F353495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 241 | 208 | 482 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100368574|Ga0070689_1003685741 |
| Length | 241 |
| Sequence | MNTDENFPENPPPNDEALLKKRGEPVEIRSNRREFIAQVGGCAAGVLALQVWQQQQLLGQVSPAPAFTAAGRMMKVSFTVNGKRCELEIDTRTTLLDALREHLHLTGSKKGCDQGQCGACTVMVGGRRVVSCLTLAVMHEGDEITTIEGLGTPEKLHPMQAAFVKHDGFQCGYCTPGQICSAVAMLRELKAGIPSHATADLTAVPQLTSDELRERMSGNICRCGAYSNIAEAITEVAGGTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 37 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 38 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 76 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 77 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 78 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 81 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 82 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 83 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 87 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 88 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 95 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 96 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 97 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 98 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 99 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 100 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 101 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 102 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 103 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 104 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 105 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 106 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 107 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 108 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 109 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 110 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 111 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 112 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 113 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 114 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 115 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 157 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 172 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 173 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 174 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 175 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 176 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 178 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 179 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 180 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 181 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 182 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 183 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 184 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 185 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 186 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 187 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 188 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 189 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 190 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 191 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 192 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 193 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 194 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 195 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 196 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 197 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 198 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 199 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 200 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 201 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 202 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 203 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 204 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 205 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 206 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 207 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 208 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.55 |
| Metatranscriptomes | 0 |
| Isolates | 12.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.54 |
| Nodule | 9.13 |
| Rhizoplane | 4.98 |
| Rhizosphere | 65.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070689_100368574 | 3300005340 | Bacteria | 1208 |
| 2 | MRS1b_contig_6837346 | 2162886011 | Bacteria | 1033 |
| 3 | CNXas_1000036 | 3300000545 | Bacteria | 28421 |
| 4 | rootL2_10020812 | 3300003322 | Bacteria | 11716 |
| 5 | Ga0055536_1011710 | 3300003781 | Bacteria | 3328 |
| 6 | Ga0055540_1000179 | 3300003792 | Bacteria | 62199 |
| 7 | Ga0055540_1000210 | 3300003792 | Bacteria | 55346 |
| 8 | Ga0055540_1004339 | 3300003792 | Bacteria | 6446 |
| 9 | JGI25405J52794_10001008 | 3300003911 | Bacteria | 4464 |
| 10 | JGI25405J52794_10014651 | 3300003911 | Bacteria | 1534 |
| 11 | Ga0065712_10094466 | 3300005290 | Bacteria | 2252 |
| 12 | Ga0065715_10008058 | 3300005293 | Bacteria | 3415 |
| 13 | Ga0070658_10000559 | 3300005327 | Bacteria | 32249 |
| 14 | Ga0070683_100097804 | 3300005329 | Bacteria | 2761 |
| 15 | Ga0070690_100036783 | 3300005330 | Bacteria | 3080 |
| 16 | Ga0070666_10179096 | 3300005335 | Bacteria | 1486 |
| 17 | Ga0070680_100024028 | 3300005336 | Bacteria | 4865 |
| 18 | Ga0070660_100462546 | 3300005339 | Bacteria | 1053 |
| 19 | Ga0070689_100245758 | 3300005340 | Bacteria | 1475 |
| 20 | Ga0070661_100175139 | 3300005344 | Bacteria | 1630 |
| 21 | Ga0070675_100042817 | 3300005354 | Bacteria | 3700 |
| 22 | Ga0070671_100019655 | 3300005355 | Bacteria | 5500 |
| 23 | Ga0070673_100006671 | 3300005364 | Bacteria | 7526 |
| 24 | Ga0070659_100136708 | 3300005366 | Bacteria | 1993 |
| 25 | Ga0070714_100529762 | 3300005435 | Bacteria | 1126 |
| 26 | Ga0070713_100321682 | 3300005436 | Bacteria | 1429 |
| 27 | Ga0070710_10365410 | 3300005437 | Bacteria | 959 |
| 28 | Ga0070678_100103888 | 3300005456 | Bacteria | 2208 |
| 29 | Ga0070662_100031032 | 3300005457 | Bacteria | 3746 |
| 30 | Ga0070662_100529003 | 3300005457 | Bacteria | 986 |
| 31 | Ga0070681_10020689 | 3300005458 | Bacteria | 6592 |
| 32 | Ga0070679_100099875 | 3300005530 | Bacteria | 2889 |
| 33 | Ga0070684_100010061 | 3300005535 | Bacteria | 7477 |
| 34 | Ga0068856_100136597 | 3300005614 | Bacteria | 2457 |
| 35 | Ga0068864_100188827 | 3300005618 | Bacteria | 1888 |
| 36 | Ga0068858_100048769 | 3300005842 | Bacteria | 3922 |
| 37 | Ga0081455_10005923 | 3300005937 | Bacteria | 13267 |
| 38 | Ga0081455_10016419 | 3300005937 | Bacteria | 7150 |
| 39 | Ga0075364_10354585 | 3300006051 | Bacteria | 1000 |
| 40 | Ga0070712_100319593 | 3300006175 | Bacteria | 1262 |
| 41 | Ga0097621_100041215 | 3300006237 | Bacteria | 3716 |
| 42 | Ga0099824_1025655 | 3300006942 | Bacteria | 3182 |
| 43 | Ga0099822_1000663 | 3300006943 | Bacteria | 34548 |
| 44 | Ga0099795_10131424 | 3300007788 | Bacteria | 1010 |
| 45 | Ga0111539_10990836 | 3300009094 | Bacteria | 977 |
| 46 | Ga0105241_10031913 | 3300009174 | Bacteria | 3945 |
| 47 | Ga0105237_10543354 | 3300009545 | Bacteria | 1169 |
| 48 | Ga0105237_10740450 | 3300009545 | Bacteria | 989 |
| 49 | Ga0105249_10781565 | 3300009553 | Bacteria | 1018 |
| 50 | Ga0099796_10019591 | 3300010159 | Bacteria | 2054 |
| 51 | Ga0157371_10342917 | 3300013102 | Bacteria | 1087 |
| 52 | Ga0157369_10038588 | 3300013105 | Bacteria | 5223 |
| 53 | Ga0157374_10238121 | 3300013296 | Bacteria | 1789 |
| 54 | Ga0157372_10054051 | 3300013307 | Bacteria | 4478 |
| 55 | Ga0157372_10122298 | 3300013307 | Bacteria | 2991 |
| 56 | Ga0157375_10267674 | 3300013308 | Bacteria | 1871 |
| 57 | Ga0157380_10007835 | 3300014326 | Bacteria | 7602 |
| 58 | Ga0157376_10007190 | 3300014969 | Bacteria | 7914 |
| 59 | Ga0207673_1002225 | 3300025290 | Bacteria | 2192 |
| 60 | Ga0209676_1000065 | 3300025292 | Bacteria | 318605 |
| 61 | Ga0209676_1024300 | 3300025292 | Bacteria | 1967 |
| 62 | Ga0209758_1001136 | 3300025297 | Bacteria | 34152 |
| 63 | Ga0209050_1022822 | 3300025298 | Bacteria | 2228 |
| 64 | Ga0209051_1000032 | 3300025303 | Bacteria | 383445 |
| 65 | Ga0209051_1000151 | 3300025303 | Bacteria | 131835 |
| 66 | Ga0209257_1000810 | 3300025304 | Bacteria | 45391 |
| 67 | Ga0209257_1007710 | 3300025304 | Bacteria | 6417 |
| 68 | Ga0207697_10001151 | 3300025315 | Bacteria | 14539 |
| 69 | Ga0207680_10088625 | 3300025903 | Bacteria | 1962 |
| 70 | Ga0207671_10466164 | 3300025914 | Bacteria | 1006 |
| 71 | Ga0207693_10409972 | 3300025915 | Bacteria | 1059 |
| 72 | Ga0207649_10109545 | 3300025920 | Bacteria | 1843 |
| 73 | Ga0207652_10108784 | 3300025921 | Bacteria | 2457 |
| 74 | Ga0207659_10030924 | 3300025926 | Bacteria | 3661 |
| 75 | Ga0207664_10613209 | 3300025929 | Bacteria | 977 |
| 76 | Ga0207644_10008353 | 3300025931 | Bacteria | 6779 |
| 77 | Ga0207644_10012728 | 3300025931 | Bacteria | 5593 |
| 78 | Ga0207644_10355013 | 3300025931 | Bacteria | 1191 |
| 79 | Ga0207706_10038826 | 3300025933 | Bacteria | 4223 |
| 80 | Ga0207706_10126758 | 3300025933 | Bacteria | 2245 |
| 81 | Ga0207670_10274095 | 3300025936 | Bacteria | 1313 |
| 82 | Ga0207670_10301784 | 3300025936 | Bacteria | 1254 |
| 83 | Ga0207711_10003996 | 3300025941 | Bacteria | 12662 |
| 84 | Ga0207661_10068905 | 3300025944 | Bacteria | 2882 |
| 85 | Ga0207679_10296529 | 3300025945 | Bacteria | 1392 |
| 86 | Ga0207668_10078412 | 3300025972 | Bacteria | 2385 |
| 87 | Ga0207702_10121052 | 3300026078 | Bacteria | 2342 |
| 88 | Ga0207641_10223562 | 3300026088 | Bacteria | 1747 |
| 89 | Ga0207676_10765245 | 3300026095 | Bacteria | 940 |
| 90 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 91 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 92 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 93 | Ga0268266_10144190 | 3300028379 | Bacteria | 2139 |
| 94 | Ga0268264_10469585 | 3300028381 | Bacteria | 1222 |
| 95 | Ga0307513_10226129 | 3300031456 | Bacteria | 1688 |
| 96 | Ga0307408_100410546 | 3300031548 | Bacteria | 1165 |
| 97 | Ga0307516_10000325 | 3300031730 | Bacteria | 61945 |
| 98 | Ga0307405_10441454 | 3300031731 | Bacteria | 1029 |
| 99 | Ga0307413_10240479 | 3300031824 | Bacteria | 1336 |
| 100 | Ga0307406_10092473 | 3300031901 | Bacteria | 2040 |
| 101 | Ga0307411_10160649 | 3300032005 | Bacteria | 1682 |
| 102 | Ga0307415_100174888 | 3300032126 | Bacteria | 1678 |
| 103 | Ga0373943_0031627 | 3300035170 | Bacteria | 2512 |
| 104 | Ga0373935_0257129 | 3300035692 | Bacteria | 1224 |
| 105 | Ga0373947_0343695 | 3300035725 | Bacteria | 1000 |
| 106 | Ga0395900_0341401 | 3300037418 | Bacteria | 1473 |
| 107 | Ga0436364_0865906 | 3300037853 | Bacteria | 5091 |
| 108 | Ga0395901_0105777 | 3300038443 | Bacteria | 2954 |
| 109 | Ga0439436_0039028 | 3300041404 | Bacteria | 1364 |
| 110 | Ga0439439_0055919 | 3300041406 | Bacteria | 1042 |
| 111 | Ga0439461_0000022 | 3300041410 | Bacteria | 20065 |
| 112 | Ga0439465_0000135 | 3300041413 | Bacteria | 18045 |
| 113 | Ga0439465_0006494 | 3300041413 | Bacteria | 3717 |
| 114 | Ga0439465_0078739 | 3300041413 | Bacteria | 1114 |
| 115 | Ga0451837_0354990 | 3300041494 | Bacteria | 1686 |
| 116 | Ga0451849_0988696 | 3300041505 | Bacteria | 2189 |
| 117 | Ga0451851_0521310 | 3300041507 | Bacteria | 2055 |
| 118 | Ga0451843_1309127 | 3300041509 | Bacteria | 1805 |
| 119 | Ga0451853_1124804 | 3300041512 | Bacteria | 3921 |
| 120 | Ga0439431_0000203 | 3300041997 | Bacteria | 11734 |
| 121 | Ga0439442_003715 | 3300042002 | Bacteria | 3023 |
| 122 | Ga0439445_0000434 | 3300042004 | Bacteria | 8437 |
| 123 | Ga0439448_0002602 | 3300042005 | Bacteria | 4917 |
| 124 | Ga0439432_000279 | 3300042006 | Bacteria | 18441 |
| 125 | Ga0439452_026189 | 3300042010 | Bacteria | 1474 |
| 126 | Ga0439452_027516 | 3300042010 | Bacteria | 1427 |
| 127 | Ga0439455_0000552 | 3300042012 | Bacteria | 5301 |
| 128 | Ga0439462_0012258 | 3300042015 | Bacteria | 2189 |
| 129 | Ga0439434_0002684 | 3300042435 | Bacteria | 5184 |
| 130 | Ga0466961_0208953 | 3300044693 | Bacteria | 1205 |
| 131 | Ga0466963_0001201 | 3300044694 | Bacteria | 13635 |
| 132 | Ga0466964_0034033 | 3300044706 | Bacteria | 2032 |
| 133 | Ga0466971_0000302 | 3300044719 | Bacteria | 18980 |
| 134 | Ga0466957_0006295 | 3300044842 | Bacteria | 6699 |
| 135 | Ga0466958_0012801 | 3300045836 | Bacteria | 4760 |
| 136 | Ga0466967_0000642 | 3300045976 | Bacteria | 17574 |
| 137 | Ga0495638_0000528 | 3300046460 | Bacteria | 44566 |
| 138 | Ga0495638_0000960 | 3300046460 | Bacteria | 29237 |
| 139 | Ga0495653_0099947 | 3300046463 | Bacteria | 2104 |
| 140 | Ga0495585_0029205 | 3300046492 | Bacteria | 3140 |
| 141 | Ga0495585_0292170 | 3300046492 | Bacteria | 803 |
| 142 | Ga0495594_0297292 | 3300046499 | Bacteria | 920 |
| 143 | Ga0495596_0000042 | 3300046500 | Bacteria | 90746 |
| 144 | Ga0495607_0001285 | 3300046501 | Bacteria | 22459 |
| 145 | Ga0495607_0028622 | 3300046501 | Bacteria | 3437 |
| 146 | Ga0495607_0104659 | 3300046501 | Bacteria | 1510 |
| 147 | Ga0495620_0027729 | 3300046515 | Bacteria | 2646 |
| 148 | Ga0495620_0164654 | 3300046515 | Bacteria | 861 |
| 149 | Ga0495628_0131365 | 3300046516 | Bacteria | 1915 |
| 150 | Ga0495630_0012452 | 3300046517 | Bacteria | 6175 |
| 151 | Ga0495632_0000397 | 3300046519 | Bacteria | 40939 |
| 152 | Ga0495632_0093475 | 3300046519 | Bacteria | 1423 |
| 153 | Ga0495643_0005928 | 3300046522 | Bacteria | 8156 |
| 154 | Ga0495648_0135035 | 3300046524 | Bacteria | 1306 |
| 155 | Ga0495609_0013383 | 3300046538 | Bacteria | 3876 |
| 156 | Ga0495645_0056493 | 3300046543 | Bacteria | 2850 |
| 157 | Ga0495633_0072864 | 3300046558 | Bacteria | 1601 |
| 158 | Ga0495668_0021467 | 3300046616 | Bacteria | 3702 |
| 159 | Ga0495668_0080661 | 3300046616 | Bacteria | 1786 |
| 160 | Ga0495634_0050960 | 3300046642 | Bacteria | 2778 |
| 161 | Ga0495625_0066635 | 3300046660 | Bacteria | 2536 |
| 162 | Ga0495625_0189168 | 3300046660 | Bacteria | 1365 |
| 163 | Ga0495635_0230285 | 3300046663 | Bacteria | 1252 |
| 164 | Ga0495661_0000673 | 3300046665 | Bacteria | 34125 |
| 165 | Ga0495661_0013772 | 3300046665 | Bacteria | 5426 |
| 166 | Ga0495670_0000005 | 3300046691 | Bacteria | 289725 |
| 167 | Ga0495671_0015129 | 3300046692 | Bacteria | 4141 |
| 168 | Ga0495674_0141755 | 3300047319 | Bacteria | 2020 |
| 169 | Ga0495683_0177251 | 3300047323 | Bacteria | 976 |
| 170 | Ga0495677_0000332 | 3300047445 | Bacteria | 20349 |
| 171 | Ga0495684_0015917 | 3300047471 | Bacteria | 5791 |
| 172 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 173 | Ga0495686_0183774 | 3300047472 | Bacteria | 1210 |
| 174 | Ga0495615_0000331 | 3300048090 | Bacteria | 7858 |
| 175 | Ga0496102_0739804 | 3300048905 | Bacteria | 906 |
| 176 | Ga0496103_0037283 | 3300048906 | Bacteria | 2978 |
| 177 | Ga0496104_0198140 | 3300048907 | Bacteria | 1920 |
| 178 | Ga0496104_0840418 | 3300048907 | Bacteria | 824 |
| 179 | Ga0496105_0009161 | 3300048908 | Bacteria | 7725 |
| 180 | Ga0496109_0311150 | 3300048912 | Bacteria | 1486 |
| 181 | Ga0496110_0399051 | 3300048913 | Bacteria | 1254 |
| 182 | Ga0496113_0782899 | 3300048916 | Bacteria | 758 |
| 183 | Ga0496115_0040084 | 3300048918 | Bacteria | 3722 |
| 184 | Ga0496115_0567055 | 3300048918 | Bacteria | 906 |
| 185 | Ga0496116_0099176 | 3300048919 | Bacteria | 1745 |
| 186 | Ga0496117_0027451 | 3300048920 | Bacteria | 4436 |
| 187 | Ga0496118_0031953 | 3300048921 | Bacteria | 4348 |
| 188 | Ga0496119_0045660 | 3300048922 | Bacteria | 2744 |
| 189 | Ga0496120_0098644 | 3300048923 | Bacteria | 1548 |
| 190 | Ga0496121_0015697 | 3300048924 | Bacteria | 7898 |
| 191 | Ga0496122_0193714 | 3300048925 | Bacteria | 1197 |
| 192 | Ga0496125_0023227 | 3300048928 | Bacteria | 5729 |
| 193 | Ga0496126_0240021 | 3300048929 | Bacteria | 1514 |
| 194 | Ga0501034_0646917 | 3300049571 | Bacteria | 959 |
| 195 | Ga0501037_0594702 | 3300049573 | Bacteria | 743 |
| 196 | Ga0501047_0001107 | 3300049581 | Bacteria | 26758 |
| 197 | Ga0501238_000519 | 3300049671 | Bacteria | 4405 |
| 198 | Ga0501080_0007192 | 3300049742 | Bacteria | 10046 |
| 199 | Ga0501035_0036867 | 3300049822 | Bacteria | 4430 |
| 200 | Ga0495601_0252106 | 3300053077 | Bacteria | 1153 |
| 201 | Ga0500610_0108519 | 3300053079 | Bacteria | 1430 |
| 202 | Ga0500643_017389 | 3300053087 | Bacteria | 2409 |
| 203 | Ga0500658_0000136 | 3300053134 | Bacteria | 34704 |
| 204 | Ga0500559_0009600 | 3300053136 | Bacteria | 4179 |
| 205 | Ga0500559_0009861 | 3300053136 | Bacteria | 4119 |
| 206 | Ga0500559_0208823 | 3300053136 | Bacteria | 921 |
| 207 | Ga0500624_000120 | 3300053157 | Bacteria | 35695 |
| 208 | Ga0500636_0002564 | 3300053177 | Bacteria | 10104 |
| 209 | Ga0500637_0000076 | 3300053178 | Bacteria | 35528 |
| 210 | Ga0500565_008125 | 3300053734 | Bacteria | 1013 |
| 211 | Ga0466962_0001765 | 3300061719 | Bacteria | 10161 |
| 212 | 2510892403 | 2510461076 | Bacteria | 8618824 |
| 213 | 2513675339 | 2513237098 | Bacteria | 9902361 |
| 214 | 2513857756 | 2513237137 | Bacteria | 9558895 |
| 215 | 2513869024 | 2513237138 | Bacteria | 7368160 |
| 216 | 2513910828 | 2513237144 | Bacteria | 7530820 |
| 217 | 2513919293 | 2513237145 | Bacteria | 8979722 |
| 218 | 2517098081 | 2517093000 | Bacteria | 7412387 |
| 219 | 2517891015 | 2517572143 | Bacteria | 9484767 |
| 220 | 2585844324 | 2585427594 | Bacteria | 6180594 |
| 221 | 2599719519 | 2599185236 | Bacteria | 6875203 |
| 222 | 2643814304 | 2643221558 | Bacteria | 5460675 |
| 223 | 2644088463 | 2643221614 | Bacteria | 4260023 |
| 224 | 2644343699 | 2643221661 | Bacteria | 4267604 |
| 225 | 2644368823 | 2643221666 | Bacteria | 4265935 |
| 226 | 2644498513 | 2643221689 | Bacteria | 6042950 |
| 227 | 2671120068 | 2667528175 | Bacteria | 7532676 |
| 228 | 2838662198 | 2838661181 | Bacteria | 7385261 |
| 229 | 2838662487 | 2838661181 | Bacteria | 7385261 |
| 230 | 2852394355 | 2852387548 | Bacteria | 8025568 |
| 231 | 2903774479 | 2903768456 | Bacteria | 9749579 |
| 232 | 2933018812 | 2933016740 | Bacteria | 6355406 |
| 233 | 2933575537 | 2933570622 | Bacteria | 7023390 |
| 234 | 2935635349 | 2935630451 | Bacteria | 8169952 |
| 235 | 2941512153 | 2941507105 | Bacteria | 8166816 |
| 236 | 2941519855 | 2941515067 | Bacteria | 8166720 |
| 237 | 2941527858 | 2941523033 | Bacteria | 8169134 |
| 238 | 3005481751 | 3005474847 | Bacteria | 9259049 |
| 239 | 8054306214 | 8054302542 | Bacteria | 5698134 |
| 240 | 8054464363 | 8054460903 | Bacteria | 4872905 |
| 241 | 8054567089 | 8054563764 | Bacteria | 5592885 |
| 242 | Ga0070689_100368574 | |||
| 243 | MRS1b_contig_6837346 | |||
| 244 | CNXas_1000036 | |||
| 245 | rootL2_10020812 | |||
| 246 | Ga0055536_1011710 | |||
| 247 | Ga0055540_1000179 | |||
| 248 | Ga0055540_1000210 | |||
| 249 | Ga0055540_1004339 | |||
| 250 | JGI25405J52794_10001008 | |||
| 251 | JGI25405J52794_10014651 | |||
| 252 | Ga0065712_10094466 | |||
| 253 | Ga0065715_10008058 | |||
| 254 | Ga0070658_10000559 | |||
| 255 | Ga0070683_100097804 | |||
| 256 | Ga0070690_100036783 | |||
| 257 | Ga0070666_10179096 | |||
| 258 | Ga0070680_100024028 | |||
| 259 | Ga0070660_100462546 | |||
| 260 | Ga0070689_100245758 | |||
| 261 | Ga0070661_100175139 | |||
| 262 | Ga0070675_100042817 | |||
| 263 | Ga0070671_100019655 | |||
| 264 | Ga0070673_100006671 | |||
| 265 | Ga0070659_100136708 | |||
| 266 | Ga0070714_100529762 | |||
| 267 | Ga0070713_100321682 | |||
| 268 | Ga0070710_10365410 | |||
| 269 | Ga0070678_100103888 | |||
| 270 | Ga0070662_100031032 | |||
| 271 | Ga0070662_100529003 | |||
| 272 | Ga0070681_10020689 | |||
| 273 | Ga0070679_100099875 | |||
| 274 | Ga0070684_100010061 | |||
| 275 | Ga0068856_100136597 | |||
| 276 | Ga0068864_100188827 | |||
| 277 | Ga0068858_100048769 | |||
| 278 | Ga0081455_10005923 | |||
| 279 | Ga0081455_10016419 | |||
| 280 | Ga0075364_10354585 | |||
| 281 | Ga0070712_100319593 | |||
| 282 | Ga0097621_100041215 | |||
| 283 | Ga0099824_1025655 | |||
| 284 | Ga0099822_1000663 | |||
| 285 | Ga0099795_10131424 | |||
| 286 | Ga0111539_10990836 | |||
| 287 | Ga0105241_10031913 | |||
| 288 | Ga0105237_10543354 | |||
| 289 | Ga0105237_10740450 | |||
| 290 | Ga0105249_10781565 | |||
| 291 | Ga0099796_10019591 | |||
| 292 | Ga0157371_10342917 | |||
| 293 | Ga0157369_10038588 | |||
| 294 | Ga0157374_10238121 | |||
| 295 | Ga0157372_10054051 | |||
| 296 | Ga0157372_10122298 | |||
| 297 | Ga0157375_10267674 | |||
| 298 | Ga0157380_10007835 | |||
| 299 | Ga0157376_10007190 | |||
| 300 | Ga0207673_1002225 | |||
| 301 | Ga0209676_1000065 | |||
| 302 | Ga0209676_1024300 | |||
| 303 | Ga0209758_1001136 | |||
| 304 | Ga0209050_1022822 | |||
| 305 | Ga0209051_1000032 | |||
| 306 | Ga0209051_1000151 | |||
| 307 | Ga0209257_1000810 | |||
| 308 | Ga0209257_1007710 | |||
| 309 | Ga0207697_10001151 | |||
| 310 | Ga0207680_10088625 | |||
| 311 | Ga0207671_10466164 | |||
| 312 | Ga0207693_10409972 | |||
| 313 | Ga0207649_10109545 | |||
| 314 | Ga0207652_10108784 | |||
| 315 | Ga0207659_10030924 | |||
| 316 | Ga0207664_10613209 | |||
| 317 | Ga0207644_10008353 | |||
| 318 | Ga0207644_10012728 | |||
| 319 | Ga0207644_10355013 | |||
| 320 | Ga0207706_10038826 | |||
| 321 | Ga0207706_10126758 | |||
| 322 | Ga0207670_10274095 | |||
| 323 | Ga0207670_10301784 | |||
| 324 | Ga0207711_10003996 | |||
| 325 | Ga0207661_10068905 | |||
| 326 | Ga0207679_10296529 | |||
| 327 | Ga0207668_10078412 | |||
| 328 | Ga0207702_10121052 | |||
| 329 | Ga0207641_10223562 | |||
| 330 | Ga0207676_10765245 | |||
| 331 | Ga0209589_1000006 | |||
| 332 | Ga0209489_100007 | |||
| 333 | Ga0209700_100008 | |||
| 334 | Ga0268266_10144190 | |||
| 335 | Ga0268264_10469585 | |||
| 336 | Ga0307513_10226129 | |||
| 337 | Ga0307408_100410546 | |||
| 338 | Ga0307516_10000325 | |||
| 339 | Ga0307405_10441454 | |||
| 340 | Ga0307413_10240479 | |||
| 341 | Ga0307406_10092473 | |||
| 342 | Ga0307411_10160649 | |||
| 343 | Ga0307415_100174888 | |||
| 344 | Ga0373943_0031627 | |||
| 345 | Ga0373935_0257129 | |||
| 346 | Ga0373947_0343695 | |||
| 347 | Ga0395900_0341401 | |||
| 348 | Ga0436364_0865906 | |||
| 349 | Ga0395901_0105777 | |||
| 350 | Ga0439436_0039028 | |||
| 351 | Ga0439439_0055919 | |||
| 352 | Ga0439461_0000022 | |||
| 353 | Ga0439465_0000135 | |||
| 354 | Ga0439465_0006494 | |||
| 355 | Ga0439465_0078739 | |||
| 356 | Ga0451837_0354990 | |||
| 357 | Ga0451849_0988696 | |||
| 358 | Ga0451851_0521310 | |||
| 359 | Ga0451843_1309127 | |||
| 360 | Ga0451853_1124804 | |||
| 361 | Ga0439431_0000203 | |||
| 362 | Ga0439442_003715 | |||
| 363 | Ga0439445_0000434 | |||
| 364 | Ga0439448_0002602 | |||
| 365 | Ga0439432_000279 | |||
| 366 | Ga0439452_026189 | |||
| 367 | Ga0439452_027516 | |||
| 368 | Ga0439455_0000552 | |||
| 369 | Ga0439462_0012258 | |||
| 370 | Ga0439434_0002684 | |||
| 371 | Ga0466961_0208953 | |||
| 372 | Ga0466963_0001201 | |||
| 373 | Ga0466964_0034033 | |||
| 374 | Ga0466971_0000302 | |||
| 375 | Ga0466957_0006295 | |||
| 376 | Ga0466958_0012801 | |||
| 377 | Ga0466967_0000642 | |||
| 378 | Ga0495638_0000528 | |||
| 379 | Ga0495638_0000960 | |||
| 380 | Ga0495653_0099947 | |||
| 381 | Ga0495585_0029205 | |||
| 382 | Ga0495585_0292170 | |||
| 383 | Ga0495594_0297292 | |||
| 384 | Ga0495596_0000042 | |||
| 385 | Ga0495607_0001285 | |||
| 386 | Ga0495607_0028622 | |||
| 387 | Ga0495607_0104659 | |||
| 388 | Ga0495620_0027729 | |||
| 389 | Ga0495620_0164654 | |||
| 390 | Ga0495628_0131365 | |||
| 391 | Ga0495630_0012452 | |||
| 392 | Ga0495632_0000397 | |||
| 393 | Ga0495632_0093475 | |||
| 394 | Ga0495643_0005928 | |||
| 395 | Ga0495648_0135035 | |||
| 396 | Ga0495609_0013383 | |||
| 397 | Ga0495645_0056493 | |||
| 398 | Ga0495633_0072864 | |||
| 399 | Ga0495668_0021467 | |||
| 400 | Ga0495668_0080661 | |||
| 401 | Ga0495634_0050960 | |||
| 402 | Ga0495625_0066635 | |||
| 403 | Ga0495625_0189168 | |||
| 404 | Ga0495635_0230285 | |||
| 405 | Ga0495661_0000673 | |||
| 406 | Ga0495661_0013772 | |||
| 407 | Ga0495670_0000005 | |||
| 408 | Ga0495671_0015129 | |||
| 409 | Ga0495674_0141755 | |||
| 410 | Ga0495683_0177251 | |||
| 411 | Ga0495677_0000332 | |||
| 412 | Ga0495684_0015917 | |||
| 413 | Ga0495686_0000054 | |||
| 414 | Ga0495686_0183774 | |||
| 415 | Ga0495615_0000331 | |||
| 416 | Ga0496102_0739804 | |||
| 417 | Ga0496103_0037283 | |||
| 418 | Ga0496104_0198140 | |||
| 419 | Ga0496104_0840418 | |||
| 420 | Ga0496105_0009161 | |||
| 421 | Ga0496109_0311150 | |||
| 422 | Ga0496110_0399051 | |||
| 423 | Ga0496113_0782899 | |||
| 424 | Ga0496115_0040084 | |||
| 425 | Ga0496115_0567055 | |||
| 426 | Ga0496116_0099176 | |||
| 427 | Ga0496117_0027451 | |||
| 428 | Ga0496118_0031953 | |||
| 429 | Ga0496119_0045660 | |||
| 430 | Ga0496120_0098644 | |||
| 431 | Ga0496121_0015697 | |||
| 432 | Ga0496122_0193714 | |||
| 433 | Ga0496125_0023227 | |||
| 434 | Ga0496126_0240021 | |||
| 435 | Ga0501034_0646917 | |||
| 436 | Ga0501037_0594702 | |||
| 437 | Ga0501047_0001107 | |||
| 438 | Ga0501238_000519 | |||
| 439 | Ga0501080_0007192 | |||
| 440 | Ga0501035_0036867 | |||
| 441 | Ga0495601_0252106 | |||
| 442 | Ga0500610_0108519 | |||
| 443 | Ga0500643_017389 | |||
| 444 | Ga0500658_0000136 | |||
| 445 | Ga0500559_0009600 | |||
| 446 | Ga0500559_0009861 | |||
| 447 | Ga0500559_0208823 | |||
| 448 | Ga0500624_000120 | |||
| 449 | Ga0500636_0002564 | |||
| 450 | Ga0500637_0000076 | |||
| 451 | Ga0500565_008125 | |||
| 452 | Ga0466962_0001765 | |||
| 453 | 2510892403 | |||
| 454 | 2513675339 | |||
| 455 | 2513857756 | |||
| 456 | 2513869024 | |||
| 457 | 2513910828 | |||
| 458 | 2513919293 | |||
| 459 | 2517098081 | |||
| 460 | 2517891015 | |||
| 461 | 2585844324 | |||
| 462 | 2599719519 | |||
| 463 | 2643814304 | |||
| 464 | 2644088463 | |||
| 465 | 2644343699 | |||
| 466 | 2644368823 | |||
| 467 | 2644498513 | |||
| 468 | 2671120068 | |||
| 469 | 2838662198 | |||
| 470 | 2838662487 | |||
| 471 | 2852394355 | |||
| 472 | 2903774479 | |||
| 473 | 2933018812 | |||
| 474 | 2933575537 | |||
| 475 | 2935635349 | |||
| 476 | 2941512153 | |||
| 477 | 2941519855 | |||
| 478 | 2941527858 | |||
| 479 | 3005481751 | |||
| 480 | 8054306214 | |||
| 481 | 8054464363 | |||
| 482 | 8054567089 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.7601 | 69 | 220 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.7582 | 69 | 220 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.7531 | 71 | 220 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.7495 | 70 | 220 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.7485 | 69 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9247 | 147 | 220 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9174 | 146 | 220 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9079 | 146 | 220 | 1.10.150.120 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.903 | 147 | 220 | 1.10.150.120 |
| 5g5hA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.8904 | 146 | 218 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7J781-F1-model_v4 | (2Fe-2S)-binding protein | 0.768 | 70 | 221 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A562ZQK9-F1-model_v4 | (2Fe-2S)-binding protein | 0.7674 | 69 | 220 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1H3E3I5-F1-model_v4 | Carbon-monoxide dehydrogenase small subunit | 0.7668 | 69 | 220 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A432IZA0-F1-model_v4 | (2Fe-2S)-binding protein | 0.7666 | 69 | 220 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-L1QLL2-F1-model_v4 | 2Fe-2S iron-sulfur cluster-binding domain protein | 0.7663 | 68 | 221 |
GO:0004854
GO:0006144 GO:0046872 GO:0051537 |