F353495

General Info

Members Datasets Scaffolds Average Seq Length
241 208 482 213

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100368574|Ga0070689_1003685741
Length 241
Sequence MNTDENFPENPPPNDEALLKKRGEPVEIRSNRREFIAQVGGCAAGVLALQVWQQQQLLGQVSPAPAFTAAGRMMKVSFTVNGKRCELEIDTRTTLLDALREHLHLTGSKKGCDQGQCGACTVMVGGRRVVSCLTLAVMHEGDEITTIEGLGTPEKLHPMQAAFVKHDGFQCGYCTPGQICSAVAMLRELKAGIPSHATADLTAVPQLTSDELRERMSGNICRCGAYSNIAEAITEVAGGTA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
37 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
76 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
77 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
100 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
178 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
181 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
182 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
183 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
184 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
185 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
186 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
187 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
188 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
189 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
190 2643221558 Rhizobium sp. Root149 Isolate Unclassified
191 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
192 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
193 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
194 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
195 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
196 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
197 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
198 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
199 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
200 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
201 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
202 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
203 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
204 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
205 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
206 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
207 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
208 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.55
Metatranscriptomes 0
Isolates 12.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.54
Nodule 9.13
Rhizoplane 4.98
Rhizosphere 65.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100368574 3300005340 Bacteria 1208
2 MRS1b_contig_6837346 2162886011 Bacteria 1033
3 CNXas_1000036 3300000545 Bacteria 28421
4 rootL2_10020812 3300003322 Bacteria 11716
5 Ga0055536_1011710 3300003781 Bacteria 3328
6 Ga0055540_1000179 3300003792 Bacteria 62199
7 Ga0055540_1000210 3300003792 Bacteria 55346
8 Ga0055540_1004339 3300003792 Bacteria 6446
9 JGI25405J52794_10001008 3300003911 Bacteria 4464
10 JGI25405J52794_10014651 3300003911 Bacteria 1534
11 Ga0065712_10094466 3300005290 Bacteria 2252
12 Ga0065715_10008058 3300005293 Bacteria 3415
13 Ga0070658_10000559 3300005327 Bacteria 32249
14 Ga0070683_100097804 3300005329 Bacteria 2761
15 Ga0070690_100036783 3300005330 Bacteria 3080
16 Ga0070666_10179096 3300005335 Bacteria 1486
17 Ga0070680_100024028 3300005336 Bacteria 4865
18 Ga0070660_100462546 3300005339 Bacteria 1053
19 Ga0070689_100245758 3300005340 Bacteria 1475
20 Ga0070661_100175139 3300005344 Bacteria 1630
21 Ga0070675_100042817 3300005354 Bacteria 3700
22 Ga0070671_100019655 3300005355 Bacteria 5500
23 Ga0070673_100006671 3300005364 Bacteria 7526
24 Ga0070659_100136708 3300005366 Bacteria 1993
25 Ga0070714_100529762 3300005435 Bacteria 1126
26 Ga0070713_100321682 3300005436 Bacteria 1429
27 Ga0070710_10365410 3300005437 Bacteria 959
28 Ga0070678_100103888 3300005456 Bacteria 2208
29 Ga0070662_100031032 3300005457 Bacteria 3746
30 Ga0070662_100529003 3300005457 Bacteria 986
31 Ga0070681_10020689 3300005458 Bacteria 6592
32 Ga0070679_100099875 3300005530 Bacteria 2889
33 Ga0070684_100010061 3300005535 Bacteria 7477
34 Ga0068856_100136597 3300005614 Bacteria 2457
35 Ga0068864_100188827 3300005618 Bacteria 1888
36 Ga0068858_100048769 3300005842 Bacteria 3922
37 Ga0081455_10005923 3300005937 Bacteria 13267
38 Ga0081455_10016419 3300005937 Bacteria 7150
39 Ga0075364_10354585 3300006051 Bacteria 1000
40 Ga0070712_100319593 3300006175 Bacteria 1262
41 Ga0097621_100041215 3300006237 Bacteria 3716
42 Ga0099824_1025655 3300006942 Bacteria 3182
43 Ga0099822_1000663 3300006943 Bacteria 34548
44 Ga0099795_10131424 3300007788 Bacteria 1010
45 Ga0111539_10990836 3300009094 Bacteria 977
46 Ga0105241_10031913 3300009174 Bacteria 3945
47 Ga0105237_10543354 3300009545 Bacteria 1169
48 Ga0105237_10740450 3300009545 Bacteria 989
49 Ga0105249_10781565 3300009553 Bacteria 1018
50 Ga0099796_10019591 3300010159 Bacteria 2054
51 Ga0157371_10342917 3300013102 Bacteria 1087
52 Ga0157369_10038588 3300013105 Bacteria 5223
53 Ga0157374_10238121 3300013296 Bacteria 1789
54 Ga0157372_10054051 3300013307 Bacteria 4478
55 Ga0157372_10122298 3300013307 Bacteria 2991
56 Ga0157375_10267674 3300013308 Bacteria 1871
57 Ga0157380_10007835 3300014326 Bacteria 7602
58 Ga0157376_10007190 3300014969 Bacteria 7914
59 Ga0207673_1002225 3300025290 Bacteria 2192
60 Ga0209676_1000065 3300025292 Bacteria 318605
61 Ga0209676_1024300 3300025292 Bacteria 1967
62 Ga0209758_1001136 3300025297 Bacteria 34152
63 Ga0209050_1022822 3300025298 Bacteria 2228
64 Ga0209051_1000032 3300025303 Bacteria 383445
65 Ga0209051_1000151 3300025303 Bacteria 131835
66 Ga0209257_1000810 3300025304 Bacteria 45391
67 Ga0209257_1007710 3300025304 Bacteria 6417
68 Ga0207697_10001151 3300025315 Bacteria 14539
69 Ga0207680_10088625 3300025903 Bacteria 1962
70 Ga0207671_10466164 3300025914 Bacteria 1006
71 Ga0207693_10409972 3300025915 Bacteria 1059
72 Ga0207649_10109545 3300025920 Bacteria 1843
73 Ga0207652_10108784 3300025921 Bacteria 2457
74 Ga0207659_10030924 3300025926 Bacteria 3661
75 Ga0207664_10613209 3300025929 Bacteria 977
76 Ga0207644_10008353 3300025931 Bacteria 6779
77 Ga0207644_10012728 3300025931 Bacteria 5593
78 Ga0207644_10355013 3300025931 Bacteria 1191
79 Ga0207706_10038826 3300025933 Bacteria 4223
80 Ga0207706_10126758 3300025933 Bacteria 2245
81 Ga0207670_10274095 3300025936 Bacteria 1313
82 Ga0207670_10301784 3300025936 Bacteria 1254
83 Ga0207711_10003996 3300025941 Bacteria 12662
84 Ga0207661_10068905 3300025944 Bacteria 2882
85 Ga0207679_10296529 3300025945 Bacteria 1392
86 Ga0207668_10078412 3300025972 Bacteria 2385
87 Ga0207702_10121052 3300026078 Bacteria 2342
88 Ga0207641_10223562 3300026088 Bacteria 1747
89 Ga0207676_10765245 3300026095 Bacteria 940
90 Ga0209589_1000006 3300027357 Bacteria 436292
91 Ga0209489_100007 3300027361 Bacteria 436292
92 Ga0209700_100008 3300027363 Bacteria 436292
93 Ga0268266_10144190 3300028379 Bacteria 2139
94 Ga0268264_10469585 3300028381 Bacteria 1222
95 Ga0307513_10226129 3300031456 Bacteria 1688
96 Ga0307408_100410546 3300031548 Bacteria 1165
97 Ga0307516_10000325 3300031730 Bacteria 61945
98 Ga0307405_10441454 3300031731 Bacteria 1029
99 Ga0307413_10240479 3300031824 Bacteria 1336
100 Ga0307406_10092473 3300031901 Bacteria 2040
101 Ga0307411_10160649 3300032005 Bacteria 1682
102 Ga0307415_100174888 3300032126 Bacteria 1678
103 Ga0373943_0031627 3300035170 Bacteria 2512
104 Ga0373935_0257129 3300035692 Bacteria 1224
105 Ga0373947_0343695 3300035725 Bacteria 1000
106 Ga0395900_0341401 3300037418 Bacteria 1473
107 Ga0436364_0865906 3300037853 Bacteria 5091
108 Ga0395901_0105777 3300038443 Bacteria 2954
109 Ga0439436_0039028 3300041404 Bacteria 1364
110 Ga0439439_0055919 3300041406 Bacteria 1042
111 Ga0439461_0000022 3300041410 Bacteria 20065
112 Ga0439465_0000135 3300041413 Bacteria 18045
113 Ga0439465_0006494 3300041413 Bacteria 3717
114 Ga0439465_0078739 3300041413 Bacteria 1114
115 Ga0451837_0354990 3300041494 Bacteria 1686
116 Ga0451849_0988696 3300041505 Bacteria 2189
117 Ga0451851_0521310 3300041507 Bacteria 2055
118 Ga0451843_1309127 3300041509 Bacteria 1805
119 Ga0451853_1124804 3300041512 Bacteria 3921
120 Ga0439431_0000203 3300041997 Bacteria 11734
121 Ga0439442_003715 3300042002 Bacteria 3023
122 Ga0439445_0000434 3300042004 Bacteria 8437
123 Ga0439448_0002602 3300042005 Bacteria 4917
124 Ga0439432_000279 3300042006 Bacteria 18441
125 Ga0439452_026189 3300042010 Bacteria 1474
126 Ga0439452_027516 3300042010 Bacteria 1427
127 Ga0439455_0000552 3300042012 Bacteria 5301
128 Ga0439462_0012258 3300042015 Bacteria 2189
129 Ga0439434_0002684 3300042435 Bacteria 5184
130 Ga0466961_0208953 3300044693 Bacteria 1205
131 Ga0466963_0001201 3300044694 Bacteria 13635
132 Ga0466964_0034033 3300044706 Bacteria 2032
133 Ga0466971_0000302 3300044719 Bacteria 18980
134 Ga0466957_0006295 3300044842 Bacteria 6699
135 Ga0466958_0012801 3300045836 Bacteria 4760
136 Ga0466967_0000642 3300045976 Bacteria 17574
137 Ga0495638_0000528 3300046460 Bacteria 44566
138 Ga0495638_0000960 3300046460 Bacteria 29237
139 Ga0495653_0099947 3300046463 Bacteria 2104
140 Ga0495585_0029205 3300046492 Bacteria 3140
141 Ga0495585_0292170 3300046492 Bacteria 803
142 Ga0495594_0297292 3300046499 Bacteria 920
143 Ga0495596_0000042 3300046500 Bacteria 90746
144 Ga0495607_0001285 3300046501 Bacteria 22459
145 Ga0495607_0028622 3300046501 Bacteria 3437
146 Ga0495607_0104659 3300046501 Bacteria 1510
147 Ga0495620_0027729 3300046515 Bacteria 2646
148 Ga0495620_0164654 3300046515 Bacteria 861
149 Ga0495628_0131365 3300046516 Bacteria 1915
150 Ga0495630_0012452 3300046517 Bacteria 6175
151 Ga0495632_0000397 3300046519 Bacteria 40939
152 Ga0495632_0093475 3300046519 Bacteria 1423
153 Ga0495643_0005928 3300046522 Bacteria 8156
154 Ga0495648_0135035 3300046524 Bacteria 1306
155 Ga0495609_0013383 3300046538 Bacteria 3876
156 Ga0495645_0056493 3300046543 Bacteria 2850
157 Ga0495633_0072864 3300046558 Bacteria 1601
158 Ga0495668_0021467 3300046616 Bacteria 3702
159 Ga0495668_0080661 3300046616 Bacteria 1786
160 Ga0495634_0050960 3300046642 Bacteria 2778
161 Ga0495625_0066635 3300046660 Bacteria 2536
162 Ga0495625_0189168 3300046660 Bacteria 1365
163 Ga0495635_0230285 3300046663 Bacteria 1252
164 Ga0495661_0000673 3300046665 Bacteria 34125
165 Ga0495661_0013772 3300046665 Bacteria 5426
166 Ga0495670_0000005 3300046691 Bacteria 289725
167 Ga0495671_0015129 3300046692 Bacteria 4141
168 Ga0495674_0141755 3300047319 Bacteria 2020
169 Ga0495683_0177251 3300047323 Bacteria 976
170 Ga0495677_0000332 3300047445 Bacteria 20349
171 Ga0495684_0015917 3300047471 Bacteria 5791
172 Ga0495686_0000054 3300047472 Bacteria 259400
173 Ga0495686_0183774 3300047472 Bacteria 1210
174 Ga0495615_0000331 3300048090 Bacteria 7858
175 Ga0496102_0739804 3300048905 Bacteria 906
176 Ga0496103_0037283 3300048906 Bacteria 2978
177 Ga0496104_0198140 3300048907 Bacteria 1920
178 Ga0496104_0840418 3300048907 Bacteria 824
179 Ga0496105_0009161 3300048908 Bacteria 7725
180 Ga0496109_0311150 3300048912 Bacteria 1486
181 Ga0496110_0399051 3300048913 Bacteria 1254
182 Ga0496113_0782899 3300048916 Bacteria 758
183 Ga0496115_0040084 3300048918 Bacteria 3722
184 Ga0496115_0567055 3300048918 Bacteria 906
185 Ga0496116_0099176 3300048919 Bacteria 1745
186 Ga0496117_0027451 3300048920 Bacteria 4436
187 Ga0496118_0031953 3300048921 Bacteria 4348
188 Ga0496119_0045660 3300048922 Bacteria 2744
189 Ga0496120_0098644 3300048923 Bacteria 1548
190 Ga0496121_0015697 3300048924 Bacteria 7898
191 Ga0496122_0193714 3300048925 Bacteria 1197
192 Ga0496125_0023227 3300048928 Bacteria 5729
193 Ga0496126_0240021 3300048929 Bacteria 1514
194 Ga0501034_0646917 3300049571 Bacteria 959
195 Ga0501037_0594702 3300049573 Bacteria 743
196 Ga0501047_0001107 3300049581 Bacteria 26758
197 Ga0501238_000519 3300049671 Bacteria 4405
198 Ga0501080_0007192 3300049742 Bacteria 10046
199 Ga0501035_0036867 3300049822 Bacteria 4430
200 Ga0495601_0252106 3300053077 Bacteria 1153
201 Ga0500610_0108519 3300053079 Bacteria 1430
202 Ga0500643_017389 3300053087 Bacteria 2409
203 Ga0500658_0000136 3300053134 Bacteria 34704
204 Ga0500559_0009600 3300053136 Bacteria 4179
205 Ga0500559_0009861 3300053136 Bacteria 4119
206 Ga0500559_0208823 3300053136 Bacteria 921
207 Ga0500624_000120 3300053157 Bacteria 35695
208 Ga0500636_0002564 3300053177 Bacteria 10104
209 Ga0500637_0000076 3300053178 Bacteria 35528
210 Ga0500565_008125 3300053734 Bacteria 1013
211 Ga0466962_0001765 3300061719 Bacteria 10161
212 2510892403 2510461076 Bacteria 8618824
213 2513675339 2513237098 Bacteria 9902361
214 2513857756 2513237137 Bacteria 9558895
215 2513869024 2513237138 Bacteria 7368160
216 2513910828 2513237144 Bacteria 7530820
217 2513919293 2513237145 Bacteria 8979722
218 2517098081 2517093000 Bacteria 7412387
219 2517891015 2517572143 Bacteria 9484767
220 2585844324 2585427594 Bacteria 6180594
221 2599719519 2599185236 Bacteria 6875203
222 2643814304 2643221558 Bacteria 5460675
223 2644088463 2643221614 Bacteria 4260023
224 2644343699 2643221661 Bacteria 4267604
225 2644368823 2643221666 Bacteria 4265935
226 2644498513 2643221689 Bacteria 6042950
227 2671120068 2667528175 Bacteria 7532676
228 2838662198 2838661181 Bacteria 7385261
229 2838662487 2838661181 Bacteria 7385261
230 2852394355 2852387548 Bacteria 8025568
231 2903774479 2903768456 Bacteria 9749579
232 2933018812 2933016740 Bacteria 6355406
233 2933575537 2933570622 Bacteria 7023390
234 2935635349 2935630451 Bacteria 8169952
235 2941512153 2941507105 Bacteria 8166816
236 2941519855 2941515067 Bacteria 8166720
237 2941527858 2941523033 Bacteria 8169134
238 3005481751 3005474847 Bacteria 9259049
239 8054306214 8054302542 Bacteria 5698134
240 8054464363 8054460903 Bacteria 4872905
241 8054567089 8054563764 Bacteria 5592885
242 Ga0070689_100368574
243 MRS1b_contig_6837346
244 CNXas_1000036
245 rootL2_10020812
246 Ga0055536_1011710
247 Ga0055540_1000179
248 Ga0055540_1000210
249 Ga0055540_1004339
250 JGI25405J52794_10001008
251 JGI25405J52794_10014651
252 Ga0065712_10094466
253 Ga0065715_10008058
254 Ga0070658_10000559
255 Ga0070683_100097804
256 Ga0070690_100036783
257 Ga0070666_10179096
258 Ga0070680_100024028
259 Ga0070660_100462546
260 Ga0070689_100245758
261 Ga0070661_100175139
262 Ga0070675_100042817
263 Ga0070671_100019655
264 Ga0070673_100006671
265 Ga0070659_100136708
266 Ga0070714_100529762
267 Ga0070713_100321682
268 Ga0070710_10365410
269 Ga0070678_100103888
270 Ga0070662_100031032
271 Ga0070662_100529003
272 Ga0070681_10020689
273 Ga0070679_100099875
274 Ga0070684_100010061
275 Ga0068856_100136597
276 Ga0068864_100188827
277 Ga0068858_100048769
278 Ga0081455_10005923
279 Ga0081455_10016419
280 Ga0075364_10354585
281 Ga0070712_100319593
282 Ga0097621_100041215
283 Ga0099824_1025655
284 Ga0099822_1000663
285 Ga0099795_10131424
286 Ga0111539_10990836
287 Ga0105241_10031913
288 Ga0105237_10543354
289 Ga0105237_10740450
290 Ga0105249_10781565
291 Ga0099796_10019591
292 Ga0157371_10342917
293 Ga0157369_10038588
294 Ga0157374_10238121
295 Ga0157372_10054051
296 Ga0157372_10122298
297 Ga0157375_10267674
298 Ga0157380_10007835
299 Ga0157376_10007190
300 Ga0207673_1002225
301 Ga0209676_1000065
302 Ga0209676_1024300
303 Ga0209758_1001136
304 Ga0209050_1022822
305 Ga0209051_1000032
306 Ga0209051_1000151
307 Ga0209257_1000810
308 Ga0209257_1007710
309 Ga0207697_10001151
310 Ga0207680_10088625
311 Ga0207671_10466164
312 Ga0207693_10409972
313 Ga0207649_10109545
314 Ga0207652_10108784
315 Ga0207659_10030924
316 Ga0207664_10613209
317 Ga0207644_10008353
318 Ga0207644_10012728
319 Ga0207644_10355013
320 Ga0207706_10038826
321 Ga0207706_10126758
322 Ga0207670_10274095
323 Ga0207670_10301784
324 Ga0207711_10003996
325 Ga0207661_10068905
326 Ga0207679_10296529
327 Ga0207668_10078412
328 Ga0207702_10121052
329 Ga0207641_10223562
330 Ga0207676_10765245
331 Ga0209589_1000006
332 Ga0209489_100007
333 Ga0209700_100008
334 Ga0268266_10144190
335 Ga0268264_10469585
336 Ga0307513_10226129
337 Ga0307408_100410546
338 Ga0307516_10000325
339 Ga0307405_10441454
340 Ga0307413_10240479
341 Ga0307406_10092473
342 Ga0307411_10160649
343 Ga0307415_100174888
344 Ga0373943_0031627
345 Ga0373935_0257129
346 Ga0373947_0343695
347 Ga0395900_0341401
348 Ga0436364_0865906
349 Ga0395901_0105777
350 Ga0439436_0039028
351 Ga0439439_0055919
352 Ga0439461_0000022
353 Ga0439465_0000135
354 Ga0439465_0006494
355 Ga0439465_0078739
356 Ga0451837_0354990
357 Ga0451849_0988696
358 Ga0451851_0521310
359 Ga0451843_1309127
360 Ga0451853_1124804
361 Ga0439431_0000203
362 Ga0439442_003715
363 Ga0439445_0000434
364 Ga0439448_0002602
365 Ga0439432_000279
366 Ga0439452_026189
367 Ga0439452_027516
368 Ga0439455_0000552
369 Ga0439462_0012258
370 Ga0439434_0002684
371 Ga0466961_0208953
372 Ga0466963_0001201
373 Ga0466964_0034033
374 Ga0466971_0000302
375 Ga0466957_0006295
376 Ga0466958_0012801
377 Ga0466967_0000642
378 Ga0495638_0000528
379 Ga0495638_0000960
380 Ga0495653_0099947
381 Ga0495585_0029205
382 Ga0495585_0292170
383 Ga0495594_0297292
384 Ga0495596_0000042
385 Ga0495607_0001285
386 Ga0495607_0028622
387 Ga0495607_0104659
388 Ga0495620_0027729
389 Ga0495620_0164654
390 Ga0495628_0131365
391 Ga0495630_0012452
392 Ga0495632_0000397
393 Ga0495632_0093475
394 Ga0495643_0005928
395 Ga0495648_0135035
396 Ga0495609_0013383
397 Ga0495645_0056493
398 Ga0495633_0072864
399 Ga0495668_0021467
400 Ga0495668_0080661
401 Ga0495634_0050960
402 Ga0495625_0066635
403 Ga0495625_0189168
404 Ga0495635_0230285
405 Ga0495661_0000673
406 Ga0495661_0013772
407 Ga0495670_0000005
408 Ga0495671_0015129
409 Ga0495674_0141755
410 Ga0495683_0177251
411 Ga0495677_0000332
412 Ga0495684_0015917
413 Ga0495686_0000054
414 Ga0495686_0183774
415 Ga0495615_0000331
416 Ga0496102_0739804
417 Ga0496103_0037283
418 Ga0496104_0198140
419 Ga0496104_0840418
420 Ga0496105_0009161
421 Ga0496109_0311150
422 Ga0496110_0399051
423 Ga0496113_0782899
424 Ga0496115_0040084
425 Ga0496115_0567055
426 Ga0496116_0099176
427 Ga0496117_0027451
428 Ga0496118_0031953
429 Ga0496119_0045660
430 Ga0496120_0098644
431 Ga0496121_0015697
432 Ga0496122_0193714
433 Ga0496125_0023227
434 Ga0496126_0240021
435 Ga0501034_0646917
436 Ga0501037_0594702
437 Ga0501047_0001107
438 Ga0501238_000519
439 Ga0501080_0007192
440 Ga0501035_0036867
441 Ga0495601_0252106
442 Ga0500610_0108519
443 Ga0500643_017389
444 Ga0500658_0000136
445 Ga0500559_0009600
446 Ga0500559_0009861
447 Ga0500559_0208823
448 Ga0500624_000120
449 Ga0500636_0002564
450 Ga0500637_0000076
451 Ga0500565_008125
452 Ga0466962_0001765
453 2510892403
454 2513675339
455 2513857756
456 2513869024
457 2513910828
458 2513919293
459 2517098081
460 2517891015
461 2585844324
462 2599719519
463 2643814304
464 2644088463
465 2644343699
466 2644368823
467 2644498513
468 2671120068
469 2838662198
470 2838662487
471 2852394355
472 2903774479
473 2933018812
474 2933575537
475 2935635349
476 2941512153
477 2941519855
478 2941527858
479 3005481751
480 8054306214
481 8054464363
482 8054567089

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

146

234

0.97

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

78

146

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.7601 69 220
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.7582 69 220
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.7531 71 220
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.7495 70 220
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.7485 69 219
ID Description Score Start End Superfamily
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9247 147 220 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9174 146 220 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9079 146 220 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.903 147 220 1.10.150.120
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8904 146 218 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A2M7J781-F1-model_v4 (2Fe-2S)-binding protein 0.768 70 221 GO:0016491
GO:0046872
GO:0051537
AF-A0A562ZQK9-F1-model_v4 (2Fe-2S)-binding protein 0.7674 69 220 GO:0016491
GO:0046872
GO:0051537
AF-A0A1H3E3I5-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.7668 69 220 GO:0016491
GO:0046872
GO:0051537
AF-A0A432IZA0-F1-model_v4 (2Fe-2S)-binding protein 0.7666 69 220 GO:0016491
GO:0046872
GO:0051537
AF-L1QLL2-F1-model_v4 2Fe-2S iron-sulfur cluster-binding domain protein 0.7663 68 221 GO:0004854
GO:0006144
GO:0046872
GO:0051537

Map