495583_0026508 3300046506 Bacteria 2871
155 Ga0495606_0000149 3300046507 Bacteria 120165
156 Ga0495643_0003148 3300046522 Bacteria 12286
157 Ga0495648_0000119 3300046524 Bacteria 95682
158 Ga0495642_0001112 3300046528 Bacteria 12402
159 Ga0495597_0002099 3300046542 Bacteria 13242
160 Ga0495622_0000574 3300046557 Bacteria 22031
161 Ga0495633_0000088 3300046558 Bacteria 124193
162 Ga0495668_0001028 3300046616 Bacteria 29571
163 Ga0495668_0086449 3300046616 Bacteria 1720
164 Ga0495661_0082863 3300046665 Bacteria 1845
165 Ga0495649_0027635 3300046694 Bacteria 3147
166 Ga0495649_0041257 3300046694 Bacteria 2525
167 Ga0495660_0027139 3300046810 Bacteria 3240
168 Ga0495687_026625 3300047443 Bacteria 2718
169 Ga0495677_0116278 3300047445 Bacteria 1019
170 Ga0495673_0000146 3300047469 Bacteria 127378
171 Ga0495673_0131911 3300047469 Bacteria 981
172 Ga0495686_0000332 3300047472 Bacteria 77832
173 Ga0495686_0074866 3300047472 Bacteria 2077
174 Ga0496101_0303825 3300048904 Bacteria 1250
175 Ga0496103_0129206 3300048906 Bacteria 1613
176 Ga0496110_0034434 3300048913 Bacteria 4387
177 Ga0496111_0535923 3300048914 Bacteria 860
178 Ga0496115_0029189 3300048918 Bacteria 4330
179 Ga0496121_0017696 3300048924 Bacteria 7255
180 Ga0496121_0204737 3300048924 Bacteria 1403
181 Ga0496126_0004621 3300048929 Bacteria 16317
182 Ga0496126_0006825 3300048929 Bacteria 12664
183 Ga0495678_081678 3300049459 Bacteria 1158
184 Ga0501031_0049975 3300049568 Bacteria 2725
185 Ga0501033_0199830 3300049570 Bacteria 1428
186 Ga0501034_0484844 3300049571 Bacteria 1151
187 Ga0501036_0276760 3300049572 Bacteria 1405
188 Ga0501039_0043836 3300049575 Bacteria 3456
189 Ga0501039_0169328 3300049575 Bacteria 1717
190 Ga0501040_0213719 3300049576 Bacteria 1371
191 Ga0501041_0121379 3300049577 Bacteria 1624
192 Ga0501042_0010424 3300049578 Bacteria 6233
193 Ga0501046_0029518 3300049580 Bacteria 4458
194 Ga0501046_0069806 3300049580 Bacteria 2733
195 Ga0501047_0100080 3300049581 Bacteria 2778
196 Ga0501048_0185039 3300049582 Bacteria 1476
197 Ga0501069_0070668 3300049585 Bacteria 1956
198 Ga0501069_0090338 3300049585 Bacteria 1732
199 Ga0501071_0027820 3300049587 Bacteria 3980
200 Ga0501072_0016770 3300049588 Bacteria 5625
201 Ga0501074_0201569 3300049590 Bacteria 1418
202 Ga0501075_0094039 3300049591 Bacteria 2275
203 Ga0501075_0117727 3300049591 Bacteria 2020
204 Ga0501075_0149078 3300049591 Bacteria 1783
205 Ga0501076_0099563 3300049592 Bacteria 2342
206 Ga0501076_0406393 3300049592 Bacteria 1120
207 Ga0501077_0051329 3300049593 Bacteria 2621
208 Ga0501079_0054315 3300049741 Bacteria 3090
209 Ga0501080_0788393 3300049742 Unclassified 834
210 Ga0501081_0111461 3300049743 Bacteria 1942
211 Ga0501044_0376369 3300049823 Bacteria 1336
212 nmdc:mga03n38_75390_c1 3300050490 Bacteria 1571
213 nmdc:mga00v17_80057_c1 3300050491 Bacteria 2038
214 nmdc:mga0yw44_10252_c1 3300050492 Bacteria 4778
215 nmdc:mga0k408_2542_c1 3300050493 Bacteria 9697
216 nmdc:mga06z11_178288_c1 3300050494 Bacteria 1224
217 nmdc:mga06z11_8249_c1 3300050494 Bacteria 4331
218 nmdc:mga04h51_89915_c1 3300050495 Bacteria 1103
219 nmdc:mga07m45_142437_c1 3300050496 Bacteria 1388
220 nmdc:mga05p37_10682_c1 3300050507 Bacteria 10898
221 nmdc:mga05p37_256444_c1 3300050507 Bacteria 2095
222 nmdc:mga05p37_98463_c1 3300050507 Bacteria 3602
223 nmdc:mga09592_77923_c1 3300050508 Bacteria 2820
224 nmdc:mga0qj67_2799_c1 3300050509 Bacteria 12511
225 nmdc:mga06r32_14066_c1 3300050510 Bacteria 7257
226 nmdc:mga06r32_3496_c1 3300050510 Bacteria 14018
227 nmdc:mga08y16_1454_c1 3300050511 Bacteria 23727
228 nmdc:mga08y16_27_c1 3300050511 Bacteria 214573
229 nmdc:mga0rr50_221066_c1 3300050513 Bacteria 1564
230 nmdc:mga0a205_269510_c1 3300050515 Bacteria 1579
231 Ga0500604_0035922 3300053151 Bacteria 1476
232 Ga0501084_0078852 3300054114 Bacteria 2760
233 Ga0590075_013580 3300059424 Bacteria 1988
234 Ga0501082_0088558 3300060353 Bacteria 2671
235 Ga0530510_0233786 3300061734 Bacteria 1367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_168581 Ga0400483_168581_6430_7092 219
2 3300049742 Ga0501080_0788393 Ga0501080_0788393_129_812 219
3 iso_pu_bacteria 2818991453 2819642268 220
4 3300049585 Ga0501069_0070668 Ga0501069_0070668_811_1572 228
5 3300009094 Ga0111539_10000030 Ga0111539_1000003020 229
6 3300027907 Ga0207428_10000038 Ga0207428_1000003871 229
7 3300050511 nmdc:mga08y16_27_c1 nmdc:mga08y16_27_c1_61400_62161 229
8 3300005293 Ga0065715_10169982 Ga0065715_101699822 231
9 3300005459 Ga0068867_100031072 Ga0068867_1000310723 231
10 3300005719 Ga0068861_100526493 Ga0068861_1005264931 231
11 3300006042 Ga0075368_10028662 Ga0075368_100286622 231
12 3300006048 Ga0075363_100035529 Ga0075363_1000355292 231
13 3300006051 Ga0075364_10040167 Ga0075364_100401673 231
14 3300006051 Ga0075364_10140183 Ga0075364_101401832 231
15 3300006178 Ga0075367_10052078 Ga0075367_100520782 231
16 3300006178 Ga0075367_10078085 Ga0075367_100780851 231
17 3300007265 Ga0099794_10000281 Ga0099794_100002812 231
18 3300009176 Ga0105242_10003075 Ga0105242_100030754 231
19 3300025923 Ga0207681_10273964 Ga0207681_102739641 231
20 3300026089 Ga0207648_10046030 Ga0207648_100460302 231
21 3300026118 Ga0207675_100458906 Ga0207675_1004589061 231
22 3300031727 Ga0316576_10014549 Ga0316576_100145495 231
23 3300031901 Ga0307406_10319625 Ga0307406_103196251 231
24 3300032002 Ga0307416_100242600 Ga0307416_1002426002 231
25 3300035398 Ga0316574_0012184 Ga0316574_0012184_3280_4053 231
26 3300036647 Ga0316582_0137011 Ga0316582_0137011_864_1637 231
27 3300036712 Ga0316584_0035667 Ga0316584_0035667_1822_2595 231
28 3300037418 Ga0395900_0170002 Ga0395900_0170002_1262_2029 231
29 3300037466 Ga0395898_0414441 Ga0395898_0414441_299_1066 231
30 3300044693 Ga0466961_0181421 Ga0466961_0181421_494_1261 231
31 3300044765 Ga0466970_0020112 Ga0466970_0020112_394_1164 231
32 3300046694 Ga0495649_0041257 Ga0495649_0041257_864_1634 231
33 3300047472 Ga0495686_0074866 Ga0495686_0074866_294_1076 231
34 3300048929 Ga0496126_0006825 Ga0496126_0006825_9300_10070 231
35 3300049581 Ga0501047_0100080 Ga0501047_0100080_1641_2411 231
36 3300049585 Ga0501069_0090338 Ga0501069_0090338_809_1603 231
37 3300049588 Ga0501072_0016770 Ga0501072_0016770_1064_1933 231
38 3300049591 Ga0501075_0117727 Ga0501075_0117727_546_1316 231
39 3300049592 Ga0501076_0406393 Ga0501076_0406393_97_867 231
40 3300050490 nmdc:mga03n38_75390_c1 nmdc:mga03n38_75390_c1_313_1092 231
41 3300050491 nmdc:mga00v17_80057_c1 nmdc:mga00v17_80057_c1_210_989 231
42 3300050492 nmdc:mga0yw44_10252_c1 nmdc:mga0yw44_10252_c1_2042_2809 231
43 3300050494 nmdc:mga06z11_178288_c1 nmdc:mga06z11_178288_c1_22_795 231
44 3300050494 nmdc:mga06z11_8249_c1 nmdc:mga06z11_8249_c1_873_1652 231
45 3300050495 nmdc:mga04h51_89915_c1 nmdc:mga04h51_89915_c1_210_989 231
46 3300050496 nmdc:mga07m45_142437_c1 nmdc:mga07m45_142437_c1_262_1041 231
47 3300053151 Ga0500604_0035922 Ga0500604_0035922_531_1331 231
48 3300059424 Ga0590075_013580 Ga0590075_013580_71_841 231
49 iso_pu_bacteria 2884215851 2884219025 231
50 3300003763 Ga0055529_1000274 Ga0055529_100027429 232
51 3300005328 Ga0070676_10134269 Ga0070676_101342692 232
52 3300005335 Ga0070666_10027073 Ga0070666_100270732 232
53 3300005336 Ga0070680_100032367 Ga0070680_1000323672 232
54 3300005337 Ga0070682_100069231 Ga0070682_1000692313 232
55 3300005338 Ga0068868_100107883 Ga0068868_1001078832 232
56 3300005339 Ga0070660_100032209 Ga0070660_1000322091 232
57 3300005339 Ga0070660_100127124 Ga0070660_1001271243 232
58 3300005354 Ga0070675_100114336 Ga0070675_1001143362 232
59 3300005441 Ga0070700_100161532 Ga0070700_1001615322 232
60 3300005456 Ga0070678_100130292 Ga0070678_1001302922 232
61 3300005457 Ga0070662_100101080 Ga0070662_1001010802 232
62 3300005458 Ga0070681_10135001 Ga0070681_101350012 232
63 3300005530 Ga0070679_100139635 Ga0070679_1001396352 232
64 3300005544 Ga0070686_100015287 Ga0070686_1000152872 232
65 3300005546 Ga0070696_100079533 Ga0070696_1000795332 232
66 3300005578 Ga0068854_100159609 Ga0068854_1001596092 232
67 3300005614 Ga0068856_100135593 Ga0068856_1001355932 232
68 3300005614 Ga0068856_100661442 Ga0068856_1006614422 232
69 3300005615 Ga0070702_100035319 Ga0070702_1000353192 232
70 3300005981 Ga0081538_10018597 Ga0081538_100185972 232
71 3300006163 Ga0070715_10296499 Ga0070715_102964991 232
72 3300006173 Ga0070716_100104325 Ga0070716_1001043252 232
73 3300006844 Ga0075428_100224924 Ga0075428_1002249242 232
74 3300006844 Ga0075428_100379215 Ga0075428_1003792152 232
75 3300006847 Ga0075431_100001973 Ga0075431_10000197310 232
76 3300007076 Ga0075435_100533205 Ga0075435_1005332052 232
77 3300009098 Ga0105245_10006486 Ga0105245_100064866 232
78 3300009098 Ga0105245_10010198 Ga0105245_100101983 232
79 3300009098 Ga0105245_10018692 Ga0105245_100186924 232
80 3300009098 Ga0105245_10941916 Ga0105245_109419162 232
81 3300009101 Ga0105247_10071538 Ga0105247_100715382 232
82 3300009147 Ga0114129_10030909 Ga0114129_100309093 232
83 3300009148 Ga0105243_10118912 Ga0105243_101189123 232
84 3300009174 Ga0105241_10024231 Ga0105241_100242312 232
85 3300009553 Ga0105249_10016675 Ga0105249_100166756 232
86 3300010375 Ga0105239_10055776 Ga0105239_100557763 232
87 3300013100 Ga0157373_10328683 Ga0157373_103286831 232
88 3300013306 Ga0163162_10006995 Ga0163162_100069957 232
89 3300013307 Ga0157372_10342039 Ga0157372_103420391 232
90 3300014326 Ga0157380_10199179 Ga0157380_101991792 232
91 3300014968 Ga0157379_10017344 Ga0157379_100173444 232
92 3300017792 Ga0163161_10065986 Ga0163161_100659862 232
93 3300021361 Ga0213872_10009680 Ga0213872_100096804 232
94 3300025245 Ga0207425_1000593 Ga0207425_10005937 232
95 3300025297 Ga0209758_1004286 Ga0209758_10042867 232
96 3300025900 Ga0207710_10041565 Ga0207710_100415652 232
97 3300025903 Ga0207680_10017535 Ga0207680_100175353 232
98 3300025907 Ga0207645_10254763 Ga0207645_102547632 232
99 3300025912 Ga0207707_10202992 Ga0207707_102029922 232
100 3300025919 Ga0207657_10007542 Ga0207657_100075422 232
101 3300025921 Ga0207652_10094848 Ga0207652_100948482 232
102 3300025927 Ga0207687_10034150 Ga0207687_100341503 232
103 3300025927 Ga0207687_10038175 Ga0207687_100381753 232
104 3300025931 Ga0207644_10469455 Ga0207644_104694551 232
105 3300025932 Ga0207690_10275020 Ga0207690_102750202 232
106 3300025933 Ga0207706_10164321 Ga0207706_101643212 232
107 3300025935 Ga0207709_10062530 Ga0207709_100625303 232
108 3300025939 Ga0207665_10064855 Ga0207665_100648553 232
109 3300025981 Ga0207640_10106967 Ga0207640_101069672 232
110 3300026023 Ga0207677_10078694 Ga0207677_100786942 232
111 3300026078 Ga0207702_10118947 Ga0207702_101189473 232
112 3300026118 Ga0207675_100001628 Ga0207675_10000162816 232
113 3300026121 Ga0207683_10128993 Ga0207683_101289933 232
114 3300031665 Ga0316575_10027144 Ga0316575_100271441 232
115 3300031727 Ga0316576_10107280 Ga0316576_101072802 232
116 3300031728 Ga0316578_10021207 Ga0316578_100212073 232
117 3300031728 Ga0316578_10050692 Ga0316578_100506921 232
118 3300031728 Ga0316578_10127138 Ga0316578_101271381 232
119 3300031852 Ga0307410_10162216 Ga0307410_101622161 232
120 3300031995 Ga0307409_100312671 Ga0307409_1003126712 232
121 3300032137 Ga0316585_10081947 Ga0316585_100819471 232
122 3300035398 Ga0316574_0004525 Ga0316574_0004525_251_1024 232
123 3300035398 Ga0316574_0007436 Ga0316574_0007436_4213_4986 232
124 3300037312 Ga0395899_0094728 Ga0395899_0094728_768_1544 232
125 3300037418 Ga0395900_0004823 Ga0395900_0004823_6408_7184 232
126 3300037466 Ga0395898_0013130 Ga0395898_0013130_340_1116 232
127 3300037471 Ga0395905_0000034 Ga0395905_0000034_134785_135564 232
128 3300037853 Ga0436364_0511179 Ga0436364_0511179_508_1281 232
129 3300038443 Ga0395901_0084683 Ga0395901_0084683_2032_2808 232
130 3300038725 Ga0400484_42704 Ga0400484_42704_1944_2717 232
131 3300038735 Ga0400485_04873 Ga0400485_04873_21902_22675 232
132 3300038735 Ga0400485_16954 Ga0400485_16954_33604_34377 232
133 3300038741 Ga0400488_02805 Ga0400488_02805_17_790 232
134 3300038741 Ga0400488_28115 Ga0400488_28115_305_1078 232
135 3300038741 Ga0400488_46399 Ga0400488_46399_333_1106 232
136 3300038741 Ga0400488_50471 Ga0400488_50471_2207_2983 232
137 3300038741 Ga0400488_63331 Ga0400488_63331_354_1127 232
138 3300038742 Ga0400486_05232 Ga0400486_05232_6268_7041 232
139 3300038742 Ga0400486_25893 Ga0400486_25893_14502_15275 232
140 3300039062 Ga0400483_030294 Ga0400483_030294_462_1235 232
141 3300039062 Ga0400483_127758 Ga0400483_127758_3445_4218 232
142 3300039062 Ga0400483_274005 Ga0400483_274005_4073_4846 232
143 3300039062 Ga0400483_279313 Ga0400483_279313_2466_3239 232
144 3300039093 Ga0400489_20843 Ga0400489_20843_1945_2718 232
145 3300039093 Ga0400489_44596 Ga0400489_44596_3321_4094 232
146 3300039093 Ga0400489_74884 Ga0400489_74884_4280_5053 232
147 3300039110 Ga0400487_15688 Ga0400487_15688_14052_14825 232
148 3300041410 Ga0439461_0010481 Ga0439461_0010481_22_807 232
149 3300042156 Ga0439446_0055714 Ga0439446_0055714_339_1112 232
150 3300042156 Ga0439446_0076866 Ga0439446_0076866_22_807 232
151 3300045051 Ga0451576_0006970 Ga0451576_0006970_780_1553 232
152 3300045051 Ga0451576_0021722 Ga0451576_0021722_4199_4972 232
153 3300045051 Ga0451576_0215039 Ga0451576_0215039_463_1236 232
154 3300046457 Ga0495590_0000056 Ga0495590_0000056_22703_23476 232
155 3300046460 Ga0495638_0003410 Ga0495638_0003410_57_758 232
156 3300046471 Ga0495650_0001444 Ga0495650_0001444_11731_12504 232
157 3300046475 Ga0495639_0004282 Ga0495639_0004282_1506_2279 232
158 3300046501 Ga0495607_0001066 Ga0495607_0001066_1463_2164 232
159 3300046506 Ga0495583_0026508 Ga0495583_0026508_2114_2815 232
160 3300046507 Ga0495606_0000149 Ga0495606_0000149_28606_29307 232
161 3300046522 Ga0495643_0003148 Ga0495643_0003148_568_1341 232
162 3300046524 Ga0495648_0000119 Ga0495648_0000119_15534_16307 232
163 3300046524 Ga0495648_0000119 Ga0495648_0000119_2267_3040 232
164 3300046528 Ga0495642_0001112 Ga0495642_0001112_5418_6191 232
165 3300046542 Ga0495597_0002099 Ga0495597_0002099_1213_1986 232
166 3300046557 Ga0495622_0000574 Ga0495622_0000574_11077_11850 232
167 3300046558 Ga0495633_0000088 Ga0495633_0000088_110411_111184 232
168 3300046616 Ga0495668_0001028 Ga0495668_0001028_22605_23378 232
169 3300046665 Ga0495661_0082863 Ga0495661_0082863_135_908 232
170 3300046694 Ga0495649_0027635 Ga0495649_0027635_2320_3093 232
171 3300046810 Ga0495660_0027139 Ga0495660_0027139_556_1329 232
172 3300047443 Ga0495687_026625 Ga0495687_026625_25_726 232
173 3300047469 Ga0495673_0000146 Ga0495673_0000146_22747_23520 232
174 3300047469 Ga0495673_0000146 Ga0495673_0000146_28943_29716 232
175 3300047469 Ga0495673_0131911 Ga0495673_0131911_97_870 232
176 3300047472 Ga0495686_0000332 Ga0495686_0000332_16013_16786 232
177 3300048904 Ga0496101_0303825 Ga0496101_0303825_277_1050 232
178 3300048906 Ga0496103_0129206 Ga0496103_0129206_281_1054 232
179 3300048913 Ga0496110_0034434 Ga0496110_0034434_464_1237 232
180 3300048914 Ga0496111_0535923 Ga0496111_0535923_35_808 232
181 3300048918 Ga0496115_0029189 Ga0496115_0029189_3108_3881 232
182 3300048924 Ga0496121_0017696 Ga0496121_0017696_2984_3802 232
183 3300048924 Ga0496121_0204737 Ga0496121_0204737_487_1266 232
184 3300048929 Ga0496126_0004621 Ga0496126_0004621_6547_7365 232
185 3300049459 Ga0495678_081678 Ga0495678_081678_401_1102 232
186 3300049568 Ga0501031_0049975 Ga0501031_0049975_550_1323 232
187 3300049570 Ga0501033_0199830 Ga0501033_0199830_411_1184 232
188 3300049571 Ga0501034_0484844 Ga0501034_0484844_12_824 232
189 3300049575 Ga0501039_0169328 Ga0501039_0169328_665_1438 232
190 3300049577 Ga0501041_0121379 Ga0501041_0121379_804_1577 232
191 3300049580 Ga0501046_0029518 Ga0501046_0029518_3536_4309 232
192 3300049591 Ga0501075_0149078 Ga0501075_0149078_435_1211 232
193 3300050493 nmdc:mga0k408_2542_c1 nmdc:mga0k408_2542_c1_2922_3734 232
194 3300050507 nmdc:mga05p37_98463_c1 nmdc:mga05p37_98463_c1_761_1531 232
195 3300050510 nmdc:mga06r32_14066_c1 nmdc:mga06r32_14066_c1_6348_7118 232
196 3300050513 nmdc:mga0rr50_221066_c1 nmdc:mga0rr50_221066_c1_781_1551 232
197 3300050515 nmdc:mga0a205_269510_c1 nmdc:mga0a205_269510_c1_205_981 232
198 iso_pu_bacteria 2858688981 2858696139 232
199 iso_pu_bacteria 2899924645 2899927057 232
200 3300003320 rootH2_10003585 rootH2_1000358522 233
201 3300005289 Ga0065704_10119015 Ga0065704_101190152 233
202 3300005329 Ga0070683_100166581 Ga0070683_1001665812 233
203 3300005467 Ga0070706_100096723 Ga0070706_1000967232 233
204 3300005981 Ga0081538_10028953 Ga0081538_100289532 233
205 3300005981 Ga0081538_10052527 Ga0081538_100525272 233
206 3300006846 Ga0075430_100001618 Ga0075430_1000016182 233
207 3300006847 Ga0075431_100000526 Ga0075431_10000052619 233
208 3300006880 Ga0075429_100085070 Ga0075429_1000850702 233
209 3300009094 Ga0111539_10002204 Ga0111539_100022044 233
210 3300009147 Ga0114129_10013718 Ga0114129_1001371810 233
211 3300009147 Ga0114129_10282842 Ga0114129_102828422 233
212 3300025937 Ga0207669_10265214 Ga0207669_102652142 233
213 3300027907 Ga0207428_10019897 Ga0207428_100198974 233
214 3300031903 Ga0307407_10079290 Ga0307407_100792902 233
215 3300032004 Ga0307414_10043591 Ga0307414_100435913 233
216 3300039062 Ga0400483_090761 Ga0400483_090761_178_954 233
217 3300046616 Ga0495668_0086449 Ga0495668_0086449_290_1087 233
218 3300047445 Ga0495677_0116278 Ga0495677_0116278_85_882 233
219 3300049572 Ga0501036_0276760 Ga0501036_0276760_639_1364 233
220 3300049575 Ga0501039_0043836 Ga0501039_0043836_2013_2810 233
221 3300049576 Ga0501040_0213719 Ga0501040_0213719_281_1078 233
222 3300049578 Ga0501042_0010424 Ga0501042_0010424_1984_2781 233
223 3300049580 Ga0501046_0069806 Ga0501046_0069806_48_773 233
224 3300049582 Ga0501048_0185039 Ga0501048_0185039_91_888 233
225 3300049587 Ga0501071_0027820 Ga0501071_0027820_1888_2685 233
226 3300049590 Ga0501074_0201569 Ga0501074_0201569_606_1403 233
227 3300049591 Ga0501075_0094039 Ga0501075_0094039_564_1361 233
228 3300049592 Ga0501076_0099563 Ga0501076_0099563_1601_2326 233
229 3300049593 Ga0501077_0051329 Ga0501077_0051329_1856_2581 233
230 3300049741 Ga0501079_0054315 Ga0501079_0054315_1011_1808 233
231 3300049743 Ga0501081_0111461 Ga0501081_0111461_1124_1921 233
232 3300049823 Ga0501044_0376369 Ga0501044_0376369_522_1319 233
233 3300050507 nmdc:mga05p37_10682_c1 nmdc:mga05p37_10682_c1_1829_2605 233
234 3300050507 nmdc:mga05p37_256444_c1 nmdc:mga05p37_256444_c1_623_1456 233
235 3300050508 nmdc:mga09592_77923_c1 nmdc:mga09592_77923_c1_602_1435 233
236 3300050509 nmdc:mga0qj67_2799_c1 nmdc:mga0qj67_2799_c1_11284_12117 233
237 3300050510 nmdc:mga06r32_3496_c1 nmdc:mga06r32_3496_c1_9664_10497 233
238 3300050511 nmdc:mga08y16_1454_c1 nmdc:mga08y16_1454_c1_17597_18373 233
239 3300054114 Ga0501084_0078852 Ga0501084_0078852_1166_1963 233
240 3300060353 Ga0501082_0088558 Ga0501082_0088558_1174_1971 233
241 3300061734 Ga0530510_0233786 Ga0530510_0233786_26_823 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

100

0.85

PF00483

NTP_transferase

Nucleotidyl transferase

2

236

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9291 1 233
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9253 1 233
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9017 1 233
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8835 1 233
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8063 2 225
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9291 1 233 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9253 1 233 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8291 70 213 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7845 2 223 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7819 1 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A257GWQ9-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9796 1 112 GO:0009058
GO:0047343
AF-A0A529I2Z1-F1-model_v4 deleted 0.974 1 122
AF-A0A432TMY5-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.969 1 77 GO:0009228
GO:0047343
AF-A0A258KUJ6-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9666 1 122 GO:0009058
GO:0047343
AF-A0A382RYG7-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9598 1 110 GO:0009058
GO:0047343

Feature Viewer

pLDDT pTM Quality
91.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map